################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:24 2021 # Report_file: c_0935_101.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00133.pdb # 2: usage_00176.pdb # 3: usage_00177.pdb # 4: usage_00293.pdb # 5: usage_00338.pdb # 6: usage_00339.pdb # 7: usage_00786.pdb # 8: usage_00790.pdb # 9: usage_00791.pdb # 10: usage_00995.pdb # 11: usage_01438.pdb # 12: usage_01530.pdb # # Length: 49 # Identity: 11/ 49 ( 22.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 49 ( 95.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 49 ( 2.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00133.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGE 49 usage_00176.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGE 49 usage_00177.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGE 49 usage_00293.pdb 1 PNYSHPALTVTPDGDLLASYDGRPTGIAAPGPNSILQRRSTDGGRTWGE 49 usage_00338.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGE 49 usage_00339.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGE 49 usage_00786.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIGAPGPNSILQRRSTDGGRTWGE 49 usage_00790.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGE 49 usage_00791.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGE 49 usage_00995.pdb 1 HSFR-LPALVNVDGVMVAIADARYETSFDNSLIDTVAKYSVDDGETWET 48 usage_01438.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGE 49 usage_01530.pdb 1 PNYRIPALTVTPDGDLLASYDGRPTGIGAPGPNSILQRRSTDGGRTWGE 49 pnyr paltVtpDGdllAsyDgRptgi apgpnsilqrrStDgGrTWge #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################