################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:11:48 2021 # Report_file: c_0393_9.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00023.pdb # 2: usage_00120.pdb # 3: usage_00121.pdb # 4: usage_00122.pdb # 5: usage_00136.pdb # # Length: 97 # Identity: 13/ 97 ( 13.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 97 ( 39.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 97 ( 19.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 -----QLRALNLTEGFAVLHWKP-PQNPVDTYDIQVTAP--GAPPLQAETPGSAVDYPLH 52 usage_00120.pdb 1 LPAPKNLVVSEVTEDSARLSWDD-PAAFYESFLIQYQESEKVGEAIVLTVPGSERSYDLT 59 usage_00121.pdb 1 ----KNLVVSEVTEDSARLSWDD-PAAFYESFLIQYQESEKVGEAIVLTVPGSERSYDLT 55 usage_00122.pdb 1 LPAPKNLVVSEVTEDSARLSWDD-PAAFYESFLIQYQESEK--EAIVLTVPGSERSYDLT 57 usage_00136.pdb 1 ------LEVVAATPTSLLISWDAPAV-TVDLYFITYGETGGNSPVQKFTVPGSKSTATIS 53 L v Te sa lsWd p Iqy e tvPGS y l usage_00023.pdb 53 DLVLHTNYTATVRGLRGP-----NLTSPASITFTTG- 83 usage_00120.pdb 60 GLKPGTEYTVSIYGVHNVYKDTNMRGLPLSAIFTTGG 96 usage_00121.pdb 56 GLKPGTEYTVSIYGVHNVYKDTNMRGLPLSAIFTTGG 92 usage_00122.pdb 58 GLKPGTEYTVSIYGVHNVYKDTNMRGLPLSAIFTTGG 94 usage_00136.pdb 54 GLKPGVDYTITVYAQYYYR--GWYVGSPISINYRT-- 86 gLkpgt YT yg g P S ftT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################