################################################################################################
# Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey
# Rundate: Fri Jul 22 19:47:11 2005
# Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/Esterase.html
################################################################################################
#====================================
# Aligned_structures: 2
# 1: 1dqza.pdb
# 2: 1f0na.pdb
#
# Length: 285
# Identity: 201/285 ( 70.5%) (Calculated as the percentage of conserved columns in the alignment.)
# Similarity: 201/285 ( 70.5%) (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps: 6/285 ( 2.1%) (Calculated as the percentage of columns with atleast one gap.)
#===========================================ALIGNMENT START=========================================
1dqza.pdb 1 -RPGLPVEYLQVPSASMGRDIKVQFQGG---GPHAVYLLDGLRAQDDYNGWDINTPAFEE 56
1f0na.pdb 1 SRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNS-PAVYLLDGLRAQDDYNGWDINTPAFEW 59
RPGLPVEYLQVPS SMGRDIKVQFQ G AVYLLDGLRAQDDYNGWDINTPAFE
1dqza.pdb 57 YYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGN 116
1f0na.pdb 60 YYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGS 119
YYQSGLS MPVGGQSSFY DWY P TYKWETFLT E P WL AN V PTG
1dqza.pdb 117 AAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSESWWPTLIGLAMNDSGGYNANSMW 176
1f0na.pdb 120 AAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMW 179
AA GLSM G SA ILAAY PQQF YA SLS L PS P LIGLAM D GGY A MW
1dqza.pdb 177 GPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTF 236
1f0na.pdb 180 GPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKF 239
GPSSDPAW RNDP QIP LVANNTR WVYCGNGTP LGG NIPA FLE N F
1dqza.pdb 237 RDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG- 280
1f0na.pdb 240 QDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG 284
D Y A GG N VFNFPPNGTHSW YW QL AMK D Q L
#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue = Acidic,{D,E}
# Magenta = Basic,{K,R} and
# Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################