################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:26:57 2021
# Report_file: c_0967_22.html
################################################################################################
#====================================
# Aligned_structures: 15
#   1: usage_00073.pdb
#   2: usage_00123.pdb
#   3: usage_00132.pdb
#   4: usage_00155.pdb
#   5: usage_00156.pdb
#   6: usage_00157.pdb
#   7: usage_00158.pdb
#   8: usage_00161.pdb
#   9: usage_00189.pdb
#  10: usage_00190.pdb
#  11: usage_00208.pdb
#  12: usage_00241.pdb
#  13: usage_00293.pdb
#  14: usage_00383.pdb
#  15: usage_00384.pdb
#
# Length:         39
# Identity:        5/ 39 ( 12.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     12/ 39 ( 30.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           12/ 39 ( 30.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00073.pdb         1  --EVEQNSGPLSVPEGAIASLNCTYSFLG----SQSFFW   33
usage_00123.pdb         1  --VMTQSPSSLAVSAGEKVTMSCKSSQSLLN--------   29
usage_00132.pdb         1  -IVLTQTPSSLPVSVGEKVTMTCKSSQTLLY--------   30
usage_00155.pdb         1  --VMSQSPSSLAVSVGEKVTMSCKSSQSLLYSRNQMNYL   37
usage_00156.pdb         1  -MVMSQSPSSLAVSAGEKVSMSCKSSQTLLN--------   30
usage_00157.pdb         1  -MVMSQSPSSLAVSAGEKVSMSCKSSQTLLN--------   30
usage_00158.pdb         1  -MVMSQSPSSLAVSAGEKVSMSCKSSQTLLN--------   30
usage_00161.pdb         1  -IVMTQSPSSLSVSAGERVTMSCKSSQSLLY--------   30
usage_00189.pdb         1  DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLN--------   31
usage_00190.pdb         1  DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLN--------   31
usage_00208.pdb         1  DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLYSSNQKNFL   39
usage_00241.pdb         1  -IVMTQAAPSVPVTPGESVSISCRSSKSLLH--------   30
usage_00293.pdb         1  --VMTQSPSSLAVSAGEKVTMNCKSSQSLLNSRTRKNYL   37
usage_00383.pdb         1  DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLN--------   31
usage_00384.pdb         1  DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLN--------   31
                             v  Q   sl V  Ge v   C sS  l          


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################