################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:14:39 2021 # Report_file: c_0243_39.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00011.pdb # 2: usage_00012.pdb # 3: usage_00145.pdb # 4: usage_00222.pdb # 5: usage_00240.pdb # # Length: 137 # Identity: 16/137 ( 11.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/137 ( 28.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/137 ( 12.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00011.pdb 1 -MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKH--FNVVLLDLLLPDV 57 usage_00012.pdb 1 -MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKH--FNVVLLDLLLPDV 57 usage_00145.pdb 1 LAKILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENCNSIDVVITDMKMPKL 60 usage_00222.pdb 1 -RQVLMVEDTASVAALYKSYLNPLGLNVSIVGTGKEALSFIQDII--PDLILLDLRLPDM 57 usage_00240.pdb 1 -PRVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSK--PQLIILDLKLPDM 57 vL eD l yl g v g ea lDl lPd usage_00011.pdb 58 NGLEILKWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIE 117 usage_00012.pdb 58 NGLEILKWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIE 117 usage_00145.pdb 61 SGMDILREIKKITPHMAVIILTGHGDLDNAILAMKEGAFEYLRKPVTAQDLSIAINNAIN 120 usage_00222.pdb 58 TGMEVLERVRKEHGNVPVVIMTAHGSIDIAVEAIRYGAQDFLIKPCEADRLRITVNKALK 117 usage_00240.pdb 58 SGEDVLDWINQNDIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHLK 117 G L i Vi T HG Av a GA dfL KP n a usage_00011.pdb 118 HRKLRKENELLRREKDL 134 usage_00012.pdb 118 HRKLRKENELLRREKDL 134 usage_00145.pdb 121 RKKLLM----------- 126 usage_00222.pdb 118 AES-------------- 120 usage_00240.pdb 118 RAKLEDLVEG------- 127 k #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################