################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:15:34 2021 # Report_file: c_0404_46.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00004.pdb # 2: usage_00031.pdb # 3: usage_00106.pdb # 4: usage_00107.pdb # 5: usage_00209.pdb # # Length: 102 # Identity: 13/102 ( 12.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 44/102 ( 43.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/102 ( 26.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 TVSIFPPS-TELA-TGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDST 58 usage_00031.pdb 1 TLEVTQQPMRVG---NQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTLTE-NK-DGT 55 usage_00106.pdb 1 SVFIFPPS-DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDST 59 usage_00107.pdb 1 SVFIFPPS-DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDST 59 usage_00209.pdb 1 TVSIFPP----------ASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST 50 v ifpp asVvC nnFYP v Wk d s T ds DsT usage_00004.pdb 59 YSMSSTLSLTE-------SHNLYTCEVVHKTSSSPVVKSFNR 93 usage_00031.pdb 56 YNWTSWFLVNISDQD-----VVLTCQVKHDGQ-LAVSKRLAL 91 usage_00106.pdb 60 YSLSSTLTLSKA---DYEKHKVYACEVTHQGLSSPVTKSFNR 98 usage_00107.pdb 60 YSLSSTLTLSKA---DYEKHKVYACEVTHQGLSSPVTKSFN- 97 usage_00209.pdb 51 YSMSSTLTLTK-------RHNSYTCEAT-----SPIVKSFN- 79 Ys sStl l y Cev spv Ksfn #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################