################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:07 2021 # Report_file: c_0870_75.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00039.pdb # 2: usage_00091.pdb # 3: usage_00118.pdb # 4: usage_00119.pdb # 5: usage_00167.pdb # # Length: 81 # Identity: 1/ 81 ( 1.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 81 ( 24.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/ 81 ( 33.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00039.pdb 1 ---TETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELK- 56 usage_00091.pdb 1 EYVRTRRALILEILIKA-GSLKIEQIQDNLKKLGFDEVIETIENDIKGLINTGIFIEIKG 59 usage_00118.pdb 1 ---TETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELK- 56 usage_00119.pdb 1 ---TETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELK- 56 usage_00167.pdb 1 ----EAKQKVVDFLNS--SKFYFNDFTDLFP---D-MKQREVKKILTALVNDEVLEYWS- 49 e r i i i l m tv n lk Lv g e k usage_00039.pdb 57 ISNDLTTYYDF---------- 67 usage_00091.pdb 60 R----FYQL------------ 64 usage_00118.pdb 57 ISNDLTTYYDFMGHQHVNVVC 77 usage_00119.pdb 57 ISNDLTTYYDF---------- 67 usage_00167.pdb 50 SGS--TTMYGL---------- 58 tt y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################