################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:03 2021 # Report_file: c_0736_36.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00024.pdb # 2: usage_00122.pdb # 3: usage_00146.pdb # 4: usage_00147.pdb # 5: usage_00205.pdb # 6: usage_00324.pdb # 7: usage_00538.pdb # 8: usage_00539.pdb # 9: usage_00540.pdb # 10: usage_00720.pdb # # Length: 69 # Identity: 11/ 69 ( 15.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 69 ( 21.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 69 ( 33.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00024.pdb 1 KGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLK----------- 49 usage_00122.pdb 1 HGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVIN------DLAPK 54 usage_00146.pdb 1 ---NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN------DTPPA 51 usage_00147.pdb 1 ---NLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN------DTPPA 51 usage_00205.pdb 1 ---SLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVPPK 57 usage_00324.pdb 1 ---NLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVT------YLPPK 51 usage_00538.pdb 1 --VSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVIN------DLAPK 52 usage_00539.pdb 1 --VSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVIN------DLAPK 52 usage_00540.pdb 1 ---SLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELT----------- 46 usage_00720.pdb 1 -GVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVIN------DLAPK 53 l Ge GpSG GK T lR LE G usage_00024.pdb --------- usage_00122.pdb 55 DRDVAMVF- 62 usage_00146.pdb 52 ERGVGMVF- 59 usage_00147.pdb 52 ERGVGMVF- 59 usage_00205.pdb 58 DRDIAMVF- 65 usage_00324.pdb 52 DRNISMVF- 59 usage_00538.pdb 53 DRDVAMVF- 60 usage_00539.pdb 53 DRDVAMVF- 60 usage_00540.pdb 47 --------T 47 usage_00720.pdb 54 DRDVAMVF- 61 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################