################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:48 2021 # Report_file: c_1221_32.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_01137.pdb # 2: usage_01341.pdb # 3: usage_01342.pdb # 4: usage_01698.pdb # 5: usage_02482.pdb # 6: usage_02484.pdb # 7: usage_02517.pdb # # Length: 43 # Identity: 15/ 43 ( 34.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 43 ( 76.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 43 ( 4.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01137.pdb 1 FIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWR-- 41 usage_01341.pdb 1 FIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRF- 42 usage_01342.pdb 1 FIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRF- 42 usage_01698.pdb 1 FIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRF- 42 usage_02482.pdb 1 FIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWR-- 41 usage_02484.pdb 1 FCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRF- 42 usage_02517.pdb 1 FCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFL 43 F idee fGqt QheLK GseI Vtn NKkEYi LviqWR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################