################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:30 2021 # Report_file: c_1312_84.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00070.pdb # 2: usage_00295.pdb # 3: usage_00469.pdb # 4: usage_00500.pdb # 5: usage_00561.pdb # 6: usage_00735.pdb # 7: usage_00890.pdb # 8: usage_00939.pdb # 9: usage_00940.pdb # 10: usage_01030.pdb # 11: usage_01070.pdb # 12: usage_01072.pdb # # Length: 30 # Identity: 10/ 30 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 30 ( 86.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 30 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00070.pdb 1 -PEQWKSHRSYSCQVTHEGSTVEKTVA--- 26 usage_00295.pdb 1 -QKHWLSDRTYTCQVTYQGHTFEDSTKK-S 28 usage_00469.pdb 1 TPEQWKSHRSYSCQVTHEGSTVEKTVAP-- 28 usage_00500.pdb 1 TPEQWKSHKSYSCQVTHEGSTVEKTVA--- 27 usage_00561.pdb 1 -PEQWKSHRSYSCQVTHEGSTVEKTVAP-- 27 usage_00735.pdb 1 TPEQWKSHRSYSCQVTHEGSTVEKTVA--- 27 usage_00890.pdb 1 TPEQWKSHRSYSCQVTHEGSTVEKTVAP-- 28 usage_00939.pdb 1 TPEQWKSHRSYSCQVTHEGSTVEKTVAP-- 28 usage_00940.pdb 1 TPEQWKSHRSYSCQVTHEGSTVEKTVAP-- 28 usage_01030.pdb 1 -PEQWKSHRSYSCQVTHEGSTVEKTVAPTE 29 usage_01070.pdb 1 -PEQWKSHRSYSCQVTHEGSTVEKTVAP-- 27 usage_01072.pdb 1 -PEQWKSHRSYSCQVTHEGSTVEKTVAP-- 27 peqWkShrsYsCQVTheGsTvEktva #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################