################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:22:08 2021 # Report_file: c_0298_7.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00051.pdb # 2: usage_00059.pdb # 3: usage_00060.pdb # 4: usage_00061.pdb # 5: usage_00062.pdb # 6: usage_00063.pdb # # Length: 106 # Identity: 61/106 ( 57.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/106 ( 57.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/106 ( 2.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00051.pdb 1 MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMS-DVVFLKVDV 59 usage_00059.pdb 1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDV 60 usage_00060.pdb 1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDV 60 usage_00061.pdb 1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDV 60 usage_00062.pdb 1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDV 60 usage_00063.pdb 1 MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMS-DVVFLKVDV 59 MVYQVKD D QL A KLVV DF ATWCGPCKMI PKL ELS VV LKVDV usage_00051.pdb 60 DECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKN- 104 usage_00059.pdb 61 DECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 106 usage_00060.pdb 61 DECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 106 usage_00061.pdb 61 DECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKAN- 105 usage_00062.pdb 61 DECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKAN- 105 usage_00063.pdb 60 DECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEK-- 103 DECEDIA I MPTF F KNG K GAN L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################