################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:01 2021 # Report_file: c_0703_137.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00027.pdb # 2: usage_00028.pdb # 3: usage_00029.pdb # 4: usage_00030.pdb # 5: usage_00031.pdb # 6: usage_00082.pdb # 7: usage_00531.pdb # 8: usage_00532.pdb # 9: usage_00533.pdb # 10: usage_00534.pdb # 11: usage_00988.pdb # # Length: 63 # Identity: 41/ 63 ( 65.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 63 ( 65.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 63 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00027.pdb 1 -----GPEIADRPPANGQRGRIDYYWSVLKPGETLNVESNGNLIAPWYAYKFTSSRHKGA 55 usage_00028.pdb 1 -----GPEIADRPPANGQRGRIDYYWSVLKPGETLNVESNGNLIAPWYAYKFTSSRHKGA 55 usage_00029.pdb 1 -----GPEIADRPPANGQRGRIDYYWSVLKPGETLNVESNGNLIAPWYAYKFTSSRHKGA 55 usage_00030.pdb 1 -----GPEIADRPPANGQRGRIDYYWSVLKPGETLNVESNGNLIAPWYAYKFTSSRHKGA 55 usage_00031.pdb 1 -----GPEIADRPPANGQRGRIDYYWSVLKPGETLNVESNGNLIAPWYAYKFTSSRHKGA 55 usage_00082.pdb 1 MNFAKSPEIAARPAVNGQRSRIDYYWSVLRPGETLNVESNGNLIAPWYAYKFVSTNKKGA 60 usage_00531.pdb 1 -----SPEIAARPAVNGQRGRIDYFWSILKPGETLNVESNGNLIAPWYAYRFVNKDSKGA 55 usage_00532.pdb 1 -----SPEIAARPAVNGQRGRIDYFWSILKPGETLNVESNGNLIAPWYAYRFVNKDSKGA 55 usage_00533.pdb 1 MNFAKSPEIAARPAVNGQRSRIDYYWSVLRPGETLNVESNGNLIAPWYAYKFVSTNKKGA 60 usage_00534.pdb 1 MNFAKSPEIAARPAVNGQRSRIDYYWSVLRPGETLNVESNGNLIAPWYAYKFVSTNKKGA 60 usage_00988.pdb 1 MNFAKSPEIAARPAVNGQRSRIDYYWSVLRPGETLNVESNGNLIAPWYAYKFVSTNKKGA 60 PEIA RP NGQR RIDY WS L PGETLNVESNGNLIAPWYAY F KGA usage_00027.pdb 56 I-- 56 usage_00028.pdb 56 I-- 56 usage_00029.pdb 56 I-- 56 usage_00030.pdb 56 I-- 56 usage_00031.pdb 56 I-- 56 usage_00082.pdb 61 VFK 63 usage_00531.pdb 56 IF- 57 usage_00532.pdb 56 I-- 56 usage_00533.pdb 61 VFK 63 usage_00534.pdb 61 VFK 63 usage_00988.pdb 61 VFK 63 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################