################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:08 2021 # Report_file: c_1322_26.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00229.pdb # 2: usage_00367.pdb # 3: usage_00445.pdb # 4: usage_00446.pdb # 5: usage_00771.pdb # 6: usage_00792.pdb # 7: usage_00802.pdb # 8: usage_00903.pdb # 9: usage_00904.pdb # 10: usage_00905.pdb # 11: usage_00935.pdb # # Length: 34 # Identity: 4/ 34 ( 11.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 34 ( 29.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 34 ( 35.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00229.pdb 1 EAEDAATYYCQQGS-EN--TETFGGGTKLDIKRA 31 usage_00367.pdb 1 QAEDEADYYCQSY-GS----AVFGGGTKLT---- 25 usage_00445.pdb 1 EAGDEADYYCHMWDSRSGFSWSFGGATRLTVLG- 33 usage_00446.pdb 1 EAGDEADYYCHMWDSRSGFSWSFGGATRLTVLG- 33 usage_00771.pdb 1 -AGDEADYYCHIWDSRVPTKWVFGGGTTLTVLG- 32 usage_00792.pdb 1 -QADEGEYECRVSTFPA--GSF-QARLRLRV--- 27 usage_00802.pdb 1 EVGDEADYYCHMWDSRSGFSWSFGGATRLT---- 30 usage_00903.pdb 1 EVGDEADYYCHMWDSRSGFSWSFGGATRLTVLS- 33 usage_00904.pdb 1 EVGDEADYYCHMWDSRSGFSWSFGGATRLTVL-- 32 usage_00905.pdb 1 EVGDEADYYCHMWDSRSGFSWSFGGATRLTVLS- 33 usage_00935.pdb 1 EAGDEADYYCHMWDSRSGFSWSFGGATRLTVLG- 33 Dea YyC gg t L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################