################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:44 2021 # Report_file: c_1368_20.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00804.pdb # 2: usage_00812.pdb # 3: usage_00813.pdb # 4: usage_01050.pdb # 5: usage_01051.pdb # 6: usage_01160.pdb # 7: usage_01161.pdb # 8: usage_01303.pdb # 9: usage_01304.pdb # # Length: 65 # Identity: 23/ 65 ( 35.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/ 65 ( 75.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 65 ( 24.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00804.pdb 1 ------------LPRILTALCVGAGLALSGVVLQGIFRNPLVNPHIIGVTSGSAFGGTLA 48 usage_00812.pdb 1 ------------LPRTLAVLLVGAALAISGAV-QALFENPLAEPGLLGVSNGAGVGLIAA 47 usage_00813.pdb 1 --------------RTLAVLLVGAALAISGAV-QALFENPLAEPGLLGVSNGAGVGLIAA 45 usage_01050.pdb 1 ----ELFVWQIRLPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAA 56 usage_01051.pdb 1 ------------LPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAA 48 usage_01160.pdb 1 -------------PRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAA 47 usage_01161.pdb 1 -------------PRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAA 47 usage_01303.pdb 1 TPRGELFVWQIRLPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAA 60 usage_01304.pdb 1 TPRGELFVWQIRLPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAA 60 RtLavLlVGAaLAiSGaV QalFeNPLaePgllGVsnGagvGliaA usage_00804.pdb 49 IFFG- 52 usage_00812.pdb 48 VLLGQ 52 usage_00813.pdb 46 VLLG- 49 usage_01050.pdb 57 VLLGQ 61 usage_01051.pdb 49 VLLGQ 53 usage_01160.pdb 48 VLLGQ 52 usage_01161.pdb 48 VLLGQ 52 usage_01303.pdb 61 VLLGQ 65 usage_01304.pdb 61 VLLGQ 65 vllG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################