################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:05 2021 # Report_file: c_1171_152.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00082.pdb # 2: usage_00341.pdb # 3: usage_00935.pdb # 4: usage_01246.pdb # 5: usage_01248.pdb # 6: usage_01249.pdb # 7: usage_01257.pdb # 8: usage_01258.pdb # 9: usage_01546.pdb # 10: usage_01547.pdb # 11: usage_01548.pdb # 12: usage_01861.pdb # 13: usage_01956.pdb # # Length: 34 # Identity: 0/ 34 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 2/ 34 ( 5.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 34 ( 44.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00082.pdb 1 ---------AYQVMATEGYQ-S--SGSSNVTVW- 21 usage_00341.pdb 1 VSFLIPREDYRIDDVWNVVG-LRGTGSNTVVVED 33 usage_00935.pdb 1 ---------NLHLEEAYREGDN--TYYRVNE--- 20 usage_01246.pdb 1 ---------DYQIMATKGWQ-S--SGSSTVSISE 22 usage_01248.pdb 1 ---------YYMIMATEGYQ-S--SGSSSINVGG 22 usage_01249.pdb 1 ---------YYMIMATEGYQ-S--SGSSSINVGG 22 usage_01257.pdb 1 ---------DYQIMATEGYQ-S--SGSSTVSISE 22 usage_01258.pdb 1 ---------DYQIMATEGYQ-S--SGSSTVSISE 22 usage_01546.pdb 1 ---------NYMIVSTEGYE-S--SGSSTITVS- 21 usage_01547.pdb 1 ---------NYMIVSTEGYE-S--SGSSTIT--- 19 usage_01548.pdb 1 ---------NYMIVSTEGYE-S--SGSSTITVS- 21 usage_01861.pdb 1 ---------AYQVMATEGYQ-S--SGSSNVTVW- 21 usage_01956.pdb 1 ---------AYQVMATEGYQ-S--SGSSNVTVW- 21 gs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################