################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:18 2021 # Report_file: c_0787_47.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00073.pdb # 2: usage_00074.pdb # 3: usage_00075.pdb # 4: usage_00076.pdb # 5: usage_00129.pdb # 6: usage_00578.pdb # 7: usage_00579.pdb # 8: usage_00744.pdb # 9: usage_00754.pdb # 10: usage_01032.pdb # # Length: 59 # Identity: 23/ 59 ( 39.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 59 ( 45.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 59 ( 16.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00073.pdb 1 DYQILFLQGGASLQFTMLPM-NLLTKGTIGNYVLTGSWSEKALKEAKLLGETHI-AA-- 55 usage_00074.pdb 1 DYQILFLQGGASLQFTMLPM-NLLTKGTIGNYVLTGSWSEKALKEAKLLGETHI----- 53 usage_00075.pdb 1 DYQILFLQGGASLQFTMLPM-NLLTKGTIGNYVLTGSWSEKALKEAKLLGETHI----- 53 usage_00076.pdb 1 DYQILFLQGGASLQFTMLPM-NLLTKGTIGNYVLTGSWSEKALKEAKLLGETHI-AA-- 55 usage_00129.pdb 1 DYKVLFLQGGASQQFAEIPL-NLLPEDGVADYIDTGIWSKKAIEEARRYGTVNV-AASA 57 usage_00578.pdb 1 DYQILFLQGGASLQFTMLPM-NLLTKGTIGNYVLTGSWSEKALKEAKLLGETHI----- 53 usage_00579.pdb 1 DYQILFLQGGASLQFTMLPM-NLLTKGTIGNYVLTGSWSEKALKEAKLLGETHI----- 53 usage_00744.pdb 1 DYQILFLQGGASLQFTMLPM-NLLTKGTIGNYVLTGSWSEKALKEAKLLGETHI----- 53 usage_00754.pdb 1 DYEVLFLQGGASLQFAI---PNL-ALNGVCEYANTGVWTKKAIKEAQILGVNVKTVA-- 53 usage_01032.pdb 1 DYQILFLQGGASLQFTMLPM-NLLTKGTIGNYVLTGSWSEKALKEAKLLGETHI----- 53 DY LFLQGGASlQF NL Y TG Ws KA kEA lG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################