################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:59 2021 # Report_file: c_1250_31.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00003.pdb # 2: usage_00160.pdb # 3: usage_00214.pdb # 4: usage_00501.pdb # 5: usage_00888.pdb # 6: usage_01183.pdb # 7: usage_01184.pdb # 8: usage_01185.pdb # 9: usage_01186.pdb # 10: usage_01285.pdb # 11: usage_01286.pdb # # Length: 43 # Identity: 8/ 43 ( 18.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 43 ( 30.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 43 ( 14.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 GMISFRI--KGGAEAASKFASSTRLFTLAESLGGIESLLEV-- 39 usage_00160.pdb 1 -MLSFEL--DGDEQTLRRFLGGLSLFTLAESLGGVESLISH-- 38 usage_00214.pdb 1 --FSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQ 41 usage_00501.pdb 1 --MLSFT--LKNDSEAVAFVESLKLFILGESLGGVESLVGI-- 37 usage_00888.pdb 1 -MVTFYI--KGTLQHAEIFLKNLKLFTLAESLGGFESLAEL-- 38 usage_01183.pdb 1 -MVTFYI--KGTLQHAEIFLKNLKLFTLAVSLGGFESLAEL-- 38 usage_01184.pdb 1 -MVTFYI--KGTLQHAEIFLKNLKLFTLAVSLGGFESLAEL-- 38 usage_01185.pdb 1 -MVTFYI--KGTLQHAEIFLKNLKLFTLAVSLGGFESLAEL-- 38 usage_01186.pdb 1 -MVTFYI--KGTLQHAEIFLKNLKLFTLAVSLGGFESLAEL-- 38 usage_01285.pdb 1 -MVTFYI--KGTLQHAEIFLKNLKLFTLAESLGGFESLAEL-- 38 usage_01286.pdb 1 -MVTFYI--KGTLQHAEIFLKNLKLFTLAESLGGFESLAEL-- 38 f f LF la SlGG ESL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################