################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:46 2021 # Report_file: c_0553_28.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00160.pdb # 2: usage_00716.pdb # 3: usage_01586.pdb # 4: usage_02176.pdb # 5: usage_02177.pdb # 6: usage_02178.pdb # # Length: 66 # Identity: 10/ 66 ( 15.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 66 ( 47.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 66 ( 18.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00160.pdb 1 PVWVKWMRGEQEQ-QGTQPGDILPNADETWYLRATLDVVAGEA-AGLSCRVKHSSLEGQD 58 usage_00716.pdb 1 EISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVEL-----GDIYSCHVEHG--G-VH 52 usage_01586.pdb 1 PIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDG-DKYQCRVEHASLP-QP 58 usage_02176.pdb 1 PIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIDAQPGDG-DKYQCRVEHASLP-QP 58 usage_02177.pdb 1 PIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIDAQPGDG-DKYQCRVEHASLP-QP 58 usage_02178.pdb 1 PIVVSWLKDGAVRGQDAHSGGIVPNGDGTYHTWVTIDAQPGDG-DKYQCRVEHASLP-QP 58 pi v W k g Qd GgI PngDgTy twvt d d y CrVeH q usage_00160.pdb 59 IVLY-W 63 usage_00716.pdb 53 MVLQ-- 56 usage_01586.pdb 59 GLYS-- 62 usage_02176.pdb 59 GLYSW- 63 usage_02177.pdb 59 GLYS-- 62 usage_02178.pdb 59 GLYSW- 63 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################