################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:50 2021 # Report_file: c_1397_18.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00047.pdb # 2: usage_00069.pdb # 3: usage_00070.pdb # 4: usage_00273.pdb # 5: usage_00543.pdb # 6: usage_00570.pdb # 7: usage_00577.pdb # 8: usage_00620.pdb # 9: usage_00625.pdb # 10: usage_00656.pdb # 11: usage_00676.pdb # 12: usage_00677.pdb # # Length: 55 # Identity: 5/ 55 ( 9.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 55 ( 47.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 55 ( 23.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00047.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTECCQA- 53 usage_00069.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTECCQA- 53 usage_00070.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTECCQA- 53 usage_00273.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTECCQA- 53 usage_00543.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTEC---- 50 usage_00570.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTECCQA- 53 usage_00577.pdb 1 --DALCAAFQDNEQLFLGKYLYEIARR-HPYFYAPELLYYAQQYKGVFAECCQA- 51 usage_00620.pdb 1 --DAQCAAFQEDPDKFLGKYLYEVARR-HPYFYGPELLFHAEEYKADFTECCPAD 52 usage_00625.pdb 1 --NLPETLIGANPEYYLRKCLEKWGK-DFSAFHPQALAEYIRCFS---Q------ 43 usage_00656.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTECCQA- 53 usage_00676.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTECCQA- 53 usage_00677.pdb 1 EVDVMCTAFHDNEETFLKKYLYEIARR-HPYFYAPELLFFAKRYKAAFTECCQA- 53 d c af n fL KyLye ar hpyFy peLl a yk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################