################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:53 2021 # Report_file: c_0971_44.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00006.pdb # 2: usage_00099.pdb # 3: usage_00100.pdb # 4: usage_00420.pdb # 5: usage_00421.pdb # 6: usage_00431.pdb # 7: usage_00537.pdb # # Length: 87 # Identity: 18/ 87 ( 20.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 87 ( 35.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 33/ 87 ( 37.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00006.pdb 1 HILGIRIVGGDHRLKNYSSTISLHSETI-D-----GKTGTLAIESFVVDVPEGNTKEETC 54 usage_00099.pdb 1 HVISFSVVGGDHRLKNYRSVTTL-----------------VVVESYIVDVPPGNTEEETL 43 usage_00100.pdb 1 HVISFSVV-------NYRSVTTL--------------EGTVVVESYIVDVPPGNTEEETL 39 usage_00420.pdb 1 RVLSFRVVGGEHRLKNYKSVTSVNEFLNQD----SGKVYTVVLESYTVDIPEGNTEEDTK 56 usage_00421.pdb 1 RVLSFRVVGGEHRLKNYKSVTSVNEFLNQD----SGKVYTVVLESYTVDIPEGNTEEDTK 56 usage_00431.pdb 1 RILSFRVLGGEHRLNNYRSVTSVNEFVVLEKDKK-KRVYSVVLESYIVDIPQGNTEEDTR 59 usage_00537.pdb 1 RILSFRVLGGEHRLNNYRSVTSVNEFVV---------VYSVVLESYIVDIPQGNTEEDTR 51 sf v NY Svt vv ESy VD P GNTeE T usage_00006.pdb 55 FFVEALIQCNLNSLADVTERLQAESME 81 usage_00099.pdb 44 SFVDTIVRCNLQSLARST--------- 61 usage_00100.pdb 40 SFVDTIVRCNLQSLARST--------- 57 usage_00420.pdb 57 MFVDTVVKLNLQKLGVAATSA------ 77 usage_00421.pdb 57 MFVDTVVKLNLQKLGVAATSA------ 77 usage_00431.pdb 60 MFVDTVVKSNLQNLAVISTA------- 79 usage_00537.pdb 52 MFVDTVVKSNLQNLAVISTA------- 71 FVdt v NLq L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################