################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:21 2021 # Report_file: c_1191_63.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00341.pdb # 2: usage_00352.pdb # 3: usage_00353.pdb # 4: usage_01186.pdb # 5: usage_02094.pdb # 6: usage_02221.pdb # # Length: 70 # Identity: 16/ 70 ( 22.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 70 ( 38.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 70 ( 25.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00341.pdb 1 QEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRD----IDRG-----------AGRADDSEW 45 usage_00352.pdb 1 DEKSWQARYDYNFAGVGIPGLTFMTRYVKGDN----IDLL-----------TTSGEGKEW 45 usage_00353.pdb 1 DEKSWQARYDYNFAGVGIPGLTFMTRYVKGDN----IDLL-----------TTSGEGKEW 45 usage_01186.pdb 1 QEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRD----IDRG-----------AGRADDSEW 45 usage_02094.pdb 1 GERTWQVRYGYDFATVGVPGLTFNTIYLSGDK----IKTA------------R-GDQSEW 43 usage_02221.pdb 1 NEKSWKLQYDYDFVALGVPGLSASASYSRGKLDLTRVDPDSPGYGGWYSAD-G-KNAKHW 58 EksWq rYdY Fa G PGL t Y G id eW usage_00341.pdb 46 ERNTDLSYV- 54 usage_00352.pdb 46 ERDMDIAYVF 55 usage_00353.pdb 46 ERDMDIAYVF 55 usage_01186.pdb 46 ERNTDLSYV- 54 usage_02094.pdb 44 ERDISLAYVI 53 usage_02221.pdb 59 ERDLDLQYVV 68 ER d YV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################