################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:16:16 2021 # Report_file: c_1085_19.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00035.pdb # 2: usage_00262.pdb # 3: usage_00263.pdb # 4: usage_00335.pdb # 5: usage_00336.pdb # 6: usage_00338.pdb # 7: usage_00575.pdb # 8: usage_00576.pdb # 9: usage_00578.pdb # 10: usage_00579.pdb # 11: usage_00711.pdb # 12: usage_00713.pdb # 13: usage_00714.pdb # 14: usage_00715.pdb # # Length: 40 # Identity: 20/ 40 ( 50.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 40 ( 65.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 40 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00035.pdb 1 EAMFTQVCGLRTVMPSNPYDAKGLLIASIECDDPVIFLEP 40 usage_00262.pdb 1 EAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEP 40 usage_00263.pdb 1 EAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEP 40 usage_00335.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00336.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00338.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00575.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00576.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00578.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00579.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00711.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00713.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00714.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 usage_00715.pdb 1 EGLVAQQPGLKVVIPSTPYDAKGLLISAIRDNDPVIFLEH 40 E GLkvV StPYDAKGLL aIrd DPV FLE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################