################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:48 2021 # Report_file: c_1115_144.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00022.pdb # 2: usage_01091.pdb # 3: usage_01273.pdb # 4: usage_01274.pdb # 5: usage_01275.pdb # 6: usage_01454.pdb # 7: usage_01455.pdb # 8: usage_01456.pdb # # Length: 65 # Identity: 24/ 65 ( 36.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 65 ( 61.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 65 ( 1.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 MEVFDGIRQASLADRSQLYKDLASGPFFGFNQPGAKSSAGMVDWFWLQGMAAGHKNAYDC 60 usage_01091.pdb 1 -SVFDGFQAQVASNRAQFYRDVPAGPFYGYNRPGVEASEGIIGNWWRQGMIGSAKAHYDG 59 usage_01273.pdb 1 KSVFDDFQAHVAANRAQFYLDVPAGPFYGYNRPGAKPSEGVIYNWWRQGMMGSTKAQYDG 60 usage_01274.pdb 1 KSVFDDFQAHVAANRAQFYLDVPAGPFYGYNRPGAKPSEGVIYNWWRQGMMGSTKAQYDG 60 usage_01275.pdb 1 KSVFDDFQAHVAANRAQFYLDVPAGPFYGYNRPGAKPSEGVIYNWWRQGMMGSTKAQYDG 60 usage_01454.pdb 1 LEVFDEFRAALAANRAQFYIDVPSGPFYGFNREGATVSQGLIDHWWLQGMMGAANAHYEC 60 usage_01455.pdb 1 -EVFDEFRAALAANRAQFYIDVPSGPFYGFNREGATVSQGLIDHWWLQGMMGAANAHYEC 59 usage_01456.pdb 1 -EVFDEFRAALAANRAQFYIDVPSGPFYGFNREGATVSQGLIDHWWLQGMMGAANAHYEC 59 VFD f a aanRaQfY Dvp GPFyG Nr Ga S G i wW QGM g a Y usage_00022.pdb 61 IKAFS 65 usage_01091.pdb 60 IVAFS 64 usage_01273.pdb 61 IVAFS 65 usage_01274.pdb 61 IVAFS 65 usage_01275.pdb 61 IVAFS 65 usage_01454.pdb 61 IAAFS 65 usage_01455.pdb 60 IAAFS 64 usage_01456.pdb 60 IAAFS 64 I AFS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################