################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:06:17 2021 # Report_file: c_1345_44.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00088.pdb # 2: usage_00089.pdb # 3: usage_00090.pdb # 4: usage_00290.pdb # 5: usage_00291.pdb # 6: usage_00292.pdb # 7: usage_00293.pdb # 8: usage_00294.pdb # 9: usage_00305.pdb # 10: usage_00306.pdb # 11: usage_00448.pdb # 12: usage_00470.pdb # 13: usage_00471.pdb # 14: usage_00472.pdb # 15: usage_00473.pdb # 16: usage_00474.pdb # 17: usage_00475.pdb # 18: usage_00476.pdb # # Length: 38 # Identity: 7/ 38 ( 18.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 38 ( 84.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 38 ( 15.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00088.pdb 1 --DHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARRY 33 usage_00089.pdb 1 -PDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARRY 34 usage_00090.pdb 1 LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARRY 35 usage_00290.pdb 1 LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARRY 35 usage_00291.pdb 1 LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARR- 34 usage_00292.pdb 1 LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARR- 34 usage_00293.pdb 1 LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARR- 34 usage_00294.pdb 1 LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARR- 34 usage_00305.pdb 1 LPDHYVSQGKWFVLFSHPADFTPVS-T-TEFVSFARR- 35 usage_00306.pdb 1 LPDHYVSQGKWFVLFSHPADFTPVS-T-TEFVSFARR- 35 usage_00448.pdb 1 EWSKLISENKKVIITGAPAAFSPT-CTVSHIPGYINYL 37 usage_00470.pdb 1 -PDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY 35 usage_00471.pdb 1 LPDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY 36 usage_00472.pdb 1 -PDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY 35 usage_00473.pdb 1 LPDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARR- 35 usage_00474.pdb 1 --DHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY 34 usage_00475.pdb 1 -PDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARR- 34 usage_00476.pdb 1 -PDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY 35 dhyvSqgKwfvlfshPAdFtPv T tefvsfarr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################