################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:36 2021 # Report_file: c_1137_36.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00109.pdb # 2: usage_00110.pdb # 3: usage_00111.pdb # 4: usage_00112.pdb # 5: usage_00117.pdb # 6: usage_00431.pdb # 7: usage_00497.pdb # # Length: 73 # Identity: 15/ 73 ( 20.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 73 ( 27.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 73 ( 4.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00109.pdb 1 GPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVE-VKKSDQPVQQLKDNIVSPGG 59 usage_00110.pdb 1 GPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVE-VKKSDQPVQQLKDNIVSPGG 59 usage_00111.pdb 1 GPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVE-VKKSDQPVQQLKDNIVSPGG 59 usage_00112.pdb 1 GPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGSVE-VKKSDQPVQQLKDNIVSPGG 59 usage_00117.pdb 1 GPAYIFLI-EALQEAAEQLGLTKETAELLTEQTVLGAAR-ALETEQSVVQLRQFVTSPGG 58 usage_00431.pdb 1 GPAYVFYLLDALQNAAIRQGFD-AEARALSLATFKGAVALAEQTGEDFEKLQKNVTSKGG 59 usage_00497.pdb 1 GPAYVFYLLDALQNAAIRQGFD-AEARALSLATFKGAVALAEQTGEDFEKLQKNVTSKGG 59 GPAYv L A G L l T kG v L n S GG usage_00109.pdb 60 ITAVGLYSLEKNS 72 usage_00110.pdb 60 ITAVGLYSLEKNS 72 usage_00111.pdb 60 ITAVGLYSLEKNS 72 usage_00112.pdb 60 ITAVGLYSLEKNS 72 usage_00117.pdb 59 TTEQAIKVLESGN 71 usage_00431.pdb 60 TTHEAVEAFRRHR 72 usage_00497.pdb 60 TTHEAVEAFRRHR 72 T #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################