################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:40 2021 # Report_file: c_0905_77.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00345.pdb # 2: usage_00545.pdb # 3: usage_00546.pdb # 4: usage_00551.pdb # 5: usage_00552.pdb # 6: usage_00598.pdb # 7: usage_00727.pdb # 8: usage_00789.pdb # 9: usage_00790.pdb # 10: usage_00791.pdb # 11: usage_00833.pdb # # Length: 34 # Identity: 28/ 34 ( 82.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 34 ( 82.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 34 ( 17.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00345.pdb 1 -----GSGAFGTVYKGLWIPEGEKVKIPVAIKEL 29 usage_00545.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL 30 usage_00546.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL 30 usage_00551.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL 30 usage_00552.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL 30 usage_00598.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL 30 usage_00727.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL 30 usage_00789.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKE- 29 usage_00790.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKE- 29 usage_00791.pdb 1 ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL 30 usage_00833.pdb 1 KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKEL 34 GSGAFGTVYKGLWIPEGEKVKIPVAIKE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################