################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:44 2021 # Report_file: c_0776_103.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00334.pdb # 2: usage_00335.pdb # 3: usage_00336.pdb # 4: usage_00372.pdb # 5: usage_00807.pdb # 6: usage_00808.pdb # # Length: 68 # Identity: 35/ 68 ( 51.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 68 ( 51.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 68 ( 2.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00334.pdb 1 TLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRKHSKL 60 usage_00335.pdb 1 TLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRKHSKL 60 usage_00336.pdb 1 TLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRKHSKL 60 usage_00372.pdb 1 AAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRKHTKA 60 usage_00807.pdb 1 AAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRKHTKA 60 usage_00808.pdb 1 AAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRKHTKA 60 KIAPS L D AN A E R A H DIMDG FVPN GA V S RKH K usage_00334.pdb 61 VFDCHLM- 67 usage_00335.pdb 61 VFDCHL-- 66 usage_00336.pdb 61 VFDCHLM- 67 usage_00372.pdb 61 YLDCHL-- 66 usage_00807.pdb 61 YLDCHLMV 68 usage_00808.pdb 61 YLDCHLMV 68 DCHL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################