################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:17:53 2021 # Report_file: c_1269_72.html ################################################################################################ #==================================== # Aligned_structures: 19 # 1: usage_00071.pdb # 2: usage_00072.pdb # 3: usage_00073.pdb # 4: usage_00074.pdb # 5: usage_00108.pdb # 6: usage_00109.pdb # 7: usage_00110.pdb # 8: usage_00111.pdb # 9: usage_00112.pdb # 10: usage_00113.pdb # 11: usage_00114.pdb # 12: usage_00115.pdb # 13: usage_00561.pdb # 14: usage_00562.pdb # 15: usage_00563.pdb # 16: usage_00623.pdb # 17: usage_00624.pdb # 18: usage_01407.pdb # 19: usage_01408.pdb # # Length: 35 # Identity: 31/ 35 ( 88.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 35 ( 91.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 35 ( 8.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00071.pdb 1 TPTWINITGIHRTDVVQRVGEFFGTHPLVLEDILN 35 usage_00072.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDILN 34 usage_00073.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDILN 34 usage_00074.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 33 usage_00108.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 33 usage_00109.pdb 1 TPTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 34 usage_00110.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 33 usage_00111.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 33 usage_00112.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 33 usage_00113.pdb 1 TPTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 34 usage_00114.pdb 1 TPTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 34 usage_00115.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 33 usage_00561.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDILN 34 usage_00562.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDILN 34 usage_00563.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDILN 34 usage_00623.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 33 usage_00624.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDIL- 33 usage_01407.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDI-- 32 usage_01408.pdb 1 -PTWINITGIHRTDVVQRVGEFFGIHPLVLEDILN 34 PTWINITGIHRTDVVQRVGEFFGiHPLVLEDI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################