################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:06:56 2021 # Report_file: c_0848_80.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00471.pdb # 2: usage_00645.pdb # 3: usage_00842.pdb # 4: usage_00843.pdb # # Length: 61 # Identity: 5/ 61 ( 8.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 61 ( 54.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 61 ( 11.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00471.pdb 1 GPQEVAFANKLFTRIETMLG-MAPNTLKMGIMDEERRTSLNLRSCIAQARNRVAFINT-- 57 usage_00645.pdb 1 -WQEAAWWSEVFSYAEDRFNLPRG-TIKATLLIETLPAVFQMDEILHALRDHI-VGLNCG 57 usage_00842.pdb 1 -YLEARLWNDVFVFAQKYIGIPNG-TIKATVLLETIHASFEMDEILYELKDHS-AGLNCG 57 usage_00843.pdb 1 -WQEAAWWSEVFSYAEDRFNLPRG-TIKATLLIETLPAVFQMDEILHALRDHI-VGLNCG 57 qEaa w vF ae p g TiKat l Et a f mdeil lrdh gln usage_00471.pdb - usage_00645.pdb 58 R 58 usage_00842.pdb 58 R 58 usage_00843.pdb 58 R 58 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################