################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:51:36 2021 # Report_file: c_0832_50.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00047.pdb # 2: usage_00107.pdb # 3: usage_00180.pdb # 4: usage_00181.pdb # 5: usage_00193.pdb # 6: usage_00194.pdb # 7: usage_00195.pdb # 8: usage_00196.pdb # 9: usage_00197.pdb # 10: usage_00668.pdb # 11: usage_00702.pdb # 12: usage_00819.pdb # # Length: 56 # Identity: 12/ 56 ( 21.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 56 ( 28.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 56 ( 26.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00047.pdb 1 DEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEILEEYGKPIDYVINIEVD 56 usage_00107.pdb 1 DDLIIALIEEVFP-K--HGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVP 53 usage_00180.pdb 1 DDLIIALIEEVFP-K--HGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEV- 52 usage_00181.pdb 1 DDLIIALIEEVFP-K--HGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVP 53 usage_00193.pdb 1 DDLIIALIEEVFP-K--HGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVP 53 usage_00194.pdb 1 DDLIIALIEEVFP-K--HGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVP 53 usage_00195.pdb 1 DDLIIALIEEVFP-K--HGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVP 53 usage_00196.pdb 1 DDLIIALIEEVFP-K--HGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVP 53 usage_00197.pdb 1 DDLIIALIEEVFP-K--HGNVIFDGFPRTVKQAEALDEMLEKKGLKVDHVLLFEVP 53 usage_00668.pdb 1 ----DDLILELIREE-LAERVIFDGFPRTLAQAEALDRLLSETGTRLLGVVLVEVP 51 usage_00702.pdb 1 -EVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEILEEMGKPIDYVINIQVD 55 usage_00819.pdb 1 DSLIIGLVKERLKEADCANGYLFDGFPRTIAQADAK-----EAGVAIDYVLEI--- 48 i E DGFPRT QAeAl G d V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################