################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:01 2021 # Report_file: c_1120_73.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00330.pdb # 2: usage_00600.pdb # 3: usage_00601.pdb # 4: usage_00624.pdb # 5: usage_00991.pdb # 6: usage_01054.pdb # # Length: 62 # Identity: 24/ 62 ( 38.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 62 ( 38.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 62 ( 16.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00330.pdb 1 ANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHH------ 54 usage_00600.pdb 1 -LLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRES---- 55 usage_00601.pdb 1 -LLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRES---- 55 usage_00624.pdb 1 --LFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHH------ 52 usage_00991.pdb 1 GLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRE----- 55 usage_01054.pdb 1 GLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTK 60 LF LF M G PEL DI Y LAL KTE EAL F N A usage_00330.pdb -- usage_00600.pdb -- usage_00601.pdb -- usage_00624.pdb -- usage_00991.pdb -- usage_01054.pdb 61 VN 62 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################