################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:24:41 2021 # Report_file: c_1362_2.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00443.pdb # 2: usage_00749.pdb # 3: usage_00759.pdb # 4: usage_00775.pdb # 5: usage_00776.pdb # 6: usage_00856.pdb # # Length: 91 # Identity: 23/ 91 ( 25.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 53/ 91 ( 58.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 91 ( 9.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00443.pdb 1 PDGYVHTFGGDRYWRKNRATGYMA-GNLCMGVDLNRNFGM-NW-GTASSSSVCSDTFHGR 57 usage_00749.pdb 1 VDGYDYTWKKDRMWRKNRSLH---EKNACVGTDLNRNFASKHWCGEGASSSSCSEIYCGT 57 usage_00759.pdb 1 VDGYDYSWKKNRMWRKNRSFY---ANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCGL 57 usage_00775.pdb 1 VDGYDYTWKKDRMWRKNRSLH---EKNACVGTDLNRNFASKHWCGEGASSSSCSEIYCGT 57 usage_00776.pdb 1 VDGYDYTWKKDRMWRKNRSLH---EKNACVGTDLNRNFASKHWCGEGASSSSCSEIYCGT 57 usage_00856.pdb 1 IDGYIYTWTKNRMWRKTRSTN---AGSSCTGTDPNRNFNA-GWCTVGASVNPCNETYCGS 56 DGY ytw k RmWRKnRs n C GtDlNRNF W gaSss Cse ycG usage_00443.pdb 58 SAFSEPESSVIRDIIAEHRNRMALYLDIHSF 88 usage_00749.pdb 58 YPESEPEVKAVADFLRRNIKHIKAYISMHSY 88 usage_00759.pdb 58 YPESEPEVKAVASFLRRNINQIKAYISM--- 85 usage_00775.pdb 58 YPESEPEVKAVADFLRRNIKHIKAYISMHSY 88 usage_00776.pdb 58 YPESEPEVKAVADFLRRNIKHIKAYISMHSY 88 usage_00856.pdb 57 AAESEKETKALADFIRNNLSSIKAYLTI--- 84 eSEpE ka adf r n ikaY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################