################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:36:23 2021 # Report_file: c_0423_2.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00040.pdb # 2: usage_00041.pdb # 3: usage_00060.pdb # 4: usage_00067.pdb # 5: usage_00069.pdb # 6: usage_00094.pdb # 7: usage_00095.pdb # # Length: 96 # Identity: 6/ 96 ( 6.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 96 ( 42.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/ 96 ( 28.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00040.pdb 1 --------GCELGPDN--TSVPTA-KFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQ 49 usage_00041.pdb 1 --------GCELGPDN--TSVPTA-KFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQ 49 usage_00060.pdb 1 TFTLQGLLGCELAPDN--SSLPTA-VFALNGEEFMRFNPRTGNWSGEWPETDIVGNLWMK 57 usage_00067.pdb 1 --HLQV--TMIYPQS-QGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKD 55 usage_00069.pdb 1 --------GCELGPDN--TSVPTA-KFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQ 49 usage_00094.pdb 1 --------GCELGPDN--TSVPTA-KFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQ 49 usage_00095.pdb 1 PYTLQGLLGCELGPDN--TSVPTA-KFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQ 57 gcel pd s pta FalngeeFm F g W g wpE i W usage_00040.pdb 50 QDKAANK---ELTFLLFSCPHRLREHLERGR----- 77 usage_00041.pdb 50 QDKAANK---ELTFLLFSCPHRLREHLERGRGNLEW 82 usage_00060.pdb 58 QPEAARK---ESEFLLTSCPERLLGHLERGRQNLEW 90 usage_00067.pdb 56 DGEF---VKQLKFLIHECSQKMDEFLK--------- 79 usage_00069.pdb 50 QDKAANK---ELTFLLFSCPHRLREHLERGRGNLEW 82 usage_00094.pdb 50 QDKAANK---ELTFLLFSCPHRLREHLE-------- 74 usage_00095.pdb 58 QDKAANK---ELTFLLFSCPHRLREHLERGRGNLEW 90 q a e fll scp rl hl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################