################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:01:52 2021 # Report_file: c_0709_52.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00122.pdb # 2: usage_00221.pdb # 3: usage_00222.pdb # 4: usage_00243.pdb # 5: usage_00342.pdb # 6: usage_00343.pdb # 7: usage_00466.pdb # 8: usage_00467.pdb # 9: usage_00541.pdb # 10: usage_00542.pdb # 11: usage_00561.pdb # 12: usage_00562.pdb # 13: usage_00674.pdb # # Length: 63 # Identity: 59/ 63 ( 93.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 63 ( 95.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 63 ( 3.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00122.pdb 1 NCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 60 usage_00221.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 59 usage_00222.pdb 1 NCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 60 usage_00243.pdb 1 NCETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 60 usage_00342.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 59 usage_00343.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 59 usage_00466.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEALLAPSAPTLTLAKF 59 usage_00467.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEALLAPSAPTLTLAKF 59 usage_00541.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 59 usage_00542.pdb 1 -CETGGSFGDSIHCRGHAAGDYAAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 59 usage_00561.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 59 usage_00562.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 59 usage_00674.pdb 1 -CETGGSFGDSIHCRGHAAGDYYAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKF 59 CETGGSFGDSIHCRGHAAGDYyAYATFGFTSAAADAKVDSKSQE LLAPSAPTLTLAKF usage_00122.pdb 61 NQV 63 usage_00221.pdb 60 NQV 62 usage_00222.pdb 61 NQV 63 usage_00243.pdb 61 NQ- 62 usage_00342.pdb 60 NQV 62 usage_00343.pdb 60 NQV 62 usage_00466.pdb 60 NQV 62 usage_00467.pdb 60 NQV 62 usage_00541.pdb 60 NQV 62 usage_00542.pdb 60 NQV 62 usage_00561.pdb 60 NQV 62 usage_00562.pdb 60 NQV 62 usage_00674.pdb 60 NQV 62 NQ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################