################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 22:59:51 2021 # Report_file: c_1135_198.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00639.pdb # 2: usage_00640.pdb # 3: usage_01112.pdb # 4: usage_01193.pdb # # Length: 72 # Identity: 28/ 72 ( 38.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 72 ( 38.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 72 ( 8.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00639.pdb 1 LHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYR 60 usage_00640.pdb 1 LHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYR 60 usage_01112.pdb 1 -LDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHR 59 usage_01193.pdb 1 PLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHR 60 L N GIG YI WA EA A A Q GIQ AEP E LQ Q R usage_00639.pdb 61 LFQTRLT----- 67 usage_00640.pdb 61 LFQTRLTE---- 68 usage_01112.pdb 60 QFQARVSRQTLL 71 usage_01193.pdb 61 QFQARVSRQT-- 70 FQ R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################