################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:49 2021 # Report_file: c_1227_14.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_01468.pdb # 2: usage_01500.pdb # 3: usage_01501.pdb # 4: usage_01710.pdb # 5: usage_01711.pdb # 6: usage_01712.pdb # 7: usage_01713.pdb # # Length: 40 # Identity: 14/ 40 ( 35.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 40 ( 70.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 40 ( 30.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01468.pdb 1 -ILLLGNNYVIHRNSC-EVEISRVANRVLD---------- 28 usage_01500.pdb 1 DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQE-- 38 usage_01501.pdb 1 DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ 40 usage_01710.pdb 1 DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQEL- 39 usage_01711.pdb 1 DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQEL- 39 usage_01712.pdb 1 DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQEL- 39 usage_01713.pdb 1 DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQEL- 39 vLLLGNdYivpRhcp laEmSRVsiRiLD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################