################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:56 2021 # Report_file: c_1001_63.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00010.pdb # 2: usage_00379.pdb # 3: usage_00403.pdb # 4: usage_00404.pdb # 5: usage_00576.pdb # 6: usage_00579.pdb # 7: usage_00686.pdb # # Length: 77 # Identity: 3/ 77 ( 3.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 77 ( 10.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 77 ( 29.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 --MCLFDMGGEYYCFAS-DITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPD 57 usage_00379.pdb 1 D-LVLIDAGCEYKGYAG-DITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILE 58 usage_00403.pdb 1 --LVTIDMGARLGGYNS-DMTRTVAVG-TPSAEMKRVYDAVLEAEEAAIAAIRPGVRAAD 56 usage_00404.pdb 1 ASVIICAVGARYKSYCS-NIARTFL--IDADPIQSKAYEVLLKAQEAVIGSLKPGNKLSA 57 usage_00576.pdb 1 --IVVVDIGGTYEPGYYSDSTRTYSIG-DPSPDVAQQYSALQRAQRAAVDAVRPGVTAAQ 57 usage_00579.pdb 1 --FVTLDFGAYYKGYCS-DITRTIAVG-EPSDKLKEIYNIVLEAQLRGVNGIKAGLTGRE 56 usage_00686.pdb 1 --LVTI-DGARLGGYN-S-DTRTVAVG-TPSAE-KRVYDAVLEAEEAAIAAIRPGVRAAD 53 G trt Y l pG usage_00010.pdb 58 MHRLADRIHLEELAHMG 74 usage_00379.pdb 59 VTGEVVRIMVSGLVKL- 74 usage_00403.pdb 57 LDKLARDLLTRHG---- 69 usage_00404.pdb 58 AYLAAVSVVEKDA---- 70 usage_00576.pdb 58 VDAA------------- 61 usage_00579.pdb 57 ADAL------------- 60 usage_00686.pdb 54 LDKLARDLLTRHG---- 66 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################