################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:18:46 2021 # Report_file: c_1376_4.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00053.pdb # 2: usage_00056.pdb # 3: usage_00078.pdb # 4: usage_00333.pdb # 5: usage_00443.pdb # 6: usage_00496.pdb # 7: usage_00984.pdb # 8: usage_01026.pdb # 9: usage_01344.pdb # 10: usage_01345.pdb # # Length: 59 # Identity: 10/ 59 ( 16.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 59 ( 22.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 59 ( 37.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00053.pdb 1 --DLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRY 57 usage_00056.pdb 1 -ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAM----- 53 usage_00078.pdb 1 -ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASI- 57 usage_00333.pdb 1 ---DMPFRQITEMTILTVQLIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARR- 55 usage_00443.pdb 1 -SMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAY 58 usage_00496.pdb 1 EISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASI- 58 usage_00984.pdb 1 --------------TPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLVR------ 39 usage_01026.pdb 1 -ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASI- 57 usage_01344.pdb 1 -ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASI- 57 usage_01345.pdb 1 ----------------TVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIV 43 eFAK p F l DQ LLK E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################