################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:14:00 2021
# Report_file: c_1208_87.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_00169.pdb
#   2: usage_01117.pdb
#   3: usage_01118.pdb
#   4: usage_01119.pdb
#   5: usage_01120.pdb
#   6: usage_01121.pdb
#   7: usage_01122.pdb
#   8: usage_01123.pdb
#   9: usage_01124.pdb
#  10: usage_01125.pdb
#  11: usage_01170.pdb
#  12: usage_01969.pdb
#  13: usage_02019.pdb
#  14: usage_02475.pdb
#
# Length:         32
# Identity:       13/ 32 ( 40.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     27/ 32 ( 84.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 32 ( 12.5%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00169.pdb         1  FFSKLGESG-SYVPRAIMVDLEPSVIDNVKAT   31
usage_01117.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01118.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01119.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01120.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01121.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01122.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01123.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01124.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01125.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01170.pdb         1  YYNEAA--GNKYVPRAILVDLEPGTMDSVRS-   29
usage_01969.pdb         1  YYNEAS--SHKYVPRAILVDLEPGTMDSVRS-   29
usage_02019.pdb         1  YYNEAT--GNKYVPRAILVDLEPGTMDSVRSG   30
usage_02475.pdb         1  YYNEAT--GNKYVPRAILVDLEPGTMDSVRSG   30
                           yynea   g kYVPRAIlVDLEPgtmDsVrs 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################