################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:58:56 2021 # Report_file: c_1043_4.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00146.pdb # 2: usage_00155.pdb # 3: usage_00263.pdb # 4: usage_00297.pdb # 5: usage_00298.pdb # 6: usage_00299.pdb # 7: usage_00300.pdb # 8: usage_00301.pdb # 9: usage_00302.pdb # 10: usage_00303.pdb # 11: usage_00341.pdb # 12: usage_00397.pdb # 13: usage_00436.pdb # # Length: 47 # Identity: 2/ 47 ( 4.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 47 ( 21.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 47 ( 42.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00146.pdb 1 -KDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 44 usage_00155.pdb 1 EKDVFVLYYVPWSRHSVAAMRLWDDLSMSQSQKRNHLTFVAARID-- 45 usage_00263.pdb 1 ----LVEFYAPWCGHCQRLTPEWKKAATALK-----D-VVKVGAVD- 36 usage_00297.pdb 1 --DVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 43 usage_00298.pdb 1 --DVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 43 usage_00299.pdb 1 --DVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 43 usage_00300.pdb 1 --DVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 43 usage_00301.pdb 1 --DVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 43 usage_00302.pdb 1 --DVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 43 usage_00303.pdb 1 --DVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 43 usage_00341.pdb 1 -KDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 44 usage_00397.pdb 1 --DVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVD-- 43 usage_00436.pdb 1 ----GTMYGAYWCPHCQDQKELFG---------AAFDQVPYV-EC-S 32 yapWc Hc d vv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################