################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:15 2021 # Report_file: c_1373_65.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00014.pdb # 2: usage_00108.pdb # 3: usage_00722.pdb # 4: usage_00723.pdb # 5: usage_00823.pdb # 6: usage_00824.pdb # 7: usage_00825.pdb # 8: usage_00915.pdb # 9: usage_00965.pdb # 10: usage_01350.pdb # # Length: 60 # Identity: 4/ 60 ( 6.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 60 ( 25.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 60 ( 31.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00014.pdb 1 DKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILAR-- 58 usage_00108.pdb 1 NRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHH 60 usage_00722.pdb 1 SRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHI------------------- 41 usage_00723.pdb 1 SRERIVGAAVELLDTVGERGLTFRALAERLATGPGAIYWHI------------------- 41 usage_00823.pdb 1 DKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILAR-- 58 usage_00824.pdb 1 DKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILARH- 59 usage_00825.pdb 1 DKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILARH- 59 usage_00915.pdb 1 DKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEMLDRH- 59 usage_00965.pdb 1 DKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEMLDRH- 59 usage_01350.pdb 1 KQVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYARETNRIL 60 a ell G Glt r lA l Ywh #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################