################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:09:47 2021
# Report_file: c_1370_130.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00027.pdb
#   2: usage_00139.pdb
#   3: usage_00140.pdb
#   4: usage_00669.pdb
#   5: usage_00697.pdb
#   6: usage_00868.pdb
#   7: usage_01073.pdb
#   8: usage_01426.pdb
#   9: usage_01665.pdb
#  10: usage_01711.pdb
#
# Length:         47
# Identity:        3/ 47 (  6.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      9/ 47 ( 19.1%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           19/ 47 ( 40.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00027.pdb         1  TA----KQIQAAYLLVENEL-----KRTQDEMANELGINRTTLWEWR   38
usage_00139.pdb         1  -------KSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV   40
usage_00140.pdb         1  ------DKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYW--   39
usage_00669.pdb         1  --------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHV   39
usage_00697.pdb         1  --------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLY---   36
usage_00868.pdb         1  -----------INSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV   36
usage_01073.pdb         1  ------NRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLY---   38
usage_01426.pdb         1  --------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYW--   37
usage_01665.pdb         1  -EAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRY-   45
usage_01711.pdb         1  ------NRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLY---   38
                                           e          t r  A  lg    TLy   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################