################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:47 2021 # Report_file: c_0950_14.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00163.pdb # 2: usage_00178.pdb # 3: usage_00179.pdb # 4: usage_00287.pdb # 5: usage_00288.pdb # 6: usage_00310.pdb # 7: usage_00311.pdb # 8: usage_00312.pdb # 9: usage_00313.pdb # 10: usage_00695.pdb # 11: usage_00700.pdb # # Length: 39 # Identity: 31/ 39 ( 79.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 39 ( 79.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 39 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00163.pdb 1 AVVTSPVTGKSYFLGGAGERGL------IKFTAIGVYL- 32 usage_00178.pdb 1 AVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYL- 38 usage_00179.pdb 1 AVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYL- 38 usage_00287.pdb 1 AVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYL- 38 usage_00288.pdb 1 AVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYL- 38 usage_00310.pdb 1 AVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYL- 38 usage_00311.pdb 1 AVVTSPVTGKSYFLGGAGERGLTI--NFIKFAAIGVYL- 36 usage_00312.pdb 1 AVVTSPVTGKSYFLGGAGERGLTIEGNFIKFAAIGVYL- 38 usage_00313.pdb 1 AVVTSPVTGKSYFLGGAGERGL-----FIKFAAIGVYLE 34 usage_00695.pdb 1 AVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYL- 38 usage_00700.pdb 1 AVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYL- 38 AVVTSPVTGKSYFLGGAGERGL IKF AIGVYL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################