################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:49 2021 # Report_file: c_0557_14.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00024.pdb # 2: usage_00025.pdb # 3: usage_00026.pdb # 4: usage_00027.pdb # 5: usage_00052.pdb # 6: usage_00178.pdb # 7: usage_00215.pdb # 8: usage_00220.pdb # # Length: 70 # Identity: 8/ 70 ( 11.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 70 ( 42.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 70 ( 12.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00024.pdb 1 ---LRLAVSLSK-EIYYHGEPIPVTVAVTNSTEKTVKKIKVLVEQVTNVVL---YSSDYY 53 usage_00025.pdb 1 DKPLRLAVSLSK-EIYYHGEPIPVTVAVTNSTEKTVKKIKVLVEQVTNVVL---YSSDYY 56 usage_00026.pdb 1 ---LRLAVSLSK-EIYYHGEPIPVTVAVTNSTEKTVKKIKVLVEQVTNVVL---YSSDYY 53 usage_00027.pdb 1 DKPLRLAVSLSK-EIYYHGEPIPVTVAVTNSTEKTVKKIKVLVEQVTNVVL---YSSDYY 56 usage_00052.pdb 1 DKPLHLEASLDK-EIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICL---FNTAQY 56 usage_00178.pdb 1 -KSFEVVFN-DPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWMQGSQQCKQ 58 usage_00215.pdb 1 ---LHLEASLDK-EIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICL---FNTAQY 53 usage_00220.pdb 1 ---LHLEASLDK-ELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICL---FSTAQY 53 l l s k e YyhGEp v V Vtn ktVKkik v q l y usage_00024.pdb 54 IKTVAAEEA- 62 usage_00025.pdb 57 IKTVAAEEA- 65 usage_00026.pdb 54 IKTVAAEEA- 62 usage_00027.pdb 57 IKTVAAEEA- 65 usage_00052.pdb 57 KCPVAMEEA- 65 usage_00178.pdb 59 TSEYLRYEDT 68 usage_00215.pdb 54 KCPVAMEEA- 62 usage_00220.pdb 54 KCPVAQVEQD 63 va E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################