################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:55 2021 # Report_file: c_1200_31.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01732.pdb # 2: usage_02242.pdb # 3: usage_02243.pdb # 4: usage_02244.pdb # 5: usage_04445.pdb # 6: usage_04952.pdb # # Length: 76 # Identity: 35/ 76 ( 46.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 76 ( 46.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/ 76 ( 35.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01732.pdb 1 SIYYDLN-T--------------------------AFWNTASWSSDLFGFYTTPTNVTVE 33 usage_02242.pdb 1 SIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLE 60 usage_02243.pdb 1 SIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLE 60 usage_02244.pdb 1 SIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLE 60 usage_04445.pdb 1 SIYYGPN-T--------------------------AFWNTASWSSDLFGFYTTPTNVTVE 33 usage_04952.pdb 1 SIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLE 60 SI Y A WS DLFGFYTTPTNVT E usage_01732.pdb 34 MTGYFLPPQTGSYTFK 49 usage_02242.pdb 61 MTGYFLPPQTGSYTFS 76 usage_02243.pdb 61 MTGYFLPPQTGSYTFS 76 usage_02244.pdb 61 MTGYFLPPQTGSYTFS 76 usage_04445.pdb 34 MTGYFLPPQTGSYTFK 49 usage_04952.pdb 61 MTGYFLPPQTGSYTFS 76 MTGYFLPPQTGSYTF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################