################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:49 2021 # Report_file: c_0841_32.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00025.pdb # 2: usage_00026.pdb # 3: usage_00146.pdb # 4: usage_00147.pdb # 5: usage_00154.pdb # 6: usage_00155.pdb # 7: usage_00270.pdb # 8: usage_00271.pdb # 9: usage_00272.pdb # # Length: 72 # Identity: 31/ 72 ( 43.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 72 ( 43.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 72 ( 4.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 SAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAIEKAGWTVDELDLIESNEAF 60 usage_00026.pdb 1 SAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAIEKAGWTVDELDLIESNEAF 60 usage_00146.pdb 1 SAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAIEKAGWTVDELDLIESNEAF 60 usage_00147.pdb 1 SAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAIEKAGWTVDELDLIESNEAF 60 usage_00154.pdb 1 SAQRAKDLGLEPLAVIRSMAVAGVDPAIMGYGPVPATQKALKRAGLNMADIDFIELNEAF 60 usage_00155.pdb 1 SAQRAKDLGLEPLAVIRSMAVAGVDPAIMGYGPVPATQKALKRAGLNMADIDFIELNEAF 60 usage_00270.pdb 1 SAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAIEKAGWTVDELDLIESNEAF 60 usage_00271.pdb 1 SESRARELGLKPRARIRSAVVGCD-PSI-GYGPVPASKLALKKAGLSASDIDVFE-NEAF 57 usage_00272.pdb 1 SESRARELGLKPRARIRSAVVGCD-PSI-GYGPVPASKLALKKAGLSASDIDVFE-NEAF 57 S A LG P A I S P I GYGP A A AG D E NEAF usage_00025.pdb 61 AAQSLAVAKDLK 72 usage_00026.pdb 61 AAQSLAVAKDLK 72 usage_00146.pdb 61 AAQSLAVAKDLK 72 usage_00147.pdb 61 AAQSLAVAKDLK 72 usage_00154.pdb 61 AAQALPVLKDLK 72 usage_00155.pdb 61 AAQALPVLKDLK 72 usage_00270.pdb 61 AAQSLAVAKDLK 72 usage_00271.pdb 58 AAQILPCIKDLG 69 usage_00272.pdb 58 AAQILPCIKDLG 69 AAQ L KDL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################