################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:30:43 2021 # Report_file: c_1095_46.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00108.pdb # 2: usage_00122.pdb # 3: usage_00349.pdb # 4: usage_00350.pdb # 5: usage_00408.pdb # 6: usage_00461.pdb # # Length: 84 # Identity: 29/ 84 ( 34.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 84 ( 36.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 84 ( 6.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00108.pdb 1 -SASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQLMLDCW 59 usage_00122.pdb 1 TSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCW 60 usage_00349.pdb 1 -IDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECW 59 usage_00350.pdb 1 -IDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECW 59 usage_00408.pdb 1 -SASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCW 59 usage_00461.pdb 1 -SASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCW 59 SD WS G V WEV YG PY N dV LP P dCP LM CW usage_00108.pdb 60 QKERNSRPKFDEIVNMLDKLIRN- 82 usage_00122.pdb 61 QKERAERPKFEQIVGILDKMIRNP 84 usage_00349.pdb 60 NEFPSRRPRFKDIHSRLRAW---- 79 usage_00350.pdb 60 NEFPSRRPRFKDIHSRLRAW---- 79 usage_00408.pdb 60 HKDRAQRPRFSQIVSVLDALIR-- 81 usage_00461.pdb 60 QQERARRPKFADIVSILDKLI--- 80 RP F I L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################