################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:52 2021 # Report_file: c_1396_129.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00011.pdb # 2: usage_00279.pdb # 3: usage_00280.pdb # 4: usage_00441.pdb # 5: usage_00442.pdb # 6: usage_01389.pdb # 7: usage_01390.pdb # 8: usage_01578.pdb # # Length: 68 # Identity: 49/ 68 ( 72.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/ 68 ( 72.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 68 ( 27.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00011.pdb 1 --ALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVY-- 56 usage_00279.pdb 1 -------VLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVY-- 51 usage_00280.pdb 1 -------VLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVY-- 51 usage_00441.pdb 1 ---------GLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVY-- 49 usage_00442.pdb 1 SDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVY-- 58 usage_01389.pdb 1 -------VLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVY-- 51 usage_01390.pdb 1 ---------GLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVY-- 49 usage_01578.pdb 1 ----KWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVYPG 56 GLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANRKAYAWRYVY usage_00011.pdb -------- usage_00279.pdb -------- usage_00280.pdb -------- usage_00441.pdb -------- usage_00442.pdb -------- usage_01389.pdb -------- usage_01390.pdb -------- usage_01578.pdb 57 MAGMGLFV 64 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################