################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:51 2021 # Report_file: c_1084_144.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00101.pdb # 2: usage_00286.pdb # 3: usage_00287.pdb # 4: usage_00467.pdb # 5: usage_00468.pdb # 6: usage_00473.pdb # 7: usage_00474.pdb # 8: usage_00753.pdb # 9: usage_00754.pdb # 10: usage_00973.pdb # 11: usage_01151.pdb # 12: usage_01152.pdb # 13: usage_01446.pdb # # Length: 51 # Identity: 34/ 51 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 51 ( 90.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 51 ( 2.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00101.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEAT 51 usage_00286.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEAT 51 usage_00287.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEAT 51 usage_00467.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEA- 50 usage_00468.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEA- 50 usage_00473.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEA- 50 usage_00474.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEAT 51 usage_00753.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEAT 51 usage_00754.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEAT 51 usage_00973.pdb 1 LFRIAAGEMLGKDQPVILQLLGSERSFQALEGVVMELEDCAFPLLAGLEAT 51 usage_01151.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEAT 51 usage_01152.pdb 1 LFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEAT 51 usage_01446.pdb 1 LFRIANGDLLGKDQPVILQLLDLPQAQAAVKGVVMELDDCAFPLLAGVVIT 51 LFRIAaGemLGKDQPVILQLL pqa AleGVVMELeDCAFPLLAGlea #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################