################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:18 2021 # Report_file: c_0944_26.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00111.pdb # 2: usage_00137.pdb # 3: usage_00274.pdb # 4: usage_00291.pdb # 5: usage_00319.pdb # 6: usage_00320.pdb # 7: usage_00530.pdb # 8: usage_00531.pdb # 9: usage_00532.pdb # # Length: 40 # Identity: 7/ 40 ( 17.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 40 ( 27.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 40 ( 15.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00111.pdb 1 ---PPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWML 37 usage_00137.pdb 1 ---PPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYK 37 usage_00274.pdb 1 GEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTW-- 38 usage_00291.pdb 1 ---GPVFVQEPSHVMFPLD-KVKLSCEVKGNPKPHIRWKL 36 usage_00319.pdb 1 ---PPVFIKKPVDQIGVSGGVASFVCQATGDPKPRVTW-- 35 usage_00320.pdb 1 ---PPVFIKKPVDQIGVSGGVASFVCQATGDPKPRVTW-- 35 usage_00530.pdb 1 ---PPVFIKKPVDQIGVSGGVASFVCQATGDPKPRVTW-- 35 usage_00531.pdb 1 ---PPVFIKKPVDQIGVSGGVASFVCQATGDPKPRVTW-- 35 usage_00532.pdb 1 ---PPVFIKKPVDQIGVSGGVASFVCQATGDPKPRVTW-- 35 pP f P g C a G P P W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################