################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:42 2021 # Report_file: c_0905_139.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00018.pdb # 2: usage_00038.pdb # 3: usage_00344.pdb # 4: usage_00500.pdb # 5: usage_00687.pdb # 6: usage_00896.pdb # 7: usage_00992.pdb # 8: usage_01002.pdb # 9: usage_01079.pdb # # Length: 41 # Identity: 6/ 41 ( 14.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 41 ( 14.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 41 ( 53.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 RLKLGKPLG-RG--GQVIEADAFGID-----TCRTVAVKML 33 usage_00038.pdb 1 --------LGRGAFGQVIEADAFGID-----TCRTVAVKM- 27 usage_00344.pdb 1 RLVLGKPLGEG-AFGQVVLAEAIGLDKDKPNRVTKVAVKML 40 usage_00500.pdb 1 RLKLGKPLG-----GQVIEADAFGIDKTA--TCRTVAVKML 34 usage_00687.pdb 1 --------GEG-AFGKVFLAECHNLLP-Q--DKMLVAVKAL 29 usage_00896.pdb 1 RLVLGKPLG------QVVLAEAIGL----PNRVTKVAVKML 31 usage_00992.pdb 1 RLKLGKPLGR----GQVIEADAFGIDKTA--TCRTVAVKML 35 usage_01002.pdb 1 --VLKREL-------KVFLAECYNLSPTK--DKMLVAVKAL 30 usage_01079.pdb 1 RLVLGKPLGEG-AFGQVVLAEAIGLDKDKPNRVTKVAVKML 40 V A VAVK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################