################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:09 2021 # Report_file: c_0664_56.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00263.pdb # 2: usage_00264.pdb # 3: usage_00553.pdb # 4: usage_00584.pdb # 5: usage_00639.pdb # # Length: 67 # Identity: 19/ 67 ( 28.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 67 ( 46.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 67 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00263.pdb 1 EMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNK--EKVVGRIISSTPLAE-N-TNSVTN 56 usage_00264.pdb 1 EMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNK--EKVVGRIISSTPLAE-N-TNSVTN 56 usage_00553.pdb 1 EIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEK----VLGRLITVNPIVT-E-KDSPVN 54 usage_00584.pdb 1 IPAETLHGTVTVEVQYAGTDGPCKVPAQMAVD-MQTLTPVGRLITANPVITESTENSKMM 59 usage_00639.pdb 1 EIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEK--RHVLGRLITVNPIVT-E-KDSPVN 56 e AETqHGT v V YeG g PCK P ei d k v GR I P S n usage_00263.pdb 57 IELEPP- 62 usage_00264.pdb 57 IELEPP- 62 usage_00553.pdb 55 IEAEPPF 61 usage_00584.pdb 60 LELD--- 63 usage_00639.pdb 57 IE----- 58 iE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################