################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:03 2021 # Report_file: c_1020_13.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00025.pdb # 2: usage_00120.pdb # 3: usage_00121.pdb # 4: usage_00144.pdb # 5: usage_00145.pdb # 6: usage_00146.pdb # 7: usage_00246.pdb # 8: usage_00275.pdb # 9: usage_00340.pdb # 10: usage_00421.pdb # 11: usage_00422.pdb # 12: usage_00423.pdb # 13: usage_00483.pdb # # Length: 44 # Identity: 10/ 44 ( 22.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 44 ( 65.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 44 ( 4.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 QPIAAANWKCNGSESLLVPLIETLNAATFDHDVQCVVAPTFLHI 44 usage_00120.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHL 44 usage_00121.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHL 44 usage_00144.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHL 44 usage_00145.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHL 44 usage_00146.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHL 44 usage_00246.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHL 44 usage_00275.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHL 44 usage_00340.pdb 1 -YFVGGNFKCNGTKESLKTLIDSFKQVESSNSEVYVFPT-SLHI 42 usage_00421.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVAPTFLHI 44 usage_00422.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVAPTFLHI 44 usage_00423.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVAPTFLHI 44 usage_00483.pdb 1 QPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVVASTFVHL 44 piaaaNwKCNGs sL LId fn hdvqcVva f H #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################