################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:40:47 2021 # Report_file: c_0469_13.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00004.pdb # 2: usage_00005.pdb # 3: usage_00006.pdb # 4: usage_00015.pdb # 5: usage_00048.pdb # 6: usage_00114.pdb # 7: usage_00125.pdb # # Length: 84 # Identity: 2/ 84 ( 2.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 84 ( 7.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 84 ( 28.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 -ANIAAQKGTVPESMVKEQLPKAQLTSLTNMGEAVNELQAGKIDAVHMDEPVALSYAAKN 59 usage_00005.pdb 1 -ANIAAQKGTVPESMVKEQLPKAQLTSLTNMGEAVNELQAGKIDAVHMDEPVALSYAAKN 59 usage_00006.pdb 1 --NIAAQKGTVPESMVKEQLPKAQLTSLTNMGEAVNELQAGKIDAVHMDEPVALSYAAKN 58 usage_00015.pdb 1 -KKVGAQKGSIQETMAKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENN 59 usage_00048.pdb 1 -GIVAAQTATIQAGYIAE-S-GATLVEFATPEETIAAVRNGEADAVFADRDYLVPIVAES 57 usage_00114.pdb 1 -TTVLAVKGSTSAANIRQHAPDAKILELENYAEAFTALQSGQGDA-TTDNAILLGIADEN 58 usage_00125.pdb 1 DVTIATTLGTSQEEKAKEFFPLSKLQSVESPARDFQEVLAGRADGNITSSTEANKLVVKY 60 a g l G Da usage_00004.pdb 60 AGLAVATVSLKMKDGDANAVALR- 82 usage_00005.pdb 60 AGLAV------------------- 64 usage_00006.pdb 59 AGLAV------------------- 63 usage_00015.pdb 60 PDLAI------------------- 64 usage_00048.pdb 58 GGELM------------------F 63 usage_00114.pdb 59 PEYEL------------------- 63 usage_00125.pdb 61 PQLAI------------------- 65 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################