################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:06 2021 # Report_file: c_1070_26.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00496.pdb # 2: usage_00506.pdb # 3: usage_00507.pdb # 4: usage_00515.pdb # 5: usage_00516.pdb # 6: usage_00993.pdb # 7: usage_01025.pdb # # Length: 92 # Identity: 8/ 92 ( 8.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 92 ( 28.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/ 92 ( 34.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00496.pdb 1 -PCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHA-EPRPYSQEELQVVQLLADQVSIA 58 usage_00506.pdb 1 DPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHA-EPRPYSQEELQVVQLLADQVSIA 59 usage_00507.pdb 1 -PCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHA-EPRPYSQEELQVVQLLADQVSIA 58 usage_00515.pdb 1 -PCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHA-EPRPYSQEELQVVQLLADQVSIA 58 usage_00516.pdb 1 DPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHA-EPRPYSQEELQVVQLLADQVSIA 59 usage_00993.pdb 1 SPIHCEYLTNMGVRASMSISIVVGGKLWGLFSCHHM-SPKLIPYPVRMSFQIFSQVCSAI 59 usage_01025.pdb 1 -------LRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLV 53 L mgV slvvp LwGLl Hha ePr e q la S usage_00496.pdb 59 IAQAELSL------------------------ 66 usage_00506.pdb 60 IAQAELSL------------------------ 67 usage_00507.pdb 59 IAQAELSL------------------------ 66 usage_00515.pdb 59 IAQAELSL------------------------ 66 usage_00516.pdb 60 IAQAELSL------------------------ 67 usage_00993.pdb 60 VERLEQGRIAELLRVSTERRLALARRARDA-- 89 usage_01025.pdb 54 LERLHFLEQTIASLHH--------------HH 71 e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################