################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:17:32 2021 # Report_file: c_1487_146.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00083.pdb # 2: usage_00085.pdb # 3: usage_00105.pdb # 4: usage_00107.pdb # 5: usage_00148.pdb # 6: usage_00150.pdb # 7: usage_00685.pdb # 8: usage_01035.pdb # 9: usage_02401.pdb # 10: usage_02403.pdb # 11: usage_02405.pdb # 12: usage_02407.pdb # 13: usage_02415.pdb # 14: usage_02417.pdb # 15: usage_03719.pdb # 16: usage_04292.pdb # 17: usage_04294.pdb # # Length: 41 # Identity: 3/ 41 ( 7.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 41 ( 24.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 41 ( 29.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00083.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_00085.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_00105.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_00107.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_00148.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_00150.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_00685.pdb 1 LS-QLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETE-- 38 usage_01035.pdb 1 LS-QLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYK 40 usage_02401.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_02403.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_02405.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_02407.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_02415.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_02417.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_03719.pdb 1 -DDLVEAFTFF-KDEKNRKEYGKRVQDFVKTK--------- 30 usage_04292.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 usage_04294.pdb 1 LD-QLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVR-- 38 ql l F D f kQ nk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################