################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:39 2021 # Report_file: c_0758_28.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00318.pdb # 2: usage_00447.pdb # 3: usage_00448.pdb # 4: usage_00449.pdb # 5: usage_00522.pdb # 6: usage_00756.pdb # # Length: 62 # Identity: 5/ 62 ( 8.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 62 ( 40.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 62 ( 8.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00318.pdb 1 NVVYTPRLDQAGVNGIMRQFCIRLLAQ-SSYQLVEVQASLEESLQADEMVICNALMPVMP 59 usage_00447.pdb 1 --TITTPPTLNNLKGITRQVVIELINE-LEIPFREANIGLFDLYSADEIFVTGTAAEIAP 57 usage_00448.pdb 1 --TITTPPTLNNLKGITRQVVIELINE-LEIPFREANIGLFDLYSADEIFVTGTAAEIAP 57 usage_00449.pdb 1 --TITTPPTLNNLKGITRQVVIELINE-LEIPFREANIGLFDLYSADEIFVTGTAAEIAP 57 usage_00522.pdb 1 --TITTPPTLNNLKGITRQVVIELINE-LEIPFREANIGLFDLYSADEIFVTGTAAEIAP 57 usage_00756.pdb 1 --KFVTPQSPSILPSITKYSLLWLAEHRLGLEVEEGDIRIDELGKFSEAGACGTAAVITP 58 ttp l gItrq i L l E i l l adE gtaa i P usage_00318.pdb -- usage_00447.pdb 58 VT 59 usage_00448.pdb 58 VT 59 usage_00449.pdb 58 VT 59 usage_00522.pdb 58 VT 59 usage_00756.pdb 59 IG 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################