################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:48:10 2021 # Report_file: c_1345_7.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00014.pdb # 2: usage_00015.pdb # 3: usage_00054.pdb # 4: usage_00175.pdb # 5: usage_00176.pdb # 6: usage_00370.pdb # 7: usage_00371.pdb # 8: usage_00412.pdb # 9: usage_00413.pdb # 10: usage_00482.pdb # 11: usage_00507.pdb # 12: usage_00521.pdb # # Length: 42 # Identity: 35/ 42 ( 83.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 42 ( 95.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 42 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00014.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00015.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00054.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIVA 42 usage_00175.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00176.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00370.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00371.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00412.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00413.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00482.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00507.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHCHQSIV- 41 usage_00521.pdb 1 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHHQSIV-- 40 PWGEIFSEYCLFIRPSNVTEEERFVQRVVDFLQIHchqsi #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################