################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:15 2021 # Report_file: c_0656_77.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00071.pdb # 2: usage_00578.pdb # 3: usage_00579.pdb # 4: usage_00580.pdb # 5: usage_00937.pdb # 6: usage_01056.pdb # 7: usage_01058.pdb # 8: usage_01077.pdb # # Length: 68 # Identity: 22/ 68 ( 32.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 68 ( 47.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 68 ( 32.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00071.pdb 1 -LQLTQSP--SSLSASVGDRITITCRASQGVTSALAWYRQKPGSPPQLLIYD-------- 49 usage_00578.pdb 1 -IQMTQSP--SSLSASVGDRVTITCQASQVISNYLNWYQQKPGKAPKLLIYD-------- 49 usage_00579.pdb 1 -IQMTQSP--SSLSASVGDRVTITCQASQVISNYLNWYQQKPGKAPKLLIYDTSNLKTGV 57 usage_00580.pdb 1 -IQMTQSP--SSLSASVGDRVTITCQASQVISNYLNWYQQKPGKAPKLLIYDTSNLKTGV 57 usage_00937.pdb 1 -IQLTQSTSS--LPASLGDRVTISCRAGQDISNHLNWYQQKPDGTVKLLIYY-------- 49 usage_01056.pdb 1 --QMTQSP--SSLSASVGDRVTITCRATESIGIYLNWYQRKPGKAPNLLIFATSSLQSGV 56 usage_01058.pdb 1 --QMTQSP--SSLSASVGDRVTITCRATESIGIYLNWYQRKPGKAPNLLIFATSSLQSGV 56 usage_01077.pdb 1 DIQLTQSP--SSLSASVGDRVTITCQASQDIRKYLNWYQQKPGKAPNLLIYD-------- 50 Q TQSp LsASvGDRvTItC A i LnWYq KPg p LLI usage_00071.pdb -------- usage_00578.pdb -------- usage_00579.pdb 58 PSRFSGSG 65 usage_00580.pdb 58 PSRFSGSG 65 usage_00937.pdb -------- usage_01056.pdb 57 PSRFSGSG 64 usage_01058.pdb 57 PSRFSGSG 64 usage_01077.pdb -------- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################