################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:13:54 2021
# Report_file: c_1171_31.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_00150.pdb
#   2: usage_00398.pdb
#   3: usage_00450.pdb
#   4: usage_00451.pdb
#   5: usage_00485.pdb
#   6: usage_00629.pdb
#   7: usage_00931.pdb
#   8: usage_01068.pdb
#   9: usage_01071.pdb
#  10: usage_01073.pdb
#  11: usage_01092.pdb
#  12: usage_01615.pdb
#  13: usage_01616.pdb
#  14: usage_01743.pdb
#
# Length:         35
# Identity:        0/ 35 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      0/ 35 (  0.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           14/ 35 ( 40.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00150.pdb         1  GWGVLIKHIQRQTPKN-GQPPYPEQESYVLDVLLK   34
usage_00398.pdb         1  -DWESVFSEFHDADA-QNSHS-----YCFEILERR   28
usage_00450.pdb         1  -DWESVFSEFHDADA-QNSHS-----YCFEILER-   27
usage_00451.pdb         1  -DWESVFSEFHDADA-QNSHS-----YCFEILER-   27
usage_00485.pdb         1  -DWESVFSEFHDADA-QNSHS-----YCFEILER-   27
usage_00629.pdb         1  -LFETVSSKFYTKDE-KNPYD-----FTIQYRKR-   27
usage_00931.pdb         1  -DWESVFSEFHDADA-QNSHS-----YCFEILER-   27
usage_01068.pdb         1  -QFKQVGYEVRDG-------N-----EVCIDALSR   22
usage_01071.pdb         1  -DWESVFSEFHDADA-QNSHS-----YCFEILER-   27
usage_01073.pdb         1  -DWESVFSEFHDADA-QNSHS-----YSFEILERR   28
usage_01092.pdb         1  -DWESVFSEFHDADA-QNSHS-----YCFEILER-   27
usage_01615.pdb         1  -DWESVFSEFHDADA-QNAHS-----YCFEILERR   28
usage_01616.pdb         1  -DWESVFSEFHDADA-QNSHS-----YCFEILER-   27
usage_01743.pdb         1  -DWEVASSVEGKLDE-KNTIP-----HTFLHLIR-   27
                                                              


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################