################################################################################################
# Program: MUSTANG-Lite v0.1: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey
# Rundate: Fri Jul 22 23:03:32 2005
# Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Ribosomal_L22.html
################################################################################################
#====================================
# Aligned_structures: 2
#   1: 1bxe.pdb
#   2: 1jj2q.pdb
#
# Length:        152
# Identity:       26/152 ( 17.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     26/152 ( 17.1%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           46/152 ( 30.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


1bxe.pdb                1  ------------EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNK--------   40
1jj2q.pdb               1  GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAV--IEGDQPVP   58
                                        AKA  R    S          I GK   EA   L             

1bxe.pdb               41  ------------------------RGAYFVAKVLESAAANAVNNHDLEDRLYVKAAYVDE   76
1jj2q.pdb              59  FKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHK  118
                                                            LE A  NA            K      

1bxe.pdb               77  GPALKRVLPRARGRADIIKKRTSHITVILGEK  108
1jj2q.pdb             119  VGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150
                                   PRA GRA            IL E 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################