################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:35 2021 # Report_file: c_1172_101.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00173.pdb # 2: usage_00353.pdb # 3: usage_00590.pdb # 4: usage_01181.pdb # 5: usage_01531.pdb # 6: usage_02277.pdb # 7: usage_03014.pdb # 8: usage_03015.pdb # 9: usage_03862.pdb # 10: usage_04699.pdb # # Length: 31 # Identity: 1/ 31 ( 3.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 31 ( 16.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 31 ( 25.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00173.pdb 1 ---LGTGSFGRVMLVKHKE-SGNHYAMKILD 27 usage_00353.pdb 1 ---LGTGSFGRVMLVKHKE-SGNHYAMKILD 27 usage_00590.pdb 1 ----GL-GVGKVLECFHRR-TGQKCALKLLY 25 usage_01181.pdb 1 ---LGTGSFGRVMLVKHKE-SGNHYAMKILD 27 usage_01531.pdb 1 ----GTGSFGRVMLVKHME-TGNHYAMKILD 26 usage_02277.pdb 1 ----GWGHFSTVWLAKDMV-NNTHVAMKIVR 26 usage_03014.pdb 1 ---LGTGSFGRVMLVKHKE-TGNHYAMKILD 27 usage_03015.pdb 1 ---LGTGSFGRVMLVKHKE-TGNHYAMKILD 27 usage_03862.pdb 1 ---RT-SPFFSVYVSADSKNSNSNVIQVDQ- 26 usage_04699.pdb 1 VKVIGRGAFGEVQLVRHKS-TRKVYAMKLLS 30 g f V a k #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################