################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:12 2021 # Report_file: c_0888_79.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00053.pdb # 2: usage_00078.pdb # 3: usage_00637.pdb # 4: usage_00734.pdb # 5: usage_00801.pdb # # Length: 85 # Identity: 8/ 85 ( 9.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 85 ( 11.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 39/ 85 ( 45.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00053.pdb 1 --------SSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFS 52 usage_00078.pdb 1 --------SSAVKAELRQYFRNLCSDDTP-VRRAAASKLGEFAKVLELDNVKSEIIP-FS 50 usage_00637.pdb 1 --------------YPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLT 46 usage_00734.pdb 1 FSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFS 60 usage_00801.pdb 1 ----------------IAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFIV 44 R KL A L SE P usage_00053.pdb 53 NLASDEQDSVRLLAVEACVNIAQLL 77 usage_00078.pdb 51 NLASDEQDSVRLLAVEACVNIAQLL 75 usage_00637.pdb 47 DT-IYDEDEVLLALAEQLGTF---- 66 usage_00734.pdb 61 NLASD-------------------- 65 usage_00801.pdb 45 ELAEDAKWRVRLAIIEYMPLLAGQL 69 l d #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################