################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:14:05 2021 # Report_file: c_1297_42.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00170.pdb # 2: usage_00653.pdb # 3: usage_00654.pdb # 4: usage_01317.pdb # 5: usage_01318.pdb # 6: usage_01319.pdb # 7: usage_01523.pdb # 8: usage_01524.pdb # 9: usage_01672.pdb # 10: usage_01675.pdb # 11: usage_01856.pdb # 12: usage_02389.pdb # 13: usage_02741.pdb # 14: usage_03032.pdb # # Length: 34 # Identity: 25/ 34 ( 73.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 34 ( 91.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 34 ( 8.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00170.pdb 1 PIVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 34 usage_00653.pdb 1 -IVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 33 usage_00654.pdb 1 PIVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 34 usage_01317.pdb 1 PIVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 34 usage_01318.pdb 1 PIVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 34 usage_01319.pdb 1 PIVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 34 usage_01523.pdb 1 -IVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 33 usage_01524.pdb 1 PIVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 34 usage_01672.pdb 1 --VVELKNQNKIENALFTFYLPVHDKHTGFLTI- 31 usage_01675.pdb 1 PIVVELKNQNKIENALFTFYLPVHDKHTGFLTI- 33 usage_01856.pdb 1 -IVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 33 usage_02389.pdb 1 -IVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 33 usage_02741.pdb 1 PVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIG 34 usage_03032.pdb 1 PIVVELKNQNKIENALFTFYLPVHDKHTGFLTIG 34 VVELKNQNKIEnAlFTFYLPvhDKHtGfLTI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################