################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:23 2021 # Report_file: c_1434_69.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00358.pdb # 2: usage_00359.pdb # 3: usage_00360.pdb # 4: usage_00684.pdb # 5: usage_00685.pdb # 6: usage_01493.pdb # # Length: 81 # Identity: 61/ 81 ( 75.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/ 81 ( 75.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 81 ( 24.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00358.pdb 1 KGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFS 60 usage_00359.pdb 1 -----------------SLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYF---KSPFS 40 usage_00360.pdb 1 KGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFS 60 usage_00684.pdb 1 -----------------SLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFS 43 usage_00685.pdb 1 KGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFS 60 usage_01493.pdb 1 -----------------SLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFS 43 SLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYF KSPFS usage_00358.pdb 61 ALNIAVHELSDVGRAIVRNLL 81 usage_00359.pdb 41 ALNIAVHELSDVGRAIVRNLL 61 usage_00360.pdb 61 ALNIAVHELSDVGRAIVRNLL 81 usage_00684.pdb 44 ALNIAVHELSDVGRAIVRNLL 64 usage_00685.pdb 61 ALNIAVHELSDVGRAIVRNLL 81 usage_01493.pdb 44 ALNIAVHELSDVGRAIVRNLL 64 ALNIAVHELSDVGRAIVRNLL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################