################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:15:37 2021
# Report_file: c_1445_1395.html
################################################################################################
#====================================
# Aligned_structures: 15
#   1: usage_03704.pdb
#   2: usage_03705.pdb
#   3: usage_04094.pdb
#   4: usage_04591.pdb
#   5: usage_09651.pdb
#   6: usage_09652.pdb
#   7: usage_10267.pdb
#   8: usage_10553.pdb
#   9: usage_11993.pdb
#  10: usage_13685.pdb
#  11: usage_15422.pdb
#  12: usage_15423.pdb
#  13: usage_15762.pdb
#  14: usage_16685.pdb
#  15: usage_16686.pdb
#
# Length:         31
# Identity:        6/ 31 ( 19.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     14/ 31 ( 45.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           17/ 31 ( 54.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_03704.pdb         1  -RTDSPKAHVTHHPRSKGEVTLRCWA-----   25
usage_03705.pdb         1  -RTDSPKAHVTHHPRSKGEVTLRCWA-----   25
usage_04094.pdb         1  -RTDSPKAHVTHHSRPEDKVTLRCWALGFYP   30
usage_04591.pdb         1  LRTDSPKAHVTHHSRPEDKVTLRCWALGFYP   31
usage_09651.pdb         1  -RTDSPKAHVTHH-------TLRCWALGFYP   23
usage_09652.pdb         1  LRTDSPKAHVTHHPR-----TLRCWALGFYP   26
usage_10267.pdb         1  ----SPKAHVTHHSRPEDKVTLRCWAL----   23
usage_10553.pdb         1  DRQDPPSVVVTSHQAPGEKKKLKCL------   25
usage_11993.pdb         1  -RTDSPKAHVTHHSRPEDKVTLRCWALG---   27
usage_13685.pdb         1  -RTDSPKAHVTHHPRSKGEVTLRCWALG---   27
usage_15422.pdb         1  -RTDSPKAHVTHHSRPEDKVTLRCWALG---   27
usage_15423.pdb         1  -RTDSPKAHVTHHSRPEDKVTLRCWALG---   27
usage_15762.pdb         1  -RTDSPKAHVTHHPRSKGEVTLRCWA-----   25
usage_16685.pdb         1  -RTDSPKAHVTHHPRSKGEVTLRCWALG---   27
usage_16686.pdb         1  -RTDSPKAHVTHHPRSKGEVTLRCWALG---   27
                               sPkahVThH       tLrCw      


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################