################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:23 2021 # Report_file: c_1433_52.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00091.pdb # 2: usage_00217.pdb # 3: usage_00569.pdb # 4: usage_00887.pdb # 5: usage_00928.pdb # 6: usage_00949.pdb # # Length: 66 # Identity: 9/ 66 ( 13.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 66 ( 15.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 66 ( 22.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00091.pdb 1 PLAVKTVVDEYLRPLLMGRDANEIEDIWQVMNVNSY-W--RNGPITNNAISGIDMALWDI 57 usage_00217.pdb 1 ADITCTIFHRQIAPHALGTDALDFADTLDLIYEREL-K--YPGSYLRRAMTGLDTALWDM 57 usage_00569.pdb 1 --AVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRG-YTGGFYVDALAALDIALWDI 57 usage_00887.pdb 1 --SVGRFVESKLAGVAEGSDALSPPAVWARMQAAIR-N-AGRPGVGAMAVSAVDIALWDL 56 usage_00928.pdb 1 --AVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRG-YTGGFYVDALAALDIALWDI 57 usage_00949.pdb 1 -----------VVPALIGRDAGRIEDTWQYLYRGAY-W--RRGPVTMTAIAAVDMALWDI 46 G DA g A D ALWD usage_00091.pdb 58 KGQLAD 63 usage_00217.pdb 58 RGKLE- 62 usage_00569.pdb 58 AGQEA- 62 usage_00887.pdb 57 KARLLG 62 usage_00928.pdb 58 AGQEAG 63 usage_00949.pdb 47 KAKAAG 52 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################