################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:04 2021 # Report_file: c_1283_38.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00241.pdb # 2: usage_01087.pdb # 3: usage_01088.pdb # 4: usage_01089.pdb # 5: usage_01090.pdb # 6: usage_01091.pdb # 7: usage_01092.pdb # 8: usage_01188.pdb # 9: usage_01585.pdb # 10: usage_01587.pdb # 11: usage_01588.pdb # # Length: 37 # Identity: 2/ 37 ( 5.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 37 ( 40.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 37 ( 13.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00241.pdb 1 -HCFTGNCVIDWLVSN-QSVRNRQEGLMIASSLLNEG 35 usage_01087.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 usage_01088.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 usage_01089.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 usage_01090.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 usage_01091.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 usage_01092.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 usage_01188.pdb 1 MLRL-DNTLEEIIFKLVPG--LREQELERESEFWKKN 34 usage_01585.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 usage_01587.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 usage_01588.pdb 1 -NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG 36 f g v dwl g R e aS llk g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################