################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:19 2021 # Report_file: c_1442_8.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_01627.pdb # 2: usage_01628.pdb # 3: usage_01629.pdb # 4: usage_06302.pdb # 5: usage_06303.pdb # 6: usage_10186.pdb # 7: usage_10187.pdb # 8: usage_10188.pdb # 9: usage_11800.pdb # 10: usage_13686.pdb # 11: usage_13687.pdb # # Length: 42 # Identity: 35/ 42 ( 83.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 42 ( 83.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 42 ( 9.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01627.pdb 1 NNDRITIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 42 usage_01628.pdb 1 NNDRITIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 42 usage_01629.pdb 1 NNDRITIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 42 usage_06302.pdb 1 -NDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 41 usage_06303.pdb 1 NNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP 42 usage_10186.pdb 1 -NDRICIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 41 usage_10187.pdb 1 -NDRICIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 41 usage_10188.pdb 1 -NDRICIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 41 usage_11800.pdb 1 -NDRITIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 41 usage_13686.pdb 1 ----ITIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 38 usage_13687.pdb 1 ----ITIEWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNL 38 I EWTNTPDGAAKQFRREWFQGDGMVRRKNLPIEYN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################