################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:05:34 2021
# Report_file: c_1438_7.html
################################################################################################
#====================================
# Aligned_structures: 9
#   1: usage_00042.pdb
#   2: usage_00043.pdb
#   3: usage_00044.pdb
#   4: usage_00046.pdb
#   5: usage_00057.pdb
#   6: usage_00058.pdb
#   7: usage_00077.pdb
#   8: usage_00078.pdb
#   9: usage_00087.pdb
#
# Length:         76
# Identity:       19/ 76 ( 25.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     45/ 76 ( 59.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           19/ 76 ( 25.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00042.pdb         1  SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD   46
usage_00043.pdb         1  SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD   46
usage_00044.pdb         1  SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD   46
usage_00046.pdb         1  SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD   46
usage_00057.pdb         1  SKEQEELIRTLLGAHTRHMG-TMFEQFVQFRPPAHLFIHHQPLPTLA--PVLPLVTHFAD   57
usage_00058.pdb         1  SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-MSP-LSMLPHLAD   46
usage_00077.pdb         1  SDEQMQIINSLVEAHHKTYDDS-YSDFVRFRPP----------V-R---R-LSMLPHLAD   44
usage_00078.pdb         1  -DEQMQIINSLVEAHHKTYDDS-YSDFVRFRPP----------V-R---R-LSMLPHLAD   43
usage_00087.pdb         1  SEEQQHIIAILLDAHHKTYDPT-YADFRDFRPP----------V-R-M-P-LSMLPHLAD   45
                             EQ  iI  L  AHhktyd   y dF  FRPP          v r     LsmlpHlAD

usage_00042.pdb        47  LVSYSIQKVIGFAKMI   62
usage_00043.pdb        47  LVSYSIQKVIGFAKMI   62
usage_00044.pdb        47  LVSYSIQKVIGFAKMI   62
usage_00046.pdb        47  LVSYSIQKVIGFAKMI   62
usage_00057.pdb        58  INTFMVLQVIKFTKD-   72
usage_00058.pdb        47  LVSYSIQKVIGFAKMI   62
usage_00077.pdb        45  LVSYSIQKVIGFAKMI   60
usage_00078.pdb        44  LVSYSIQKVIGFAKMI   59
usage_00087.pdb        46  LVSYSIQKVIGFAKMI   61
                           lvsysiqkVIgFaKm 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################