################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:24:15 2021 # Report_file: c_1099_7.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00190.pdb # 2: usage_00191.pdb # 3: usage_00481.pdb # 4: usage_00510.pdb # 5: usage_00669.pdb # 6: usage_00810.pdb # # Length: 71 # Identity: 17/ 71 ( 23.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 71 ( 53.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 71 ( 7.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00190.pdb 1 --RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSK 58 usage_00191.pdb 1 -SRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSK 59 usage_00481.pdb 1 --KKAILELFQTYKEP-LGNYIGAEGLQRLFEDIQVDPSDVVTLVLAWKLKASST-EFSE 56 usage_00510.pdb 1 --RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSK 58 usage_00669.pdb 1 ---QRLEELFRRYKDE-REDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFTR 56 usage_00810.pdb 1 GSKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSR 60 k le L rYKdp en Ig G q fc Dl DP vL AWKf Aat eFs usage_00190.pdb 59 QEFMDGMTELG 69 usage_00191.pdb 60 QEFMDGMTELG 70 usage_00481.pdb 57 KEFVEGLANLQ 67 usage_00510.pdb 59 QEFMDGMTELG 69 usage_00669.pdb 57 KEFFDGCKAIS 67 usage_00810.pdb 61 KEFLDGMTELG 71 EF dG l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################