################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:42 2021 # Report_file: c_0867_5.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00023.pdb # 2: usage_00026.pdb # 3: usage_00028.pdb # 4: usage_00032.pdb # 5: usage_00325.pdb # 6: usage_00327.pdb # 7: usage_00329.pdb # 8: usage_00331.pdb # # Length: 77 # Identity: 46/ 77 ( 59.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 77 ( 59.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/ 77 ( 40.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 -------EQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLA 53 usage_00026.pdb 1 -------EQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLA 53 usage_00028.pdb 1 -------EQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLA 53 usage_00032.pdb 1 FMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLA 60 usage_00325.pdb 1 -------EQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLA 53 usage_00327.pdb 1 FMQKEIFEQPDSAFNTMRGRIDFENCVVTLGGLKSWLSTIRRCRRIIMIACGTSYHSCLA 60 usage_00329.pdb 1 -----------------------------LGGLKSWLSTIRRCRRIIMIACGTSYHSCLA 31 usage_00331.pdb 1 -----------------------------LGGLKSWLSTIRRCRRIIMIACGTSYHSCLA 31 LGGLKSWLSTIRRCRRIIMIACGTSYHSCLA usage_00023.pdb 54 TRSIFEELTEIPVSVEL 70 usage_00026.pdb 54 TRSIFEELTEIPVSVEL 70 usage_00028.pdb 54 TRSIFEELTEIPVSV-- 68 usage_00032.pdb 61 TRSIFEELTEIPVSV-- 75 usage_00325.pdb 54 TRSIFEELTEIPVSV-- 68 usage_00327.pdb 61 TRSIFEELTEIPVSVEL 77 usage_00329.pdb 32 TRSIFEELTEIPVSVEL 48 usage_00331.pdb 32 TRSIFEELTEIPVSVEL 48 TRSIFEELTEIPVSV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################