################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 22:54:35 2021 # Report_file: c_1142_337.html ################################################################################################ #==================================== # Aligned_structures: 2 # 1: usage_00829.pdb # 2: usage_00830.pdb # # Length: 44 # Identity: 34/ 44 ( 77.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 44 ( 77.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 44 ( 22.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00829.pdb 1 FRCRLRCLLDNSSGFLAMNFQGRLKYLHGQNLPPQLALFAIATP 44 usage_00830.pdb 1 FRCRLRCLL----GFLAMNFQGRLKY------PPQLALFAIATP 34 FRCRLRCLL GFLAMNFQGRLKY PPQLALFAIATP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################