################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:04:47 2021
# Report_file: c_1487_103.html
################################################################################################
#====================================
# Aligned_structures: 7
#   1: usage_02191.pdb
#   2: usage_03065.pdb
#   3: usage_04255.pdb
#   4: usage_04256.pdb
#   5: usage_04258.pdb
#   6: usage_04260.pdb
#   7: usage_04261.pdb
#
# Length:         31
# Identity:        1/ 31 (  3.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      7/ 31 ( 22.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           10/ 31 ( 32.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_02191.pdb         1  --VEEILDTWYGFVGSHP------HLLYYFT   23
usage_03065.pdb         1  --DLYERFIETKRLT-E-VFAQNETLSEIYS   27
usage_04255.pdb         1  --SHMQRLIEGLQKFREGYFSSHRDLFEQLS   29
usage_04256.pdb         1  --SHMQRLIEGLQKFREGYFSSHRDLFEQLS   29
usage_04258.pdb         1  --SHMQRLIEGLQKFREGYFSSHRDLFEQLS   29
usage_04260.pdb         1  --SHMQRLIEGLQKFREGYFSSHRDLFEQLS   29
usage_04261.pdb         1  RGSHMQRLIEGLQKFREGYFSSHRDLFEQLS   31
                                 r ie      e        L e  s


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################