################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:28:01 2021 # Report_file: c_1244_91.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00614.pdb # 2: usage_00615.pdb # 3: usage_00616.pdb # 4: usage_00617.pdb # 5: usage_00945.pdb # 6: usage_00946.pdb # 7: usage_01597.pdb # 8: usage_01598.pdb # 9: usage_01599.pdb # 10: usage_01600.pdb # 11: usage_01601.pdb # 12: usage_01602.pdb # 13: usage_01603.pdb # 14: usage_01604.pdb # 15: usage_01605.pdb # # Length: 36 # Identity: 34/ 36 ( 94.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 36 ( 94.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 36 ( 5.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00614.pdb 1 -RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 35 usage_00615.pdb 1 -RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 35 usage_00616.pdb 1 -RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 35 usage_00617.pdb 1 --RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 34 usage_00945.pdb 1 MRRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 36 usage_00946.pdb 1 MRRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 36 usage_01597.pdb 1 -RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 35 usage_01598.pdb 1 --RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 34 usage_01599.pdb 1 -RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 35 usage_01600.pdb 1 -RRSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 35 usage_01601.pdb 1 --RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 34 usage_01602.pdb 1 --RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 34 usage_01603.pdb 1 --RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 34 usage_01604.pdb 1 --RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 34 usage_01605.pdb 1 --RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT 34 RSVYFCGSIRGGREDQALYARIVSRLRRYGKVLT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################