################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:24:53 2021 # Report_file: c_1438_4.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00023.pdb # 2: usage_00062.pdb # 3: usage_00063.pdb # 4: usage_00064.pdb # 5: usage_00065.pdb # 6: usage_00089.pdb # # Length: 97 # Identity: 25/ 97 ( 25.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 68/ 97 ( 70.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/ 97 ( 29.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 ----LALGKAVFDG----NCAACHAG---GG-NNVIPDHTLQKAAIEQFLDGGFNIEAIV 48 usage_00062.pdb 1 -EDKLALGREIFLERSEPQCALCHTLADAEAVGEVGPN----LDELK------PDAERVN 49 usage_00063.pdb 1 -EDKLALGREIFLERSEPQCALCHTLADAEAVGEVGPN----LDELK------PDAERVN 49 usage_00064.pdb 1 -EDKLALGREIFLERSEPQCALCHTLADAEAVGEVGPN----LDELK------PDAERVN 49 usage_00065.pdb 1 EEDKLALGREIFLERSEPQCALCHTLADAEAVGEVGPN----LDELK------PDAERVN 50 usage_00089.pdb 1 ----LALGREIFLERSEPQCALCHTLADAEAVGEVGPN----LDELK------PDAERVN 46 LALGreiFle qCAlCHtl ea geVgPn ldelk pdaErvn usage_00023.pdb 49 YQIENGKGAMPAWDGR-LDEDEIAGVAAYVYDQAAGN 84 usage_00062.pdb 50 TAVTNGIGPMPAN--EILTDEEIEAVALYVSTVA--- 81 usage_00063.pdb 50 TAVTNGIGPMPAN--EILTDEEIEAVALYVSTV---- 80 usage_00064.pdb 50 TAVTNGIGPMPAN--EILTDEEIEAVALYVSTV---- 80 usage_00065.pdb 51 TAVTNGIGPMPAN--EILTDEEIEAVALYVSTVA--- 82 usage_00089.pdb 47 TAVTNGIGPMPAN--EILTDEEIEAVALYVSTVA--- 78 tavtNGiGpMPAn e LtdeEIeaVAlYVstv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################