################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:16 2021 # Report_file: c_0798_52.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00141.pdb # 2: usage_00142.pdb # 3: usage_00183.pdb # 4: usage_00325.pdb # 5: usage_00383.pdb # 6: usage_00384.pdb # 7: usage_00400.pdb # # Length: 77 # Identity: 5/ 77 ( 6.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 77 ( 10.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 25/ 77 ( 32.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00141.pdb 1 -HMIYAGILAG--------------PKQFL-ELGDRPILIHTIEKFVLEPS-IEKIVVGV 43 usage_00142.pdb 1 -HMIYAGILAG--------------PKQFL-ELGDRPILIHTIEKFVLEPS-IEKIVVGV 43 usage_00183.pdb 1 --VMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPK-DVIVVT 57 usage_00325.pdb 1 --EVVAIVPAA--------------PKAFY-QLDGQTLIERAVDGLLDSGV-VDTVVVAV 42 usage_00383.pdb 1 --MIYAEILA--------------MPKQFL-PLNKRPIIIHTVEKFLLNDR-FDKILIVS 42 usage_00384.pdb 1 --MIYAEILA---------------PKQFL-PLNKRPIIIHTVEKFLLNDR-FDKILIVS 41 usage_00400.pdb 1 HHMNVAILLAAGKGERMS--EN--VPKQFL-EIEGRMLFEYPLSTFLKSEA-IDGVVIVT 54 A lA PKqFl usage_00141.pdb 44 HGDWVSHAEDLVDK--- 57 usage_00142.pdb 44 HGDWVSHAEDLVDK--- 57 usage_00183.pdb 58 HKDYVERTKKEL----- 69 usage_00325.pdb 43 PADRTDEARQILG---- 55 usage_00383.pdb 43 PKEWINHTKDILKKFIG 59 usage_00384.pdb 42 PKEWINHTKDILKKFIG 58 usage_00400.pdb 55 RREWFEVVEKRV----- 66 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################