################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:41:42 2021 # Report_file: c_1336_107.html ################################################################################################ #==================================== # Aligned_structures: 21 # 1: usage_00101.pdb # 2: usage_00102.pdb # 3: usage_00103.pdb # 4: usage_00104.pdb # 5: usage_00105.pdb # 6: usage_00349.pdb # 7: usage_00350.pdb # 8: usage_00520.pdb # 9: usage_00630.pdb # 10: usage_00631.pdb # 11: usage_00632.pdb # 12: usage_00633.pdb # 13: usage_00634.pdb # 14: usage_00635.pdb # 15: usage_00636.pdb # 16: usage_00637.pdb # 17: usage_00638.pdb # 18: usage_00639.pdb # 19: usage_00640.pdb # 20: usage_00641.pdb # 21: usage_00642.pdb # # Length: 50 # Identity: 12/ 50 ( 24.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 50 ( 42.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 50 ( 2.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00101.pdb 1 SRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMDTYSMNQ- 49 usage_00102.pdb 1 SRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMDTYSMNQ- 49 usage_00103.pdb 1 SRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMDTYSMNQG 50 usage_00104.pdb 1 SRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMDTYSMNQ- 49 usage_00105.pdb 1 SRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMDTYSMNQ- 49 usage_00349.pdb 1 SDREKERLARGYIRAIYDVISPYEDIPAPDVYTNPQIMAWMMDEYETISR 50 usage_00350.pdb 1 SDREKERLARGYIRAIYDVISPYEDIPAPDVYTNPQIMAWMMDEYETISR 50 usage_00520.pdb 1 SERELEQLSRGWVRGLYKYLGDRIDIPAPDVNTNGQIMSWFVDEYVKLN- 49 usage_00630.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNV- 49 usage_00631.pdb 1 SPQELERLVRRYTAELVGLIGPDSDILGPDLGADQQVMAWIMDTYSMTVG 50 usage_00632.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNV- 49 usage_00633.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNV- 49 usage_00634.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNVG 50 usage_00635.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNV- 49 usage_00636.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNV- 49 usage_00637.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNVG 50 usage_00638.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNVG 50 usage_00639.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNV- 49 usage_00640.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNVG 50 usage_00641.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNV- 49 usage_00642.pdb 1 SPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNV- 49 S E Er R y p DIpaPDv t MaW mD Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################