################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:06 2021 # Report_file: c_0417_17.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00104.pdb # 2: usage_00105.pdb # 3: usage_00123.pdb # 4: usage_00124.pdb # 5: usage_00127.pdb # 6: usage_00134.pdb # # Length: 61 # Identity: 17/ 61 ( 27.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 61 ( 50.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 61 ( 11.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00104.pdb 1 PFAYIRSKPKGNQIEGRVLKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIFTY 60 usage_00105.pdb 1 PFAYIRSKP--NQIEGRVLKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIFTY 58 usage_00123.pdb 1 PMCYVR------QIEGKAEKGQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSIFTY 54 usage_00124.pdb 1 PMCYVRS--G-NQIEGKAEKGQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSIFTY 57 usage_00127.pdb 1 PLAYIRSKPK-NQIEGRVTKGQKMVIIEDLISTGGSVLDAVAAAQREGADVLGVVAIFTY 59 usage_00134.pdb 1 PLIYPRREA-KAAIEGEYKKGDRVVIIDDLVSTGETKVEAIEKLRSAGLEVVSIVVLVDR 59 P Y R qIEG KGqk V eDLiSTGgs a G Vlg V ifty usage_00104.pdb - usage_00105.pdb - usage_00123.pdb - usage_00124.pdb - usage_00127.pdb - usage_00134.pdb 60 D 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################