################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:56 2021 # Report_file: c_1222_43.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00184.pdb # 2: usage_00529.pdb # 3: usage_00542.pdb # 4: usage_00612.pdb # 5: usage_01105.pdb # 6: usage_01662.pdb # 7: usage_02112.pdb # 8: usage_02291.pdb # 9: usage_02292.pdb # # Length: 47 # Identity: 11/ 47 ( 23.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 47 ( 38.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 47 ( 34.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00184.pdb 1 AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPS-YDK- 45 usage_00529.pdb 1 AAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENP-AYDH 46 usage_00542.pdb 1 AAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENP-AYDH 46 usage_00612.pdb 1 AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPS-YDK- 45 usage_01105.pdb 1 AMEMHIVHKKL-------------DKFAVLAFMIEVGDKVNKGFQ-- 32 usage_01662.pdb 1 AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPS-YDK- 45 usage_02112.pdb 1 AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPS-YDK- 45 usage_02291.pdb 1 AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPS-YDK- 45 usage_02292.pdb 1 AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPS-YDK- 45 AaElH VHy s glAVL lIE G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################