################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:08 2021 # Report_file: c_1242_75.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00904.pdb # 2: usage_00905.pdb # 3: usage_00906.pdb # 4: usage_00907.pdb # 5: usage_01269.pdb # 6: usage_01566.pdb # 7: usage_01567.pdb # 8: usage_01994.pdb # 9: usage_01995.pdb # 10: usage_01996.pdb # 11: usage_01998.pdb # 12: usage_01999.pdb # 13: usage_02000.pdb # 14: usage_02083.pdb # # Length: 47 # Identity: 6/ 47 ( 12.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 47 ( 66.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 47 ( 4.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00904.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_00905.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_00906.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_00907.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_01269.pdb 1 --VAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFK 45 usage_01566.pdb 1 -KVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 46 usage_01567.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_01994.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_01995.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_01996.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_01998.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_01999.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_02000.pdb 1 KKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYR 47 usage_02083.pdb 1 -ATGFYSHADCLQHEMGQWHPECPARLQAIEDQLIASRIGELIERES 46 v yyyd D gn yGqgHPmkPhR th lll ygly kme #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################