################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:17:23 2021
# Report_file: c_1332_51.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_00247.pdb
#   2: usage_00253.pdb
#   3: usage_00326.pdb
#   4: usage_00327.pdb
#   5: usage_00494.pdb
#   6: usage_00495.pdb
#   7: usage_00544.pdb
#   8: usage_00545.pdb
#   9: usage_00546.pdb
#  10: usage_00547.pdb
#  11: usage_00636.pdb
#  12: usage_00671.pdb
#  13: usage_00939.pdb
#  14: usage_00940.pdb
#
# Length:         39
# Identity:        0/ 39 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      5/ 39 ( 12.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           13/ 39 ( 33.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00247.pdb         1  -----EEANRTLTGH-LAYHFSPTETSRQNLLR------   27
usage_00253.pdb         1  -----GADVHCKVS-GVADHYAEDDDHALAIARRCVANL   33
usage_00326.pdb         1  FEELGGARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL   38
usage_00327.pdb         1  -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL   33
usage_00494.pdb         1  -----GAVVHATKS-GVVHFMVDSEQEAINLTKRLLSY-   32
usage_00495.pdb         1  -----GAVVHATKS-GVVHFMVDSEQEAINLTKRLLSYL   33
usage_00544.pdb         1  -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL   33
usage_00545.pdb         1  -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLS--   31
usage_00546.pdb         1  -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL   33
usage_00547.pdb         1  -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLS--   31
usage_00636.pdb         1  -----GGDLHSRTS-GVTDHLADDDEDALRIVRAIADTF   33
usage_00671.pdb         1  -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSY-   32
usage_00939.pdb         1  -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL   33
usage_00940.pdb         1  -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL   33
                                g   h   s  v          a           


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################