################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:50:21 2021 # Report_file: c_1392_1.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00031.pdb # 2: usage_00114.pdb # 3: usage_00231.pdb # 4: usage_00285.pdb # 5: usage_00286.pdb # 6: usage_00500.pdb # 7: usage_00501.pdb # 8: usage_00565.pdb # # Length: 82 # Identity: 53/ 82 ( 64.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 62/ 82 ( 75.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 82 ( 24.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00031.pdb 1 -----SLWELVIEQFEDLLVRILLLAACISFVLAWFE------TAFVEPFVILLILIANA 49 usage_00114.pdb 1 EEGKSLWELVIE-QFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANA 59 usage_00231.pdb 1 -----SLWELVIEQFEDLLVRILLLAACISFVLAWFE------TAFVEPFVILLILIANA 49 usage_00285.pdb 1 -----SLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANA 55 usage_00286.pdb 1 -----SLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANA 55 usage_00500.pdb 1 -----SLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANA 55 usage_00501.pdb 1 -----SLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANA 55 usage_00565.pdb 1 -----SLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANA 55 slwelvi QFEDLLVRILLLAACISFVLAWFE TAFVEPFVILLILIANA usage_00031.pdb 50 IVGVWQERNAENAIEALKEY-- 69 usage_00114.pdb 60 IVGVWQERNAENAIEALKEY-- 79 usage_00231.pdb 50 IVGVWQERNAENAIEALKEYE- 70 usage_00285.pdb 56 IVGVWQERNAENAIEALKEYEP 77 usage_00286.pdb 56 IVGVWQERNAENAIEALKEYEP 77 usage_00500.pdb 56 IVGVWQERNAENAIE------- 70 usage_00501.pdb 56 IVGVWQERNAENAIEA------ 71 usage_00565.pdb 56 IVGVWQERNAEN-AIEALKEYE 76 IVGVWQERNAEN ie #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################