################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:16:09 2021 # Report_file: c_1226_88.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00034.pdb # 2: usage_00035.pdb # 3: usage_00249.pdb # 4: usage_00303.pdb # 5: usage_00639.pdb # 6: usage_00839.pdb # 7: usage_00840.pdb # 8: usage_00936.pdb # 9: usage_00937.pdb # 10: usage_00938.pdb # 11: usage_00939.pdb # 12: usage_00998.pdb # 13: usage_00999.pdb # 14: usage_01391.pdb # 15: usage_01392.pdb # 16: usage_01419.pdb # # Length: 30 # Identity: 11/ 30 ( 36.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 30 ( 53.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 30 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00034.pdb 1 RIEHDTMGEVRVPAEALWRAQTQRAVEN-- 28 usage_00035.pdb 1 RIEHDTMGEVRVPAEALWRAQTQRAVE--- 27 usage_00249.pdb 1 RIESDSFGEIQIEEKFYWGAQTQRSLN--- 27 usage_00303.pdb 1 RMERDTFGEIAVPAARLWGAQTQRSLQN-- 28 usage_00639.pdb 1 RIERDTMGEVRVPADKYWGAQTQRSLEN-- 28 usage_00839.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVE--- 27 usage_00840.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVE--- 27 usage_00936.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVEN-- 28 usage_00937.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVEN-- 28 usage_00938.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVE--- 27 usage_00939.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVEN-- 28 usage_00998.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVEN-- 28 usage_00999.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVENFP 30 usage_01391.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVE--- 27 usage_01392.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVE--- 27 usage_01419.pdb 1 RIEHDTMGEVRVPAKALWRAQTQRAVE--- 27 RiE Dt GE vpa W AQTQR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################