################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:35 2021 # Report_file: c_0696_25.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00141.pdb # 2: usage_00142.pdb # 3: usage_00172.pdb # 4: usage_00197.pdb # 5: usage_00198.pdb # 6: usage_00279.pdb # 7: usage_00446.pdb # 8: usage_00483.pdb # 9: usage_00485.pdb # # Length: 51 # Identity: 0/ 51 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 51 ( 31.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 51 ( 17.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00141.pdb 1 GRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKT- 50 usage_00142.pdb 1 GRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKT- 50 usage_00172.pdb 1 --AVFKV------DGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRG 43 usage_00197.pdb 1 GRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKT- 50 usage_00198.pdb 1 GRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKT- 50 usage_00279.pdb 1 GRARLQVVNCNGNTVFDGELEAGRALTVPQNYAVAAKSLSDRFSYVAFKT- 50 usage_00446.pdb 1 GRGRIQIVNDQGQSVFDEELSRGQLVVVPQNFAIVKQAFEDGFEWVSFKT- 50 usage_00483.pdb 1 --GRVRVVN-QGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKT- 47 usage_00485.pdb 1 GKGRVRVVN-QGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKT- 49 v vfd el g vpqn a v fkt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################