################################################################################################
# Program: MUSTANG-Lite v0.1: A Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, A. M. Lesk, J. C. Whisstock, and P. J. Stuckey
# Rundate: Sat Jul 23 01:59:52 2005
# Report_file: /mnt/EXTRA_STORAGE/MUSTANG_RESULTS/HOMSTRAD_Datasets/results/E2_C.html
################################################################################################
#====================================
# Aligned_structures: 3
# 1: 1a7ge.pdb
# 2: 1by9.pdb
# 3: 2bopa.pdb
#
# Length: 90
# Identity: 20/ 90 ( 22.2%) (Calculated as the percentage of conserved columns in the alignment.)
# Similarity: 56/ 90 ( 62.2%) (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps: 19/ 90 ( 21.1%) (Calculated as the percentage of columns with atleast one gap.)
#===========================================ALIGNMENT START=========================================
1a7ge.pdb 1 ATTPIIHLKGDANILKCLRYRL-SKYKQLYEQVSSTWHWTC-----TDGKHKNAIVTLTY 54
1by9.pdb 1 -TTPIVHLKGDANTLKCLRYRF-KKHCTLYTAVSSTWHWT-------------AIVTLTY 45
2bopa.pdb 1 --SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQG---QAQILITF 55
tpi hlkGdAN lKClRyR kkh lYe vssTWhwt AivtlTy
1a7ge.pdb 55 ISTSQRDDFLNTVVIPNTVSVSTGYMTI-- 82
1by9.pdb 46 DSEWQRDQFLSQVKIPKTITVSTGFMS--- 72
2bopa.pdb 56 GSPSQRQDFLKHVPLPPGMNISGFTASLDF 85
S sQRddFL V iP t vStg ms
#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue = Acidic,{D,E}
# Magenta = Basic,{K,R} and
# Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################