################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:21:55 2021 # Report_file: c_0275_4.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00013.pdb # 2: usage_00048.pdb # 3: usage_00068.pdb # 4: usage_00104.pdb # 5: usage_00108.pdb # 6: usage_00134.pdb # # Length: 80 # Identity: 24/ 80 ( 30.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 80 ( 48.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 80 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00013.pdb 1 -QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGV 59 usage_00048.pdb 1 AQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGV 60 usage_00068.pdb 1 --SVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGI 58 usage_00104.pdb 1 -DSVTQTEGLVTLTEGLPVMLNCTYQSTYSPFLFWYVQHLNEAPKLLLKSFTDNKR-PEH 58 usage_00108.pdb 1 AQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGV 60 usage_00134.pdb 1 --SVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDK-GSN 57 SVTQ vT sEga l l C Y P LFWYVQ p g q LLK d usage_00013.pdb 60 NGFEAEFSKSNSSFHLR--- 76 usage_00048.pdb 61 NGFEAEFSKSDSSFHLRKA- 79 usage_00068.pdb 59 KGFEAEFKRSQSSFNLRKP- 77 usage_00104.pdb 59 QGFHATLHKSSSSFHLQKS- 77 usage_00108.pdb 61 NGFEAEFSKSDSSFHLRKAS 80 usage_00134.pdb 58 KGFEATYRKETTSFHLEKG- 76 GFeA ks sSFhL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################