################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:02 2021 # Report_file: c_1387_49.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00286.pdb # 2: usage_01038.pdb # 3: usage_01039.pdb # 4: usage_01040.pdb # 5: usage_01041.pdb # 6: usage_02541.pdb # # Length: 75 # Identity: 44/ 75 ( 58.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 52/ 75 ( 69.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 75 ( 5.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00286.pdb 1 PLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFD-VQTSDNMD 59 usage_01038.pdb 1 PLAVKYFFDFLDEQAERKKITDPDVLHIWKTNSLPLRFWVNILKNPDFVFSDMEKSPHLD 60 usage_01039.pdb 1 PLAVKYFFDFLDEQAERKKITDPDVLHIWKTNSLPLRFWVNILKNPDFVFSDMEKSPHLD 60 usage_01040.pdb 1 PLAVKYFFDFLDEQAERKKITDPDVLHIWKTNSLPLRFWVNILKNPDFVFSDMEKSPHLD 60 usage_01041.pdb 1 PLAVKYFFDFLDEQAERKKITDPDVLHIWKTNSLPLRFWVNILKNPDFVFSDMEKSPHLD 60 usage_02541.pdb 1 -PAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFD-VHVHEVVD 58 lAVKYFFDfLDEQAe I D D HIWKTNSLPLRFWvNIlKNP FvF s D usage_00286.pdb 60 AVLLVIAQTFMDAC- 73 usage_01038.pdb 61 GCLSVIAQAFMDS-- 73 usage_01039.pdb 61 GCLSVIAQAFMDS-- 73 usage_01040.pdb 61 GCLSVIAQAFMDSFS 75 usage_01041.pdb 61 GCLSVIAQAFMDSFS 75 usage_02541.pdb 59 ASLSVIAQTFMDACT 73 LsVIAQ FMD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################