################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:36:37 2021 # Report_file: c_0487_6.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00055.pdb # 2: usage_00056.pdb # 3: usage_00059.pdb # 4: usage_00080.pdb # 5: usage_00081.pdb # 6: usage_00159.pdb # 7: usage_00227.pdb # # Length: 100 # Identity: 8/100 ( 8.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/100 ( 24.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/100 ( 8.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00055.pdb 1 RVGYVV-ASEKFIDAYNRVRLPFNVSYVSQMFAKVALD--HREIFEERTKFIVEERERMK 57 usage_00056.pdb 1 RVGYVV-ASEKFIDAYNRVRLPFNVSYVSQMFAKVALD--HREIFEERTKFIVEERERMK 57 usage_00059.pdb 1 RCGFTL-ANEEVINLLMKVIAPYPLSTPVADIAAQALSPQGIVAMRERVAQIIAEREYLI 59 usage_00080.pdb 1 RVGYVV-ASEKFIDAYNRVRLPFNVSYVSQMFAKVALD--HREIFEERTKFIVEERERMK 57 usage_00081.pdb 1 RVGYVV-ASEKFIDAYNRVRLPFNVSYVSQMFAKVALD--HREIFEERTKFIVEERERMK 57 usage_00159.pdb 1 -LGYLI-ATPAVIDAMLLVRLPYHLSSVTQAAARAALR--HSDDTLSSVAALIAERERVT 56 usage_00227.pdb 1 RFGYGITNNKEIAAKIKAKQNPWNINCFAEMAAINCLK--DTNYIEESLLWIKKERKRFI 58 Gy a i v P s A aL e i ERer usage_00055.pdb 58 SALREMG-Y-RITDSRGNFVFVFMEKEEKERLLEHLRTKN 95 usage_00056.pdb 58 SALREMG-Y-RITDSRGNFVFVFMEKEEKERLLEHLRTKN 95 usage_00059.pdb 60 AALKEIPCVEQVFDSETNYILARFK--ASSAVFKSLWDQG 97 usage_00080.pdb 58 SALREMG-Y-RITDSRGNFVFVFMEKEEKERLLEHLRTKN 95 usage_00081.pdb 58 SALREMG-Y-RITDSRGNFVFVFMEKEEKERLLEHLRTKN 95 usage_00159.pdb 57 TSLNDMG-F-RVIPSDANFVLFGEFA-DAPAAWRRYLEAG 93 usage_00227.pdb 59 EELNKIGFIKRVFSPHANFVLCRLENISGEKLYDSLLKED 98 L g r s Nfv l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################