################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:27 2021 # Report_file: c_1010_16.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00025.pdb # 2: usage_00092.pdb # 3: usage_00093.pdb # 4: usage_00094.pdb # 5: usage_00101.pdb # 6: usage_00136.pdb # 7: usage_00137.pdb # 8: usage_00138.pdb # 9: usage_00139.pdb # # Length: 65 # Identity: 38/ 65 ( 58.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 65 ( 72.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 65 ( 4.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 ---ITFDVGNATINKYATFMKSIHNQAKDPTLKCYGIPMLPNTNLTPKYLLVTLQDSSLK 57 usage_00092.pdb 1 ---ITFDAGNATINKYATFMESLRNEAKDPSLKCYGIPMLPNTNSTIKYLLVKLQGASLK 57 usage_00093.pdb 1 -NTIIYNVGSTTISKYATFLNDLRNEAKDPSLKCYGIPMLPNTNTNPKYVLVELQGSNKK 59 usage_00094.pdb 1 -NTIIYNVGSTTISKYATFLNDLRNEAKDPSLKCYGIPMLPNTNTNPKYVLVELQGSNKK 59 usage_00101.pdb 1 -NTIIYNVGSTTISKYATFLNDLRNEAKDPSLKCYGIPMLPNTNTNPKYVLVELQGSNKK 59 usage_00136.pdb 1 VNTIIYNVGSTTISKYATFLNDLRNEAKDPSLKCYGIPMLPNTNTNPKYVLVELQGSNKK 60 usage_00137.pdb 1 -NTIIYNVGSTTISKYATFLNDLRNEAKDPSLKCYGIPMLPNTNTNPKYVLVELQGSNKK 59 usage_00138.pdb 1 VNTIIYNVGSTTISKYATFLNDLRNEAKDPSLKCYGIPMLPNTNTNPKYVLVELQGSNKK 60 usage_00139.pdb 1 VNTIIYNVGSTTISKYATFLNDLRNEAKDPSLKCYGIPMLPNTNTNPKYVLVELQGSNKK 60 I vG TI KYATF lrNeAKDPsLKCYGIPMLPNTN pKY LV LQgs K usage_00025.pdb 58 TITLM 62 usage_00092.pdb 58 TITLI 62 usage_00093.pdb 60 TITLM 64 usage_00094.pdb 60 TITLM 64 usage_00101.pdb 60 TITLM 64 usage_00136.pdb 61 TITLM 65 usage_00137.pdb 60 TITLM 64 usage_00138.pdb 61 TITLM 65 usage_00139.pdb 61 TITLM 65 TITLm #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################