################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:32:22 2021
# Report_file: c_1431_67.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00748.pdb
#   2: usage_01017.pdb
#   3: usage_01018.pdb
#   4: usage_01019.pdb
#   5: usage_01020.pdb
#   6: usage_01021.pdb
#
# Length:         67
# Identity:       17/ 67 ( 25.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     33/ 67 ( 49.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           34/ 67 ( 50.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00748.pdb         1  GYDVILMKKGMLDIQREAREKLEQLDYANPEDIDKIYFYKSVIETAEGVMIYARRLSAYA   60
usage_01017.pdb         1  GYDVLLFTKGMNGIKADAEAHLASLSMENPEDIDRIYYYKAAIETCEGVVNYARRIAAHA   60
usage_01018.pdb         1  GYDVLLFTKGMNGIKADAEAHLASLSMENPEDI---------------------------   33
usage_01019.pdb         1  GYDVLLFTKGMNGIKADAEAHLASLSMENPEDI---------------------------   33
usage_01020.pdb         1  GYDVLLFTKGMNGIKADAEAHLASLSMENPEDI---------------------------   33
usage_01021.pdb         1  GYDVLLFTKGMNGIKADAEAHLASLSMENPEDI---------------------------   33
                           GYDVlLftKGMngIkadAeahLasLsmeNPEDI                           

usage_00748.pdb        61  AELAAR-   66
usage_01017.pdb        61  RELAAKE   67
usage_01018.pdb            -------     
usage_01019.pdb            -------     
usage_01020.pdb            -------     
usage_01021.pdb            -------     
                                  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################