################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:39 2021 # Report_file: c_1434_76.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00915.pdb # 2: usage_00916.pdb # 3: usage_00917.pdb # 4: usage_00918.pdb # 5: usage_01632.pdb # 6: usage_02158.pdb # 7: usage_02223.pdb # # Length: 98 # Identity: 7/ 98 ( 7.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 98 ( 14.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 30/ 98 ( 30.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00915.pdb 1 ---DFYIQLQWQYFQGTGQGPYFGQLVWFTLY---H--EEK--IPSA---VTRYKEEALR 47 usage_00916.pdb 1 ---DFYIQLQWQYFQGTGQGPYFGQLVWFTLY---H--EEK--IPSA---VTRYKEEALR 47 usage_00917.pdb 1 --DDFYIQLQWQYFQGTGQGPYFGQLVWFTLY---H--EEK--IPSA---VTRYKEEALR 48 usage_00918.pdb 1 ---DFYIQLQWQYFQGTGQGPYFGQLVWFTLY---H--EEK--IPSA---VTRYKEEALR 47 usage_01632.pdb 1 DPVQQARVNAALHFESGVLFARMRFIFERIFF---YGKSDI---------PEDRVEYVQK 48 usage_02158.pdb 1 TPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIHH--------NKQA---TENAKEEVRR 49 usage_02223.pdb 1 -EPED-ALVSWSLFAATAVEPPALEIQLIQRS---GG----GTSPEGQAAIAIAAERLRR 51 w F p E r usage_00915.pdb 48 VFSVLERVLSNQEWLVGGKMTIADISFVSWNDMIVHFL 85 usage_00916.pdb 48 VFSVLERVLSNQEWLVGGKMTIADISFVSWNDMIVHFL 85 usage_00917.pdb 49 VFSVLERVLSNQEWLVGGKMTIADISFVSWNDMIVHFL 86 usage_00918.pdb 48 VFSVLERVLSNQEWLVGGKMTIADISFVSWNDM----- 80 usage_01632.pdb 49 SYRLLEDTLK-DDFVAGSKMTIADFSCISTISSI---- 81 usage_02158.pdb 50 ILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYK-- 85 usage_02223.pdb 52 PLARLERHFAAEDYLVGGRFTVADLNLAETL------- 82 Le l lvG T AD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################