################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:35 2021 # Report_file: c_0776_99.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00063.pdb # 2: usage_00064.pdb # 3: usage_00430.pdb # 4: usage_00431.pdb # 5: usage_00454.pdb # 6: usage_00501.pdb # # Length: 62 # Identity: 3/ 62 ( 4.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 62 ( 51.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 62 ( 11.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00063.pdb 1 NFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMV 60 usage_00064.pdb 1 NFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMV 60 usage_00430.pdb 1 NVVSYGLN-ENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMV 59 usage_00431.pdb 1 NVVSYGLN-ENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMV 59 usage_00454.pdb 1 -HVFKLDP-N-KPIDDERLERLCES-GTDAVIVGG--VTID-NVLDLLARIRRFSVPCAL 53 usage_00501.pdb 1 NVVSYGLN-ENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMV 59 Vsy e e Dyda a e pklivaGa df ia vgaylmv usage_00063.pdb 61 DM 62 usage_00064.pdb 61 DM 62 usage_00430.pdb 60 DM 61 usage_00431.pdb 60 DM 61 usage_00454.pdb 54 EV 55 usage_00501.pdb 60 DM 61 dm #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################