################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:04 2021 # Report_file: c_0601_1.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00001.pdb # 2: usage_00007.pdb # 3: usage_00008.pdb # 4: usage_00009.pdb # 5: usage_00013.pdb # 6: usage_00112.pdb # 7: usage_00113.pdb # 8: usage_00114.pdb # # Length: 73 # Identity: 22/ 73 ( 30.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 66/ 73 ( 90.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 73 ( 9.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 --SQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPI 58 usage_00007.pdb 1 -SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPI 59 usage_00008.pdb 1 --SQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPI 58 usage_00009.pdb 1 ------LLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPI 54 usage_00013.pdb 1 --SR-RLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDN-PPYDKGAFRIEINFPA 56 usage_00112.pdb 1 --SQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPI 58 usage_00113.pdb 1 PSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPI 60 usage_00114.pdb 1 -SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPI 59 LllELkglqeepvegFRvtlVDEgdLynWevaIfgpp tyYegGyFkarlkFPi usage_00001.pdb 59 DYPYSPPAFRFLT 71 usage_00007.pdb 60 DYPYSPPAFRFLT 72 usage_00008.pdb 59 DYPYSPPAFRFLT 71 usage_00009.pdb 55 DYPYSPPAFRFLT 67 usage_00013.pdb 57 EYPFKPPKITFKT 69 usage_00112.pdb 59 DYPYSPPAFRFLT 71 usage_00113.pdb 61 DYPYSPPAFRFLT 73 usage_00114.pdb 60 DYPYSPPAFRFLT 72 dYPysPPafrFlT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################