################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 22:54:57 2021
# Report_file: c_1481_340.html
################################################################################################
#====================================
# Aligned_structures: 2
#   1: usage_02553.pdb
#   2: usage_02557.pdb
#
# Length:         30
# Identity:       30/ 30 (100.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     30/ 30 (100.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            0/ 30 (  0.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_02553.pdb         1  DAEYYIENQVLPAVERILRAFGYRKEDLKY   30
usage_02557.pdb         1  DAEYYIENQVLPAVERILRAFGYRKEDLKY   30
                           DAEYYIENQVLPAVERILRAFGYRKEDLKY


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################