################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:09:24 2021
# Report_file: c_1113_124.html
################################################################################################
#====================================
# Aligned_structures: 4
#   1: usage_00178.pdb
#   2: usage_00415.pdb
#   3: usage_00822.pdb
#   4: usage_00954.pdb
#
# Length:         91
# Identity:       10/ 91 ( 11.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     22/ 91 ( 24.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           28/ 91 ( 30.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00178.pdb         1  -SLPCDICKDVVTAAGDL-KDNATE-----EEILVYLEKTCDWL----PKP----N-SAS   44
usage_00415.pdb         1  --LSCQMCELVVKKYEGS-A-DKDA-----NVIKKDFDAECKKLFHTI--P----FGTRE   45
usage_00822.pdb         1  -SLPCDICKDVVTAAGDMLKDNATE-----EEILVYLEKTCDWL----PKP----NMSAS   46
usage_00954.pdb         1  NVIVCEICKMAVKLIVPE-------ADKDLDQLEKEFIQGCMTL----I--GWLPYAEKE   47
                             l C iCk vV                    i       C  L                

usage_00178.pdb        45  CKEIVDSYLPVILDIIKGE-SRPGEVCSALN   74
usage_00415.pdb        46  CDHYVNSKVDPIIHELEGG-TAPKDVCTKLN   75
usage_00822.pdb        47  CKEIVDSYLPVILDIIKGEMSRPGEVCSALN   77
usage_00954.pdb        48  CKALAKIEMGAIKTLLENG-SAPEEICTTL-   76
                           Ck  v s    I     g  s P evC  L 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################