################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:00:10 2021 # Report_file: c_1460_234.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00138.pdb # 2: usage_01018.pdb # 3: usage_01019.pdb # 4: usage_01021.pdb # 5: usage_01413.pdb # 6: usage_01989.pdb # 7: usage_02154.pdb # 8: usage_02190.pdb # # Length: 39 # Identity: 13/ 39 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 39 ( 56.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 39 ( 2.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00138.pdb 1 AGVDWRSRGCVTPVKDQRDCGSCWAFSTTGALEGAHCAK 39 usage_01018.pdb 1 RSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRK 39 usage_01019.pdb 1 RSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRK 39 usage_01021.pdb 1 RSVDWREKGYVTPVKNQGQCGSAWAFSATGALEGQMFRK 39 usage_01413.pdb 1 RSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRK 39 usage_01989.pdb 1 ESIDWREKGAVTPVKNQNPCGSCWAFSTVATIEGINKII 39 usage_02154.pdb 1 RSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRK 39 usage_02190.pdb 1 QSIDWRAKGAVTPVKNQGACGSWAFSTIATVEGINKIV- 38 s DWR kG VTPVKnQ CGS wafs eg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################