################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:57 2021 # Report_file: c_1261_155.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_03492.pdb # 2: usage_03493.pdb # 3: usage_03494.pdb # 4: usage_03495.pdb # 5: usage_03496.pdb # 6: usage_03597.pdb # 7: usage_03598.pdb # 8: usage_03599.pdb # 9: usage_03600.pdb # # Length: 39 # Identity: 17/ 39 ( 43.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 39 ( 43.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 39 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_03492.pdb 1 ---NIGIVHVGAPSAALNAATRAATLYCLSHGHKPYAIM 36 usage_03493.pdb 1 KRLKIAIVNVGAPAGGINSAVYSMATYCMSQGHRPYAIY 39 usage_03494.pdb 1 ---NIGIVHVGAPSAALNAATRAATLYCLSHGHKPYAIM 36 usage_03495.pdb 1 KRLKIAIVNVGAPAGGINSAVYSMATYCMSQGHRPYAIY 39 usage_03496.pdb 1 KRLKIAIVNVGAPAGGINSAVYSMATYCMSQGHRPYAIY 39 usage_03597.pdb 1 ---KIAIINVGAPAGGMNSAVYSMATYCMSRGHVPYAIH 36 usage_03598.pdb 1 ---KIAIINVGAPAGGMNSAVYSMATYCMSRGHVPYAIH 36 usage_03599.pdb 1 ---KIAIINVGAPAGGMNSAVYSMATYCMSRGHVPYAIH 36 usage_03600.pdb 1 ---KIAIINVGAPAGGMNSAVYSMATYCMSRGHVPYAIH 36 I I VGAP N A YC S GH PYAI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################