################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:52 2021 # Report_file: c_1148_210.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_03307.pdb # 2: usage_03308.pdb # 3: usage_03309.pdb # 4: usage_03310.pdb # 5: usage_03311.pdb # 6: usage_03312.pdb # 7: usage_03313.pdb # 8: usage_03314.pdb # 9: usage_03315.pdb # 10: usage_03316.pdb # 11: usage_03973.pdb # 12: usage_03974.pdb # 13: usage_03975.pdb # # Length: 34 # Identity: 26/ 34 ( 76.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 34 ( 76.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 34 ( 23.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_03307.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03308.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03309.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03310.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03311.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03312.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03313.pdb 1 GVNVLNERAWGPGYRHDAEFV---PSQFSFYRWS 31 usage_03314.pdb 1 -----NERAWGPGYRHDAEFVTDPPSQFSFYRWS 29 usage_03315.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03316.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03973.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03974.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 usage_03975.pdb 1 GVNVLNERAWGPGYRHDAEFVTDPPSQFSFYRWS 34 NERAWGPGYRHDAEFV PSQFSFYRWS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################