################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:00:04 2021 # Report_file: c_1412_102.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00161.pdb # 2: usage_00187.pdb # 3: usage_00236.pdb # 4: usage_00237.pdb # 5: usage_00533.pdb # 6: usage_00653.pdb # 7: usage_01060.pdb # 8: usage_01061.pdb # # Length: 48 # Identity: 5/ 48 ( 10.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 48 ( 25.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 48 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00161.pdb 1 VADAYLFTLSQWAPHVALD-LTDLSHLQDYLARIAQRPNVHSALVTEG 47 usage_00187.pdb 1 VADIYLFVVLGWSAYVNID-LSPWPSLQAFQGRVGGREAVQSALRAEG 47 usage_00236.pdb 1 VADAYLSTVLGWCEYLKID-LSKWPRILAYLERNQARPAVQAAMKAEG 47 usage_00237.pdb 1 VADAYLSTVLGWCEYLKID-LSKWPRILAYLERNQARPAVQAAMKAEG 47 usage_00533.pdb 1 QPDAYASVIIGWGVGQKLD-LSAYPKALKLRERVLARPNVQKAFKEEG 47 usage_00653.pdb 1 AADILMICVLRRLES-S-GILKDYGNLLAYVERGKARPAFKRAFDAQL 46 usage_01060.pdb 1 VADIYLFVVLGWSAYVNID-LSPWPSLQAFQGRVGGREAVQSALRAEG 47 usage_01061.pdb 1 VADIYLFVVLGWSAYVNID-LSPWPSLQAFQGRVGGREAVQSALRAEG 47 aD y w d L R R v A eg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################