################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:49 2021 # Report_file: c_1184_57.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00119.pdb # 2: usage_00566.pdb # 3: usage_00614.pdb # 4: usage_00780.pdb # 5: usage_01173.pdb # 6: usage_01348.pdb # 7: usage_01392.pdb # 8: usage_01564.pdb # 9: usage_01652.pdb # 10: usage_01835.pdb # 11: usage_02297.pdb # # Length: 31 # Identity: 3/ 31 ( 9.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 31 ( 32.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 31 ( 29.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00119.pdb 1 QRTDAPKTHMTHHAVSDHEATLRCWALS--- 28 usage_00566.pdb 1 LRSDPPKAHVTRHPRPEGDVTLRCWALG--- 28 usage_00614.pdb 1 -RTDSPKAHVTHHPRSKGEVTLRCWALG--- 27 usage_00780.pdb 1 DRQDPPSVVVTSHQAPGEKKKLKCLAYD--- 28 usage_01173.pdb 1 QRTDAPKTHMTHHAVSDHEATLRCWALS--- 28 usage_01348.pdb 1 QRTDAPKTHMTHHAVSDHEATLRCWALSFYP 31 usage_01392.pdb 1 QRADPPKTHVTHHPVFDYEATLRCWALG--- 28 usage_01564.pdb 1 QRTDAPKTHMTHHAVSDHEATLRCWALS--- 28 usage_01652.pdb 1 ----PPKTHVTHHPISDHEATLRCWALG--- 24 usage_01835.pdb 1 TDSPKAHVTHHSRP--EDKVTLRCWALG--- 26 usage_02297.pdb 1 QRTDAPKTHMTHHAVSDHEATLRCWALS--- 28 p t h tLrCwAl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################