################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:43 2021 # Report_file: c_1154_33.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00003.pdb # 2: usage_00004.pdb # 3: usage_00345.pdb # 4: usage_00346.pdb # 5: usage_00392.pdb # 6: usage_00394.pdb # 7: usage_00401.pdb # 8: usage_00703.pdb # 9: usage_00787.pdb # 10: usage_01155.pdb # # Length: 33 # Identity: 15/ 33 ( 45.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 33 ( 45.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 33 ( 27.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 GPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYT 33 usage_00004.pdb 1 GPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYT 33 usage_00345.pdb 1 GPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYT 33 usage_00346.pdb 1 GPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYT 33 usage_00392.pdb 1 GPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYT 33 usage_00394.pdb 1 ---------TWLQAGVVSWGEGCAQPNRPGIYT 24 usage_00401.pdb 1 GPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYT 33 usage_00703.pdb 1 GPLSCKHNEVWHLVGITSWGEGCAQRERPGVYT 33 usage_00787.pdb 1 GPLSCKHNEVWHLVGITSWGEGCAQRERPGVYT 33 usage_01155.pdb 1 ---------TWLQAGVVSWGEGCAQPNRPGIYT 24 W G SWGEGCAQ RPG YT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################