################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:38 2021 # Report_file: c_1334_65.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00062.pdb # 2: usage_00183.pdb # 3: usage_00184.pdb # 4: usage_00204.pdb # 5: usage_00205.pdb # 6: usage_00484.pdb # 7: usage_00543.pdb # 8: usage_00866.pdb # 9: usage_00875.pdb # # Length: 35 # Identity: 1/ 35 ( 2.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 4/ 35 ( 11.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 35 ( 40.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00062.pdb 1 KEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASN 35 usage_00183.pdb 1 ----QEVAICYILYVLLQGESYGTELIQQLETE-- 29 usage_00184.pdb 1 ----QEVAICYILYVLLQGESYGTELIQQLETEHP 31 usage_00204.pdb 1 ---SKELAVCYVLAVLRHEDSYGTELIQHLET--- 29 usage_00205.pdb 1 ---SKELAVCYVLAVLRHEDSYGTELIQHLETHWP 32 usage_00484.pdb 1 ---------CYVLAVLRHEDSYGTELIQHLETHWP 26 usage_00543.pdb 1 -------IDILIVSILEKKDCYGYEIAKQVRERS- 27 usage_00866.pdb 1 ------YVDTIILSLLIEGDSYGYEISKNIRIKTD 29 usage_00875.pdb 1 ---SALLIEYLILAIVSKHDSYGYDISQTI----- 27 l l Yg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################