################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:17:52 2021 # Report_file: c_0842_3.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00358.pdb # 2: usage_00359.pdb # 3: usage_00360.pdb # 4: usage_00389.pdb # 5: usage_00390.pdb # 6: usage_00571.pdb # 7: usage_00605.pdb # 8: usage_00784.pdb # 9: usage_00786.pdb # 10: usage_00857.pdb # # Length: 83 # Identity: 46/ 83 ( 55.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 68/ 83 ( 81.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 83 ( 1.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00358.pdb 1 MDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIY 60 usage_00359.pdb 1 MDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIY 60 usage_00360.pdb 1 MDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIY 60 usage_00389.pdb 1 MDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIY 60 usage_00390.pdb 1 MDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIY 60 usage_00571.pdb 1 MDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIY 60 usage_00605.pdb 1 ISNLYNMIKSVASDCSDPTLLGNFIENHDNPRFAKYTSDYSQAKNVLSYIFLSDGIPIVY 60 usage_00784.pdb 1 MDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIY 60 usage_00786.pdb 1 MDDLYNMINTVKSDCPDSTLLGTFVENHDNPRFASYTNDIALAKNVAAFIILNDGIPIIY 60 usage_00857.pdb 1 -WSLVDNINKVFQTCNDPRLLGTFSENHDIPRFASYTQDLALAKNVLAFTILFDGIPIVY 59 LynmIn V sdC D tLLGtF ENHDnPRFAsYT D alAKNV afiiL DGIPI Y usage_00358.pdb 61 AGQEQHYAGGNDPANREATWLSG 83 usage_00359.pdb 61 AGQEQHYAGGNDPANREATWLSG 83 usage_00360.pdb 61 AGQEQHYAGGNDPANREATWLSG 83 usage_00389.pdb 61 AGQEQHYAGGNDPANREATWLSG 83 usage_00390.pdb 61 AGQEQHYAGGNDPANREATWLSG 83 usage_00571.pdb 61 AGQEQHYAGGNDPANREATWLSG 83 usage_00605.pdb 61 AGEEQHYAGGKVPYNREATWLSG 83 usage_00784.pdb 61 AGQEQHYAGGNDPANREATWLSG 83 usage_00786.pdb 61 AGQEQHYAGGNDPANREATWLSG 83 usage_00857.pdb 60 AGQEQQYSGDSDPYNREALWLSG 82 AGqEQhYaGg dP NREAtWLSG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################