################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:27 2021 # Report_file: c_0731_30.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00103.pdb # 2: usage_00104.pdb # 3: usage_00123.pdb # 4: usage_00124.pdb # 5: usage_00125.pdb # 6: usage_00150.pdb # # Length: 79 # Identity: 35/ 79 ( 44.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 79 ( 50.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 79 ( 21.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00103.pdb 1 RIQLEEYCNSGAHYFVKFK-RNPGGNPLEQFLEKEILSASKMLSKFRKIIKEEI-KN--T 56 usage_00104.pdb 1 RIQLEEYCNSGAHYFVKF--------PLEQ-FLEEILSASKMLSKFRKIIKEEIKNIEDT 51 usage_00123.pdb 1 --ELQEYYETGAFYLVKFK-RIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDI 57 usage_00124.pdb 1 RIELQEYYETGAFYLVKFK-------PLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDI 53 usage_00125.pdb 1 RIELQEYYETGAFYLVKFKR----GNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDI 56 usage_00150.pdb 1 --QLEEYSNTRAYYFVKFK-RNPKENPLSQFLEGEILSASK-LSKFRKIIKEEINDIKDT 56 L EY gA Y VKF PL le E LSA K LSKFRKIIKEE i usage_00103.pdb 57 GVTVERKRG-SPAVTLLIS 74 usage_00104.pdb 52 GVTVERKRRGSPAVTLLIS 70 usage_00123.pdb 58 DVSVEKEKPGSPAVTLLIR 76 usage_00124.pdb 54 DVSVEKEKPGSPAVTLLIR 72 usage_00125.pdb 57 DVSVEKEKPGSPAVTLLIR 75 usage_00150.pdb 57 DVI-KRKRGGSPAVTLLIS 74 V e SPAVTLLI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################