################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:06 2021 # Report_file: c_1333_8.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00005.pdb # 2: usage_00025.pdb # 3: usage_00269.pdb # 4: usage_00270.pdb # 5: usage_00271.pdb # 6: usage_00337.pdb # 7: usage_00338.pdb # 8: usage_00456.pdb # 9: usage_00457.pdb # 10: usage_00510.pdb # 11: usage_00790.pdb # # Length: 44 # Identity: 16/ 44 ( 36.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 44 ( 70.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 44 ( 2.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 DYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCV 44 usage_00025.pdb 1 DYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV 44 usage_00269.pdb 1 DYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV 44 usage_00270.pdb 1 DYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV 44 usage_00271.pdb 1 DYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV 44 usage_00337.pdb 1 DYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV 44 usage_00338.pdb 1 DYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV 44 usage_00456.pdb 1 DYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV 44 usage_00457.pdb 1 DYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV 44 usage_00510.pdb 1 -YERVVRETVKEIGYDSEEKGLDYKTMDVIIKLEQQSNQIAGCV 43 usage_00790.pdb 1 -YIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGV 43 Y VvRe K IGYd s kGfD ktc V v leQQSpdIAq V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################