################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:19 2021 # Report_file: c_0906_43.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00068.pdb # 2: usage_00197.pdb # 3: usage_00198.pdb # 4: usage_00431.pdb # 5: usage_00432.pdb # 6: usage_00433.pdb # 7: usage_00434.pdb # 8: usage_00607.pdb # 9: usage_00770.pdb # 10: usage_01068.pdb # # Length: 56 # Identity: 51/ 56 ( 91.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 52/ 56 ( 92.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 56 ( 5.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00068.pdb 1 --TLDFKKFTYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSR 54 usage_00197.pdb 1 YRTLDFKKFIYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSR 56 usage_00198.pdb 1 YRTLDFKKFIYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYS- 55 usage_00431.pdb 1 YRTLDFKKFIYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYS- 55 usage_00432.pdb 1 YRTLDFKKFIYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSR 56 usage_00433.pdb 1 YRTLDFKKFIYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSR 56 usage_00434.pdb 1 YRTLDFKKFIYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYS- 55 usage_00607.pdb 1 YRTLDFKKFTYQGQYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSR 56 usage_00770.pdb 1 YRTLDFKKFIYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSR 56 usage_01068.pdb 1 YRTLDFKKFTYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSR 56 TLDFKKF YQGdYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################