################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:51:32 2021 # Report_file: c_0805_32.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00029.pdb # 2: usage_00030.pdb # 3: usage_00031.pdb # 4: usage_00032.pdb # 5: usage_00231.pdb # 6: usage_00232.pdb # 7: usage_00233.pdb # 8: usage_00234.pdb # 9: usage_00293.pdb # 10: usage_00294.pdb # 11: usage_00295.pdb # 12: usage_00296.pdb # # Length: 47 # Identity: 47/ 47 (100.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 47 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 47 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00029.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00030.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00031.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00032.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00231.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00232.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00233.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00234.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00293.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00294.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00295.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 usage_00296.pdb 1 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN 47 PYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWAN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################