################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:59 2021 # Report_file: c_1415_96.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00086.pdb # 2: usage_00087.pdb # 3: usage_00655.pdb # 4: usage_01095.pdb # 5: usage_01096.pdb # 6: usage_01097.pdb # 7: usage_01098.pdb # 8: usage_01099.pdb # 9: usage_01100.pdb # 10: usage_01288.pdb # 11: usage_01289.pdb # 12: usage_01461.pdb # # Length: 40 # Identity: 25/ 40 ( 62.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 40 ( 62.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 40 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00086.pdb 1 RLPFIP-TAKRVTGIV-SRGGSIAKWCLAHHKENFLYERF 38 usage_00087.pdb 1 RLPFIP-TAKRVTGIV-SRGGSIAKWCLAHHKENFLYERF 38 usage_00655.pdb 1 LLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEH- 39 usage_01095.pdb 1 LLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEH- 39 usage_01096.pdb 1 LLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEH- 39 usage_01097.pdb 1 LLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEH- 39 usage_01098.pdb 1 LLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEH- 39 usage_01099.pdb 1 LLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEH- 39 usage_01100.pdb 1 LLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEH- 39 usage_01288.pdb 1 RLPFIPMTAKRVTGIVSRGGSIMAKWCLAHHKENFLYERF 40 usage_01289.pdb 1 RLPFIPMTAKRVTGIVSRGGSIMAKWCLAHHKENFLYER- 39 usage_01461.pdb 1 RLPFIPMTAKRVTGIVSRGGSIMAKWCLAHHKENFLYER- 39 L IP TAKR TGIV G AKWCLA HKENF YE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################