################################################################################################
# Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey
# Rundate: Fri Jul 22 23:03:08 2005
# Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Ribosomal_L11.html
################################################################################################
#====================================
# Aligned_structures: 2
# 1: 1mmsa.pdb
# 2: 1qa6a.pdb
#
# Length: 71
# Identity: 41/ 71 ( 57.7%) (Calculated as the percentage of conserved columns in the alignment.)
# Similarity: 41/ 71 ( 57.7%) (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps: 5/ 71 ( 7.0%) (Calculated as the percentage of columns with atleast one gap.)
#===========================================ALIGNMENT START=========================================
1mmsa.pdb 1 KTPPASFLLKKAAGIEKGSSEPKRKIVGKVT-RKQIEEIAKTKMPDLNANSLEAAMKIIE 59
1qa6a.pdb 1 KTPPAAVLLKKAAGIESGS-GEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIE 59
KTPPA LLKKAAGIE GS R EIA KMPDLNA S EAAM IE
1mmsa.pdb 60 GTAKSMGIEVV 70
1qa6a.pdb 60 GTARSMGI--- 67
GTA SMGI
#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue = Acidic,{D,E}
# Magenta = Basic,{K,R} and
# Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################