################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:37 2021 # Report_file: c_1369_42.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00335.pdb # 2: usage_00408.pdb # 3: usage_00592.pdb # 4: usage_00614.pdb # 5: usage_00804.pdb # 6: usage_00805.pdb # 7: usage_00806.pdb # 8: usage_00807.pdb # 9: usage_00808.pdb # 10: usage_00809.pdb # 11: usage_00857.pdb # 12: usage_00858.pdb # # Length: 46 # Identity: 14/ 46 ( 30.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 46 ( 43.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 46 ( 21.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00335.pdb 1 VTTLKILAQRWAPQIAAAHIKESQHLALQDIRDSIEELRYYRAHLL 46 usage_00408.pdb 1 VSTIKELARRWAPAVASGFAKSSAHTALSDVRDSIDELRHYRQFM- 45 usage_00592.pdb 1 -STLKELARRWKPEILDGFTKQGTHQAMDDIRESVAELAYYREHFI 45 usage_00614.pdb 1 -STLKELAARWKPEILEGFKKENTHLALDDIRESIKELAYYREHF- 44 usage_00804.pdb 1 VSTVKELSKRWRPEIMSGLK--ASHLAMDDIRDSISELKYYREY-- 42 usage_00805.pdb 1 VSTVKELSKRWRPEIMSGL-----HLAMDDIRDSISELKYYRE--- 38 usage_00806.pdb 1 VSTVKELSKRWRPEIMSGLKK-NSHLAMDDIRDSISELKYYREY-- 43 usage_00807.pdb 1 VSTVKELSKRWRPEIMSGLKKNASHLAMDDIRDSISELKYYREY-- 44 usage_00808.pdb 1 VSTVKELSKRWRPEIMSGLK----HLAMDDIRDSISELKYYRE--- 39 usage_00809.pdb 1 VSTVKELSKRWRPEIMSGLKKNASHLAMDDIRDSISELKYYRE--- 43 usage_00857.pdb 1 VSTLKELARRWKPEILDGFTKQGTHQ-ADDIRESVAELAYYRE--- 42 usage_00858.pdb 1 -STLKELARRWKPEILDGFTKQGTHQ-ADDIRESVAELAYYRE--- 41 sT KeL RW P i g H DiR S EL yYR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################