################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 22:59:22 2021
# Report_file: c_1439_74.html
################################################################################################
#====================================
# Aligned_structures: 3
#   1: usage_00520.pdb
#   2: usage_00738.pdb
#   3: usage_00835.pdb
#
# Length:         90
# Identity:        2/ 90 (  2.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     48/ 90 ( 53.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           42/ 90 ( 46.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00520.pdb         1  D----RLTQEPESIR-----KW-REEQRKRL-----QELDAASKVMEQEWREKAKKDLEE   45
usage_00738.pdb         1  -DSEKLKEEIGKELEELRARLLPHA------NEVSQKIGDNLRELQQRLEPYADQLRTQV   53
usage_00835.pdb         1  D----RLTQEPESIR-----KW-REEQRKRL-----QELDAASKVMEQEWREKAKKDLEE   45
                                rltqepesir     kw re           qelDaaskvmeqewrekakkdlee

usage_00520.pdb        46  WNQRQSEQVEKNKINNRIADKAFYQQPDAD   75
usage_00738.pdb        54  NTQAEQLRRQ--------------------   63
usage_00835.pdb        46  WNQRQSEQVEKNKINNRIADKAFYQQPDAD   75
                           wnQrqseqve                    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################