################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:18 2021 # Report_file: c_1266_175.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00362.pdb # 2: usage_00469.pdb # 3: usage_00992.pdb # 4: usage_00993.pdb # 5: usage_00994.pdb # 6: usage_00996.pdb # 7: usage_00997.pdb # 8: usage_01108.pdb # 9: usage_01431.pdb # 10: usage_01471.pdb # # Length: 31 # Identity: 7/ 31 ( 22.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 31 ( 45.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 31 ( 9.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00362.pdb 1 GVLLYGEPGVGKTLLAKAIAGEAHVPFISVS 31 usage_00469.pdb 1 -IWLFGPATTGKTNIAEAIAHTVPFYGCV-- 28 usage_00992.pdb 1 GVLFYGPPGCGKTLLAKAIANECQANFISI- 30 usage_00993.pdb 1 GVLFYGPPGCGKTLLAKAIANECQANFISI- 30 usage_00994.pdb 1 GVLFYGPPGCGKTLLAKAIANECQANFISI- 30 usage_00996.pdb 1 GVLFYGPPGCGKTLLAKAIANECQANFISI- 30 usage_00997.pdb 1 GVLFYGPPGCGKTLLAKAIANECQANFISI- 30 usage_01108.pdb 1 GILLYGPPGTGKTLIARAVANETGAFFFLIN 31 usage_01431.pdb 1 GVLLYGPPGTGKTLLAKAVAATIGANFIFSP 31 usage_01471.pdb 1 GVLLYGPPGTGKTLLARAVAHHTDCTFIRV- 30 l yGppg GKTl A A A f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################