################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:21 2021 # Report_file: c_1409_190.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00245.pdb # 2: usage_00615.pdb # 3: usage_00616.pdb # 4: usage_01089.pdb # 5: usage_01132.pdb # 6: usage_01175.pdb # 7: usage_01176.pdb # 8: usage_01177.pdb # 9: usage_01444.pdb # 10: usage_01445.pdb # 11: usage_01621.pdb # 12: usage_01766.pdb # 13: usage_01767.pdb # # Length: 38 # Identity: 4/ 38 ( 10.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 38 ( 15.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 38 ( 31.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00245.pdb 1 -----RAARTVLWDYGNMVSASVGYILDEMRRKSAAKG 33 usage_00615.pdb 1 DPTKLIPTRHVMSEYGNMSSACVHFILDQTRKASLQN- 37 usage_00616.pdb 1 DPTKLIPTRHVMSEYGNMSSACVHFILDQTRKASLQN- 37 usage_01089.pdb 1 -----KVTRQVLKDYGNMSSATVFFIMDEMRKKSLENG 33 usage_01132.pdb 1 -----AASRRVLSDYGNMSGATVIFALDELRRQRK--- 30 usage_01175.pdb 1 ------ASRDVLASYGNMSSASVLFVLDQIRKNSEELH 32 usage_01176.pdb 1 ------ASRDVLASYGNMSSASVLFVLDQIRKNSEELH 32 usage_01177.pdb 1 ------ASRDVLASYGNMSSASVLFVLDQIRKNSEELH 32 usage_01444.pdb 1 -----RASYDRYINHGNSSSATIFSVLNRLRE------ 27 usage_01445.pdb 1 -----RASYDRYINHGNSSSATIFSVLNRLRE------ 27 usage_01621.pdb 1 ----LEATRHVLSEYGNMSSACVLFILDEMRKKSLKG- 33 usage_01766.pdb 1 -----KVTRQVLKDYGNMSSATVFFIMDEMRKKSLENG 33 usage_01767.pdb 1 -----KVTRQVLKDYGNMSSATVFFIMDEMRKKSLENG 33 GN ssA R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################