################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:53:30 2021
# Report_file: c_1307_81.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00198.pdb
#   2: usage_00199.pdb
#   3: usage_00200.pdb
#   4: usage_00201.pdb
#   5: usage_00900.pdb
#   6: usage_01217.pdb
#   7: usage_01274.pdb
#   8: usage_01276.pdb
#   9: usage_01714.pdb
#  10: usage_01917.pdb
#  11: usage_01918.pdb
#  12: usage_01930.pdb
#
# Length:         31
# Identity:       29/ 31 ( 93.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     29/ 31 ( 93.5%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 31 (  6.5%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00198.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_00199.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_00200.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_00201.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNW-   29
usage_00900.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_01217.pdb         1  GQDISETFNHANGLTLVSRAHQLVMEGYNWC   31
usage_01274.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_01276.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_01714.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_01917.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_01918.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
usage_01930.pdb         1  -QDISETFNHANGLTLVSRAHQLVMEGYNWC   30
                            QDISETFNHANGLTLVSRAHQLVMEGYNW 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################