################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:56 2021 # Report_file: c_1172_71.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_01643.pdb # 2: usage_01647.pdb # 3: usage_01672.pdb # 4: usage_01673.pdb # 5: usage_02174.pdb # 6: usage_02175.pdb # 7: usage_02176.pdb # 8: usage_03733.pdb # 9: usage_04919.pdb # 10: usage_04920.pdb # 11: usage_04921.pdb # # Length: 40 # Identity: 7/ 40 ( 17.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 40 ( 82.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 40 ( 17.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01643.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_01647.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_01672.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_01673.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_02174.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_02175.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_02176.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_03733.pdb 1 HIYRKVRDRASYAFALVSVAAIIQPD-----GSGRVALGG 35 usage_04919.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_04920.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 usage_04921.pdb 1 R-CYKLSKRFDQDISAVCGCLNLTLKGSKIE-TARIAFGG 38 r cyKlskRfdqdisaVcgclnltlk taRiAfGG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################