################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:29 2021 # Report_file: c_0679_59.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00029.pdb # 2: usage_00133.pdb # 3: usage_00180.pdb # 4: usage_00352.pdb # 5: usage_00353.pdb # # Length: 69 # Identity: 7/ 69 ( 10.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 69 ( 21.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 69 ( 29.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00029.pdb 1 MREWLDILGNGLLRKKTLVPGPP--GSSRPVKGQVVTVHLQTSLE-NGTRVQEEP---EL 54 usage_00133.pdb 1 --EKVELTADGGVIKTILKKGDEGEE-NIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVP 57 usage_00180.pdb 1 ----LDILGNGLLRKKTLVPGPP--GSSRPVKGQVVTVHLQTSLE-NGTRVQEEP---EL 50 usage_00352.pdb 1 --TVTEIGDDKKILKKVLKEXEG---YERPNEGAVVTVKITGKLQ-DGTVFLKKG---H- 50 usage_00353.pdb 1 -TSVRDIAKDGGIFKKILKEGDK---WENPKDPDEVFVKYEARLE-DGTVVSKSE---GV 52 i g Kk L g P g VtV Le Gt usage_00029.pdb 55 VF------- 56 usage_00133.pdb 58 FK-----F- 60 usage_00180.pdb 51 VF------- 52 usage_00352.pdb 51 DEQEPFEFK 59 usage_00353.pdb 53 EF------- 54 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################