################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:08 2021 # Report_file: c_0870_16.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00226.pdb # 2: usage_00227.pdb # 3: usage_00228.pdb # 4: usage_00364.pdb # 5: usage_00365.pdb # 6: usage_00366.pdb # 7: usage_00395.pdb # 8: usage_00396.pdb # # Length: 67 # Identity: 49/ 67 ( 73.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 67 ( 74.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 67 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00226.pdb 1 DVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGK 60 usage_00227.pdb 1 DVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGK 60 usage_00228.pdb 1 DVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRVE---- 56 usage_00364.pdb 1 DVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGK 60 usage_00365.pdb 1 -VLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGK 59 usage_00366.pdb 1 -VLEIMAKS----GYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRE----- 50 usage_00395.pdb 1 -VLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGK 59 usage_00396.pdb 1 DVLEIMAKSVPPSGYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRELPSGK 60 VLEIMAKS GYISPAEIAAQLPTTNPEAPVMLDRVLRLLASYSVVTYTLRe usage_00226.pdb 61 VERLY-- 65 usage_00227.pdb 61 VERLY-- 65 usage_00228.pdb 57 RLYGL-- 61 usage_00364.pdb 61 VERLYGL 67 usage_00365.pdb 60 VERLYGL 66 usage_00366.pdb 51 RLYGL-- 55 usage_00395.pdb 60 VERLY-- 64 usage_00396.pdb 61 VERLY-- 65 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################