################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:05:34 2021 # Report_file: c_1438_7.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00042.pdb # 2: usage_00043.pdb # 3: usage_00044.pdb # 4: usage_00046.pdb # 5: usage_00057.pdb # 6: usage_00058.pdb # 7: usage_00077.pdb # 8: usage_00078.pdb # 9: usage_00087.pdb # # Length: 76 # Identity: 19/ 76 ( 25.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 76 ( 59.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 76 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD 46 usage_00043.pdb 1 SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD 46 usage_00044.pdb 1 SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD 46 usage_00046.pdb 1 SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD 46 usage_00057.pdb 1 SKEQEELIRTLLGAHTRHMG-TMFEQFVQFRPPAHLFIHHQPLPTLA--PVLPLVTHFAD 57 usage_00058.pdb 1 SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD 46 usage_00077.pdb 1 SDEQMQIINSLVEAHHKTYDDS-YSDFVRFRPP----------V-R---R-LSMLPHLAD 44 usage_00078.pdb 1 -DEQMQIINSLVEAHHKTYDDS-YSDFVRFRPP----------V-R---R-LSMLPHLAD 43 usage_00087.pdb 1 SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-M-P-LSMLPHLAD 45 EQ iI L AHhktyd y dF FRPP v r LsmlpHlAD usage_00042.pdb 47 LVSYSIQKVIGFAKMI 62 usage_00043.pdb 47 LVSYSIQKVIGFAKMI 62 usage_00044.pdb 47 LVSYSIQKVIGFAKMI 62 usage_00046.pdb 47 LVSYSIQKVIGFAKMI 62 usage_00057.pdb 58 INTFMVLQVIKFTKD- 72 usage_00058.pdb 47 LVSYSIQKVIGFAKMI 62 usage_00077.pdb 45 LVSYSIQKVIGFAKMI 60 usage_00078.pdb 44 LVSYSIQKVIGFAKMI 59 usage_00087.pdb 46 LVSYSIQKVIGFAKMI 61 lvsysiqkVIgFaKm #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################