################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:52 2021 # Report_file: c_0658_21.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00182.pdb # 2: usage_00268.pdb # 3: usage_00452.pdb # 4: usage_00453.pdb # 5: usage_00454.pdb # 6: usage_01111.pdb # 7: usage_01112.pdb # # Length: 66 # Identity: 44/ 66 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/ 66 ( 92.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 66 ( 4.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00182.pdb 1 YFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNW 60 usage_00268.pdb 1 TFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTEEGNW 60 usage_00452.pdb 1 YFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNW 60 usage_00453.pdb 1 YFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNW 60 usage_00454.pdb 1 YFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNW 60 usage_01111.pdb 1 YFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNW 60 usage_01112.pdb 1 YFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNW 60 yFeVThDIT YsKAKvFehiGK TpiavRFSTVAGEsGSADtVRDPRGFAvKfYTEdGNW usage_00182.pdb 61 DLVGNN 66 usage_00268.pdb 61 DLVGNN 66 usage_00452.pdb 61 DLVGNN 66 usage_00453.pdb 61 DLVGN- 65 usage_00454.pdb 61 DLVGNN 66 usage_01111.pdb 61 DLV--- 63 usage_01112.pdb 61 DLVGNN 66 DLV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################