################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:07:58 2021 # Report_file: c_1133_18.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00083.pdb # 2: usage_00471.pdb # 3: usage_00483.pdb # 4: usage_00528.pdb # # Length: 123 # Identity: 54/123 ( 43.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 112/123 ( 91.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/123 ( 7.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00083.pdb 1 ----SFDVQVGLHALLGHGSGKLFVQDEKGAFNFDQETVIN-PETGEQIQSWYRSGETWD 55 usage_00471.pdb 1 WKGPSFDVQVGLHALLGHGSGKLFVQDEKGAFNFDQETVIN-PETGEQIQSWYRCGETWD 59 usage_00483.pdb 1 WKGPSFDVQVGLHALLGHGSGKLFVQDEKGAFNFDQETVIN-PETGEQIQSWYRCGETWD 59 usage_00528.pdb 1 YQSDSFEVQVDIHELLGHGSGKLLTEFTDGFN-FDKENP-PLGLDGKPVSTYYKVGETWG 58 SFdVQVglHaLLGHGSGKLfvqdekGaf FDqEtv n petGeqiqswYr GETWd usage_00083.pdb 56 SKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEG-ADAEDVIYVNWLNMVRAGLLALE 114 usage_00471.pdb 60 SKFSTIASSYEECRAESVGLYLSLHPQVLEIFGFEG-ADAEDVIYVNWLNMVRAGLLALE 118 usage_00483.pdb 60 SKFSTIASSYEECRAESVGLYLSLHPQVLEIFGFEG-ADAEDVIYVNWLNMVRAGLLALE 118 usage_00528.pdb 59 SKFGQLAGPFEECRAEVIAMFLLTNKKILDIFGFHDVESQDKVIYAGYLQMARAGLLALE 118 SKFstiAssyEECRAEsvglyL lhpqvLeIFGFeg adaedVIYvnwLnMvRAGLLALE usage_00083.pdb 115 FY- 116 usage_00471.pdb 119 FYT 121 usage_00483.pdb 119 FY- 120 usage_00528.pdb 119 YWN 121 fy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################