################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:27:06 2021 # Report_file: c_1036_31.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00280.pdb # 2: usage_00281.pdb # 3: usage_00282.pdb # 4: usage_00284.pdb # 5: usage_00297.pdb # 6: usage_00299.pdb # 7: usage_00300.pdb # 8: usage_00301.pdb # 9: usage_00302.pdb # 10: usage_00303.pdb # 11: usage_00304.pdb # 12: usage_00308.pdb # 13: usage_00395.pdb # 14: usage_00397.pdb # 15: usage_00401.pdb # # Length: 33 # Identity: 31/ 33 ( 93.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 33 ( 93.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 33 ( 6.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00280.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00281.pdb 1 -PTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 31 usage_00282.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00284.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00297.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00299.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00300.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00301.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00302.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTG 33 usage_00303.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTG 33 usage_00304.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00308.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00395.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00397.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 usage_00401.pdb 1 LPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT- 32 PTLDFEDVLRYDEHAYKWLSTLKKVGIVRLT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################