################################################################################################
# Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey
# Rundate: Fri Jul 22 23:24:51 2005
# Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Syntaxin.html
################################################################################################
#====================================
# Aligned_structures: 2
# 1: 1ez3a.pdb
# 2: 1fioa.pdb
#
# Length: 202
# Identity: 19/202 ( 9.4%) (Calculated as the percentage of conserved columns in the alignment.)
# Similarity: 19/202 ( 9.4%) (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps: 90/202 ( 44.6%) (Calculated as the percentage of columns with atleast one gap.)
#===========================================ALIGNMENT START=========================================
1ez3a.pdb 1 RDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPN---PDEKTKEELEELMSDI 57
1fioa.pdb 1 -MHDFVGFMNKISQINRDLDKYDHTINQVDSLHKRLLTEVNEEQA-SHLRHSLDNFVAQA 58
F I DK V H L N L
1ez3a.pdb 58 KKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYR 117
1fioa.pdb 59 TDLQFKLKNEIKSAQRDGIH----------DTNKQAQAENSRQRFLKLIQDYRIVDSNYK 108
K KS Q F Y S Y
1ez3a.pdb 118 ERCKGRI----------------------------------------------------- 124
1fioa.pdb 109 EENKEQAKRQYMIIQPEATEDEVEAAISDVGGQQIFSQALLEAKTALAEVQARHQELLKL 168
E K
1ez3a.pdb ----------------------
1fioa.pdb 169 EKSMAELTQLFNDMEELVIEQQ 190
#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue = Acidic,{D,E}
# Magenta = Basic,{K,R} and
# Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################