################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:06 2021 # Report_file: c_0757_19.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00132.pdb # 2: usage_00133.pdb # 3: usage_00134.pdb # 4: usage_00135.pdb # 5: usage_00136.pdb # 6: usage_00137.pdb # 7: usage_00297.pdb # # Length: 62 # Identity: 17/ 62 ( 27.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 62 ( 82.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 62 ( 17.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00132.pdb 1 PKIFLFHT-PYHKGLN-------EQGSHEVAHLIKTHNPLLVLVAGKGQKHE-LGASWVV 51 usage_00133.pdb 1 -KIFLFHT-PYHKGLN-------EQGSHEVAHLIKTHNPLLVLVAGKGQKHE-LGASWVV 50 usage_00134.pdb 1 -KIFLFHT-PYHKGLN-------EQGSHEVAHLIKTHNPLLVLVAGKGQKHE-LGASWVV 50 usage_00135.pdb 1 PKIFLFHT-PYHKGLN-------EQGSHEVAHLIKTHNPLLVLVAGKGQKHE-LGASWVV 51 usage_00136.pdb 1 -KIFLFHT-PYHKGLN-------EQGSHEVAHLIKTHNPLLVLVAGKGQKHE-LGASWVV 50 usage_00137.pdb 1 -KIFLFHT-PYHKGLN-------EQGSHEVAHLIKTHNPLLVLVAGKGQKHE-LGASWVV 50 usage_00297.pdb 1 RLVTIFYTPPIGEFVDRTPEDPKHHGSAVVNTIIKSLNPEVAIVGHVGKGHELVGNTIVV 60 kiflFhT Pyhkgln eqGSheVahlIKthNPllvlVagkGqkHE lGaswVV usage_00132.pdb 52 V- 52 usage_00133.pdb 51 V- 51 usage_00134.pdb 51 V- 51 usage_00135.pdb 52 V- 52 usage_00136.pdb 51 V- 51 usage_00137.pdb 51 V- 51 usage_00297.pdb 61 NP 62 v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################