################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:11 2021 # Report_file: c_1401_58.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00110.pdb # 2: usage_00221.pdb # 3: usage_00297.pdb # 4: usage_00486.pdb # 5: usage_00549.pdb # 6: usage_00671.pdb # # Length: 62 # Identity: 20/ 62 ( 32.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 62 ( 33.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 62 ( 16.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00110.pdb 1 SAELQSDTEEILSKAIRLIQACVDVLSSNGWL-SPALAA-ELA--QVTQA-WSKDSYLKQ 55 usage_00221.pdb 1 -VDFQNDLKDILEKVVPLINVVVDILSANGYL-NATTADLA----QLIQGVWDVDNPLRQ 54 usage_00297.pdb 1 PVDFQNDLKDILEKVVPLINVVVDILSANGYL-NATTAM-DL-AQMLIQGVWDVDNPLRQ 57 usage_00486.pdb 1 --DFQNDLKDILEKVVPLINVVVDILSANGYL-NATTAM-DL-AQMLIQGVWDVDNPLRQ 55 usage_00549.pdb 1 PVDFQNDLKDILEKVVPLINVVVDILSANGYL-NATTAM-DL-AQMLIQGVWDVDNPLRQ 57 usage_00671.pdb 1 SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAM-EL-AQMVTQAMWSKDSYLKQ 58 Q D IL K LI VD LS NG L a A Q W D L Q usage_00110.pdb 56 L- 56 usage_00221.pdb 55 I- 55 usage_00297.pdb 58 I- 58 usage_00486.pdb 56 I- 56 usage_00549.pdb 58 IP 59 usage_00671.pdb 59 L- 59 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################