################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:12 2021 # Report_file: c_1484_110.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00151.pdb # 2: usage_02388.pdb # 3: usage_02439.pdb # 4: usage_02959.pdb # 5: usage_02960.pdb # 6: usage_02975.pdb # 7: usage_02976.pdb # 8: usage_03153.pdb # 9: usage_04746.pdb # 10: usage_04823.pdb # # Length: 40 # Identity: 32/ 40 ( 80.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 40 ( 80.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 40 ( 20.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00151.pdb 1 SLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACG 40 usage_02388.pdb 1 SLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACG 40 usage_02439.pdb 1 -LHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACG 39 usage_02959.pdb 1 SLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSAC- 39 usage_02960.pdb 1 SLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACG 40 usage_02975.pdb 1 SLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACG 40 usage_02976.pdb 1 SLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACG 40 usage_03153.pdb 1 SLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACG 40 usage_04746.pdb 1 SLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSAC- 39 usage_04823.pdb 1 -------WNREFVRTSPAGARYEALATEIDRGLRFMSAC- 32 WNREFVRTSPAGARYEALATEIDRGLRFMSAC #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################