################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:15 2021 # Report_file: c_1489_246.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00113.pdb # 2: usage_00890.pdb # 3: usage_01288.pdb # 4: usage_01294.pdb # 5: usage_01644.pdb # 6: usage_03264.pdb # 7: usage_03265.pdb # 8: usage_03752.pdb # 9: usage_03761.pdb # 10: usage_03778.pdb # # Length: 61 # Identity: 30/ 61 ( 49.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 61 ( 60.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 61 ( 16.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00113.pdb 1 LSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMD-- 58 usage_00890.pdb 1 -------VVYKTAYYTYWLPLVMGLLVSGTLEKVDKKATHKVAMVMGEYFQVQDDVMD-- 51 usage_01288.pdb 1 -------VKYKTTFYTYLLPLVMGLFVSEAAASVEMNLVERVAHLIGEYFQVQDDVMDCF 53 usage_01294.pdb 1 -------VKYKTTFYTYLLPLVMGLFVSEAAASVEMNLVERVAHLIGEYFQVQDDVMDCF 53 usage_01644.pdb 1 -------VKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMD-- 51 usage_03264.pdb 1 -------VKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCF 53 usage_03265.pdb 1 -------VKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMD-- 51 usage_03752.pdb 1 -------VKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMD-- 51 usage_03761.pdb 1 -------VKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCF 53 usage_03778.pdb 1 -------VKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMD-- 51 VkYKT YTYlLPLVMGL VSea V m e A l GEYFQVQDDVMD usage_00113.pdb - usage_00890.pdb - usage_01288.pdb 54 T 54 usage_01294.pdb 54 T 54 usage_01644.pdb - usage_03264.pdb - usage_03265.pdb - usage_03752.pdb - usage_03761.pdb - usage_03778.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################