################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:24 2021 # Report_file: c_1175_47.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00090.pdb # 2: usage_00097.pdb # 3: usage_00219.pdb # 4: usage_00686.pdb # 5: usage_00687.pdb # 6: usage_00688.pdb # 7: usage_01088.pdb # 8: usage_01106.pdb # # Length: 51 # Identity: 16/ 51 ( 31.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 51 ( 49.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 51 ( 15.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00090.pdb 1 -AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEK 50 usage_00097.pdb 1 -KKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAGKDQFEE 50 usage_00219.pdb 1 -KKYVCTVCGYEYDPAEGDPDNGVKPGTAFEDVPADWVCPICGAPKSEFEP 50 usage_00686.pdb 1 MAKWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFER 51 usage_00687.pdb 1 MAKWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFER 51 usage_00688.pdb 1 MAKWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFER 51 usage_01088.pdb 1 MQKYVCNVCGYEYDPAEH-------DNVPFDQLPDDWCCPVCGVSKDQFSP 44 usage_01106.pdb 1 -AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEK 50 K C CGY Yd g pgt F PdDWvCP CGa K Fe #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################