################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:42:57 2021
# Report_file: c_1201_124.html
################################################################################################
#====================================
# Aligned_structures: 16
#   1: usage_00060.pdb
#   2: usage_00202.pdb
#   3: usage_00210.pdb
#   4: usage_00223.pdb
#   5: usage_00224.pdb
#   6: usage_00225.pdb
#   7: usage_00475.pdb
#   8: usage_00566.pdb
#   9: usage_00842.pdb
#  10: usage_01022.pdb
#  11: usage_01139.pdb
#  12: usage_01144.pdb
#  13: usage_01145.pdb
#  14: usage_01146.pdb
#  15: usage_01147.pdb
#  16: usage_01502.pdb
#
# Length:         31
# Identity:       11/ 31 ( 35.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     11/ 31 ( 35.5%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 31 ( 12.9%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00060.pdb         1  VGYGIQKGNKHWIIKNSWGENWGNKGYILMA   31
usage_00202.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
usage_00210.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
usage_00223.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
usage_00224.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
usage_00225.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
usage_00475.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
usage_00566.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
usage_00842.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
usage_01022.pdb         1  VGYGIQKGNKHWIIKNSWGENWGNKGYILMA   31
usage_01139.pdb         1  --VGYGP--NYILIRNSWGTGWGENGYIRIK   27
usage_01144.pdb         1  --VGYGP--NYILIRNSWGTGWGENGYIRIK   27
usage_01145.pdb         1  --VGYGP--NYILIRNSWGTGWGENGYIRIK   27
usage_01146.pdb         1  --VGYGP--NYILIRNSWGTGWGENGYIRIK   27
usage_01147.pdb         1  --VGYGP--NYILIRNSWGTGWGENGYIRIK   27
usage_01502.pdb         1  --VGYGP--NYILIKNSWGTGWGENGYIRIK   27
                              G         I NSWG  WG  GYI   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################