################################################################################################
# Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey
# Rundate: Fri Jul 22 20:57:25 2005
# Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Lipoprotein_4.html
################################################################################################
#====================================
# Aligned_structures: 2
# 1: 1psza.pdb
# 2: 1toaa.pdb
#
# Length: 298
# Identity: 83/298 ( 27.9%) (Calculated as the percentage of conserved columns in the alignment.)
# Similarity: 83/298 ( 27.9%) (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps: 33/298 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.)
#===========================================ALIGNMENT START=========================================
1psza.pdb 1 KKDTTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEAD 60
1toaa.pdb 1 -------GKPLVVTTIGMIADAVKNIAQGDVHLKGLMGPGVDPHLYTATAGDVEWLGNAD 53
K VV T IAD KNIA L G DPH Y DV AD
1psza.pdb 61 LIFYNGINLETGGNAWFTKLVENAKKTENK---DYFAVSDGVDV---IYLEGQNEKG-KE 113
1toaa.pdb 54 LILYNGLHLET----KMGEVFSKLR-----GSRLVVAVSETIPVSQRLSLE-E----AEF 99
LI YNG LET AVS V LE
1psza.pdb 114 DPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPA 173
1toaa.pdb 100 DPHVWFDVKLWSYSVKAVYESLCKLLPGKTREFTQRYQAYQQQLDKLDAYVRRKAQSLPA 159
DPH W K L P Y LDKLD K PA
1psza.pdb 174 EKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESS 233
1toaa.pdb 160 ERRVLVTAHDAFGYFSRAYGFEVKGLQGVSTASEASAHDMQELAAFIAQRKLPAIFIESS 219
E VT AF YFS AYG T E L Q K P F ESS
1psza.pdb 234 VDDRPMKTVSQDTN-----IPIYAQIFTDSIAEQGKEGDSYYSMMKYNLDKIAEGLAK 286
1toaa.pdb 220 IPHKNVEALRDAVQARGHVVQIGGELFSDAMGDAGTSEGTYVGMVTHNIDTIVAALAR 277
I F D G Y M N D I LA
#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue = Acidic,{D,E}
# Magenta = Basic,{K,R} and
# Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################