################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:13 2021 # Report_file: c_1387_145.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00094.pdb # 2: usage_00118.pdb # 3: usage_00145.pdb # 4: usage_00463.pdb # 5: usage_00464.pdb # 6: usage_00480.pdb # 7: usage_00915.pdb # 8: usage_00958.pdb # 9: usage_01012.pdb # 10: usage_01175.pdb # 11: usage_01806.pdb # 12: usage_02212.pdb # 13: usage_02560.pdb # # Length: 33 # Identity: 14/ 33 ( 42.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 33 ( 60.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 33 ( 18.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00094.pdb 1 -EVLREQAGGDATENFEDVGHSTDARELSK--- 29 usage_00118.pdb 1 EEVLREQAGGDATENFEDVGHSTDARELSKTYI 33 usage_00145.pdb 1 EEVLREQAGGDATENFEDVGHSTDARELSKTYI 33 usage_00463.pdb 1 EEILLEQAGADATESFEDIGHSPDAREM----- 28 usage_00464.pdb 1 EEILLEQAGADATESFEDIGHSPDAREMLKQYY 33 usage_00480.pdb 1 -AVLRAQAGGDATANFEAVGHSTDARELSKTFI 32 usage_00915.pdb 1 EEVLREQAGGDATENWEDVGHSTDARELSKTFI 33 usage_00958.pdb 1 EEVLREQAGADATESFEDVGHSPDAREM----- 28 usage_01012.pdb 1 EEVLIEQAGKDATEHFEDVGHSSDAREMMKQYK 33 usage_01175.pdb 1 EEVLREQAGGDATENFEDVGHSTDARELSKTFI 33 usage_01806.pdb 1 -EVLLEQAGADATESFEDVGHSPDAREMLKQYY 32 usage_02212.pdb 1 -EVLLEQAGADATESFEDVGHSPDAREMLKQYY 32 usage_02560.pdb 1 EEVLLEQAGVDASESFEDVGHSSDAREMLKQYY 33 e L eQAG DAte fEd GHS DARE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################