################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:12:56 2021
# Report_file: c_1256_446.html
################################################################################################
#====================================
# Aligned_structures: 9
#   1: usage_00245.pdb
#   2: usage_00257.pdb
#   3: usage_00740.pdb
#   4: usage_00741.pdb
#   5: usage_00742.pdb
#   6: usage_00743.pdb
#   7: usage_00780.pdb
#   8: usage_00781.pdb
#   9: usage_01298.pdb
#
# Length:         42
# Identity:        4/ 42 (  9.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     15/ 42 ( 35.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            8/ 42 ( 19.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00245.pdb         1  --IAAYTHAVA-D----NLEDLYTEIDEIRKKGYQHIRCQLG   35
usage_00257.pdb         1  --IPAYTHAVA-D----NLDDLYHEIDRFLAAGYRYIRCQLG   35
usage_00740.pdb         1  ---PAYSHASG-E----TLEALFASVDALIAQGYRHIRCQLG   34
usage_00741.pdb         1  ---PAYSHASG-E----TLEALFASVDALIAQGYRHIRCQLG   34
usage_00742.pdb         1  --IPAYSHASG-E----TLEALFASVDALIAQGYRHIRCQLG   35
usage_00743.pdb         1  --IPAYSHASG-E----TLEALFASVDALIAQGYRHIRCQLG   35
usage_00780.pdb         1  --IAAYTHAVA-D----NLEDLYTEIDEIRKKGYQHIRCQLG   35
usage_00781.pdb         1  --IAAYTHAVA-D----NLEDLYTEIDEIRKKGYQHIRCQLG   35
usage_01298.pdb         1  EEIPVYASFQSYSDSPQWISRSVSNVEAQLKKGFEQIKVKIG   42
                               aY ha         l  l    d     Gy  IrcqlG


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################