################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:46 2021 # Report_file: c_0832_21.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00051.pdb # 2: usage_00475.pdb # 3: usage_00476.pdb # 4: usage_00481.pdb # 5: usage_00878.pdb # 6: usage_00879.pdb # # Length: 72 # Identity: 34/ 72 ( 47.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 66/ 72 ( 91.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 72 ( 8.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00051.pdb 1 PGEKLFQKIQEVFGEVPVLAEDLGVITPEVEALRDRFGLPGMKVLQFAFD--MENPFLPH 58 usage_00475.pdb 1 --KSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPH 58 usage_00476.pdb 1 --KSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPH 58 usage_00481.pdb 1 --KSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPH 58 usage_00878.pdb 1 --KSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPH 58 usage_00879.pdb 1 --KSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPH 58 ksLFdaIskgvGkikiiAEDLGVITkdVveLRksiGaPGMaVLQFAFg adNPhLPH usage_00051.pdb 59 NYPAHGRVVVYT 70 usage_00475.pdb 59 NHE--VNQVVYS 68 usage_00476.pdb 59 NHE--VNQVVYS 68 usage_00481.pdb 59 NHE--VNQVVYS 68 usage_00878.pdb 59 NHE--VNQVVYS 68 usage_00879.pdb 59 NHE--VNQVVYS 68 Nhe vnqVVYs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################