################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:11:41 2021
# Report_file: c_1351_27.html
################################################################################################
#====================================
# Aligned_structures: 9
#   1: usage_00140.pdb
#   2: usage_00141.pdb
#   3: usage_00941.pdb
#   4: usage_00942.pdb
#   5: usage_00943.pdb
#   6: usage_00944.pdb
#   7: usage_00945.pdb
#   8: usage_00946.pdb
#   9: usage_00947.pdb
#
# Length:         33
# Identity:        7/ 33 ( 21.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     10/ 33 ( 30.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 33 ( 12.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00140.pdb         1  -GEWKSRYISEDYTSIDPIVRHGLLEYTPLIWN   32
usage_00141.pdb         1  PGEWKSRYISEDYTSIDPIVRHGLLEYTPLIW-   32
usage_00941.pdb         1  PLDWVKKYKKNSYHLIDPVILTAKDKVAPFA--   31
usage_00942.pdb         1  -REWEHRYVKFGYVTIDPIIKRVASQPRPVVWN   32
usage_00943.pdb         1  --EWEHRYVKFGYVTIDPIIKRVASQPRPVVWN   31
usage_00944.pdb         1  PREWEHRYVKFGYVTIDPIIKRVASQPRPVVWN   33
usage_00945.pdb         1  -REWEHRYVKFGYVTIDPIIKRVASQPRPVVWN   32
usage_00946.pdb         1  -REWEHRYVKFGYVTIDPIIKRVASQPRPVVWN   32
usage_00947.pdb         1  PREWEHRYVKFGYVTIDPIIKRVASQPRPVVWN   33
                             eW  rY    Y  IDPi         P    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################