################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:44 2021 # Report_file: c_0934_17.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00182.pdb # 2: usage_00236.pdb # 3: usage_00237.pdb # 4: usage_00318.pdb # 5: usage_00319.pdb # 6: usage_00320.pdb # 7: usage_00500.pdb # 8: usage_00622.pdb # 9: usage_00634.pdb # 10: usage_00635.pdb # 11: usage_00682.pdb # # Length: 49 # Identity: 39/ 49 ( 79.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 49 ( 81.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 49 ( 12.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00182.pdb 1 --ATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFT---- 43 usage_00236.pdb 1 --ATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFT---- 43 usage_00237.pdb 1 HSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFT---- 45 usage_00318.pdb 1 --ATTWSGQYVGGADAKINTQWLLTSGTTNANAWKSTLVGHDTFTKVKP 47 usage_00319.pdb 1 --ATTWSGQYVGGADAKINTQWLLTSGTTNANAWKSTLVGHDTFT---- 43 usage_00320.pdb 1 --ATTWSGQYVGGADAKINTQWLLTSGTTNANAWKSTLVGHDTFT---- 43 usage_00500.pdb 1 --ATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV-- 45 usage_00622.pdb 1 --ATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFT---- 43 usage_00634.pdb 1 HSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTK--- 46 usage_00635.pdb 1 --ATTWSGQYVGGAEARINTQFLLTSGTTEANAWKSTLVGHDTFTK--- 44 usage_00682.pdb 1 HSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK- 48 ATTWSGQYVGGA A INTQwLLTSGTT ANAWKSTLVGHDTFT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################