################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:11 2021 # Report_file: c_1404_31.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00019.pdb # 2: usage_00097.pdb # 3: usage_00098.pdb # 4: usage_00099.pdb # 5: usage_00423.pdb # 6: usage_00424.pdb # 7: usage_00425.pdb # 8: usage_00426.pdb # 9: usage_00427.pdb # # Length: 62 # Identity: 40/ 62 ( 64.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 62 ( 69.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 62 ( 30.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00019.pdb 1 KTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSEL 60 usage_00097.pdb 1 KTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGD----QDSEL 56 usage_00098.pdb 1 KTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGP--D-QDSEL 57 usage_00099.pdb 1 KTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSD--------DSEL 52 usage_00423.pdb 1 ---------VKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSD--Q----DSELL 45 usage_00424.pdb 1 KTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGGP-D-QDSEL 58 usage_00425.pdb 1 -TLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSD--------DSEL 51 usage_00426.pdb 1 KTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSD---------SEL 51 usage_00427.pdb 1 KTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGP--D-QDSEL 57 VKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSD seL usage_00019.pdb 61 LS 62 usage_00097.pdb 57 LS 58 usage_00098.pdb 58 LS 59 usage_00099.pdb 53 LS 54 usage_00423.pdb 46 S- 46 usage_00424.pdb 59 LS 60 usage_00425.pdb 52 LS 53 usage_00426.pdb 52 LS 53 usage_00427.pdb 58 LS 59 l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################