################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:31 2021 # Report_file: c_0863_27.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00503.pdb # 2: usage_01056.pdb # 3: usage_01059.pdb # 4: usage_01060.pdb # 5: usage_01062.pdb # 6: usage_01063.pdb # 7: usage_01436.pdb # # Length: 65 # Identity: 8/ 65 ( 12.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 65 ( 33.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 65 ( 12.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00503.pdb 1 --WQYIHDVFAQYSQIYEYMADSTMTADLVAHARQWQPDLVIWDALTYAGPIAAEAVGAP 58 usage_01056.pdb 1 TPEEELDFAGHWFGRMA-----AGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVP 55 usage_01059.pdb 1 TPEEELDFAGHWFGRMA-----AGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVP 55 usage_01060.pdb 1 TPEEELDFAGHWFGRMA-----AGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVP 55 usage_01062.pdb 1 TPEEELDFAGHWFGRMA-----AGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVP 55 usage_01063.pdb 1 TPEEELDFAGHWFGRMA-----AGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVP 55 usage_01436.pdb 1 -EKPLLEHIGRGYGRLV------LRRDEALALAERWKPDLVLTETYSLTGPLVAATLGIP 53 l g gr d l W PDLV s a l Aa lG P usage_00503.pdb 59 HVRML 63 usage_01056.pdb 56 YVRQA 60 usage_01059.pdb 56 YVRQA 60 usage_01060.pdb 56 YVRQA 60 usage_01062.pdb 56 YVRQA 60 usage_01063.pdb 56 YVRQA 60 usage_01436.pdb 54 WIEQS 58 vrq #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################