################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:02 2021 # Report_file: c_0726_26.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00022.pdb # 2: usage_00023.pdb # 3: usage_00024.pdb # 4: usage_00025.pdb # 5: usage_00249.pdb # 6: usage_00250.pdb # 7: usage_00251.pdb # # Length: 65 # Identity: 34/ 65 ( 52.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 65 ( 52.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 65 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 -YFSLPNEKGEKLSRSAERFRNRYLLLNFWASWCDPQ--PEANAELKRLNKEYKKNKNFA 57 usage_00023.pdb 1 -YFSLPNEKGEKLSRSAERFRNRYLLLNFWASWCDPQ--PEANAELKRLNKEYKKNKNFA 57 usage_00024.pdb 1 PYFSLPNEKGEKLSRSAERFRNRYLLLNFWASWCDPQ--PEANAELKRLNKEYKKNKNFA 58 usage_00025.pdb 1 PYFSLPNEKGEKLSRSAERFRNRYLLLNFWASWCDPQ--PEANAELKRLNKEYKKNKNFA 58 usage_00249.pdb 1 PFFSLPNAKGEKITRSSDAFKQKSLLINFWASWNDSISQKQSNSELREIYKKYKKNKYIG 60 usage_00250.pdb 1 PFFSLPNAKGEKITRSSDAFKQKSLLINFWASWNDSISQKQSNSELREIYKKYKKNKYIG 60 usage_00251.pdb 1 -FFSLPNAKGEKITRSSDAFKQKSLLINFWASWNDSISQKQSNSELREIYKKYKKNKYIG 59 FSLPN KGEK RS F LL NFWASW D N EL K YKKNK usage_00022.pdb 58 LGIS- 61 usage_00023.pdb 58 LGIS- 61 usage_00024.pdb 59 LGIS- 62 usage_00025.pdb 59 LGIS- 62 usage_00249.pdb 61 LGIS- 64 usage_00250.pdb 61 LGISL 65 usage_00251.pdb 60 LGIS- 63 LGIS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################