################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:54:25 2021 # Report_file: c_1168_92.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00351.pdb # 2: usage_00352.pdb # 3: usage_00873.pdb # 4: usage_01174.pdb # 5: usage_01193.pdb # 6: usage_01407.pdb # 7: usage_01408.pdb # 8: usage_01409.pdb # 9: usage_01410.pdb # 10: usage_01411.pdb # 11: usage_01412.pdb # 12: usage_01413.pdb # 13: usage_01461.pdb # 14: usage_01462.pdb # 15: usage_01474.pdb # 16: usage_01564.pdb # 17: usage_01806.pdb # # Length: 32 # Identity: 2/ 32 ( 6.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 32 ( 68.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 32 ( 31.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00351.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_00352.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_00873.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKE--AEFVP 29 usage_01174.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01193.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01407.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01408.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01409.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01410.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01411.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01412.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01413.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01461.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01462.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01474.pdb 1 -----EFEMEVLIAKPKRFRIKP--GIYQTAW 25 usage_01564.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 usage_01806.pdb 1 TYRIARLCLQPTTFLVKE-EPKNKRQEAEFVP 31 rlclqpttflvKe epKn aefvp #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################