################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:51:33 2021 # Report_file: c_0805_66.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00059.pdb # 2: usage_00060.pdb # 3: usage_00061.pdb # 4: usage_00062.pdb # 5: usage_00074.pdb # 6: usage_00075.pdb # 7: usage_00357.pdb # 8: usage_00419.pdb # 9: usage_00438.pdb # 10: usage_00439.pdb # 11: usage_00796.pdb # 12: usage_00797.pdb # # Length: 45 # Identity: 26/ 45 ( 57.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 45 ( 57.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 45 ( 8.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00059.pdb 1 ---QVSEQIMGLLGDKVKLSSPVTYIDQTDDNIIVETLNHEHYEC 42 usage_00060.pdb 1 ---QVSEQIMGLLGDKVKLSSPVTYIDQTDDNIIVETLNHEHYEC 42 usage_00061.pdb 1 ---QVSEQIMGLLGDKVKLSSPVTYIDQTDDNIIVETLNHEHYEC 42 usage_00062.pdb 1 ---QVSEQIMGLLGDKVKLSSPVTYIDQTDDNIIVETLNHEHYEC 42 usage_00074.pdb 1 GSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYEC 45 usage_00075.pdb 1 GSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYEC 45 usage_00357.pdb 1 ---QVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEA 42 usage_00419.pdb 1 GSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHEMYEA 45 usage_00438.pdb 1 ---QVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYEC 42 usage_00439.pdb 1 --GQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYEC 43 usage_00796.pdb 1 ---QVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYE- 41 usage_00797.pdb 1 ---QVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYE- 41 QVSE IM LLGD VKL PV DQ N ETLNHE YE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################