################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:27:46 2021
# Report_file: c_1162_25.html
################################################################################################
#====================================
# Aligned_structures: 15
#   1: usage_00080.pdb
#   2: usage_00081.pdb
#   3: usage_00140.pdb
#   4: usage_00141.pdb
#   5: usage_00142.pdb
#   6: usage_00143.pdb
#   7: usage_00144.pdb
#   8: usage_00348.pdb
#   9: usage_00372.pdb
#  10: usage_00373.pdb
#  11: usage_00612.pdb
#  12: usage_00750.pdb
#  13: usage_00780.pdb
#  14: usage_01254.pdb
#  15: usage_01308.pdb
#
# Length:         30
# Identity:       15/ 30 ( 50.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     21/ 30 ( 70.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            6/ 30 ( 20.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00080.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00081.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00140.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00141.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00142.pdb         1  -AIHQAGEFTQFRFSKKRPDL-TGVLE---   25
usage_00143.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00144.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00348.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LE-   27
usage_00372.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00373.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00612.pdb         1  IAIHRAGEFTQFRFSRKVRPDLTGMV-LEE   29
usage_00750.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
usage_00780.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LE-   27
usage_01254.pdb         1  -AIHRAGEFTLFRFSKKIRPDLTGMI-LEE   28
usage_01308.pdb         1  -AIHQAGEFTQFRFSKKMRPDLTGMV-LEE   28
                            AIH AGEFTqFRFSkK rpd TGm     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################