################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:48:45 2021 # Report_file: c_0507_3.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00005.pdb # 2: usage_00012.pdb # 3: usage_00015.pdb # 4: usage_00016.pdb # 5: usage_00017.pdb # 6: usage_00024.pdb # 7: usage_00026.pdb # 8: usage_00027.pdb # # Length: 97 # Identity: 23/ 97 ( 23.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 97 ( 32.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 97 ( 9.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 STEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFAAYNVLEDPE 60 usage_00012.pdb 1 TPQLKDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVP---FEDVNILENEM 57 usage_00015.pdb 1 ---SAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVR--DYAAYNVLDDPE 55 usage_00016.pdb 1 ---SAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVR--DYAAYNVLDDPE 55 usage_00017.pdb 1 ---SAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVR--DYAAYNVLDDPE 55 usage_00024.pdb 1 ----KKDIDDTIKSEDVVTFIKGLPEAPMCAYSKRMIDVLEALGLE---YTSFDVLAHPV 53 usage_00026.pdb 1 ---SAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVR--DYAAYNVLDDPE 55 usage_00027.pdb 1 ----KKDIDDTIKSEDVVTFIKGLPEAPMCAYSKRMIDVLEALGLE---YTSFDVLAHPV 53 VV F KG pe P C S L g vL p usage_00005.pdb 61 LREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSG 97 usage_00012.pdb 58 LRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKT- 93 usage_00015.pdb 56 LRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQ-- 90 usage_00016.pdb 56 LRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQ-- 90 usage_00017.pdb 56 LRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQ-- 90 usage_00024.pdb 54 VRSYVKEVSEWPTIPQLFIKAEFVGGLDIVTKMLESG 90 usage_00026.pdb 56 LRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNG 92 usage_00027.pdb 54 VRSYVKEVSEWPTIPQLFIKAEFVGGLDIVTKMLESG 90 R K S WPTiPQ EF GG Di m #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################