################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:55 2021 # Report_file: c_1200_368.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_02070.pdb # 2: usage_02071.pdb # 3: usage_02072.pdb # 4: usage_04010.pdb # 5: usage_04352.pdb # 6: usage_04353.pdb # # Length: 48 # Identity: 27/ 48 ( 56.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 48 ( 56.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 48 ( 43.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02070.pdb 1 ERVSFGFTTAGKPALLRPVSG--------N-GNGPFPAVSTDYVYLLM 39 usage_02071.pdb 1 ERVSFGFTTAGKPALLRPVSG---------DGNGPFPAVSTDYVYLLM 39 usage_02072.pdb 1 ERVSFGFTTAGKPALLRPVSGDDRPVAGLN-GNGPFPAVSTDYVYLLM 47 usage_04010.pdb 1 ERVSFGFTTAGKPALLRPVS-------------------STDYVYLLM 29 usage_04352.pdb 1 --VSFGFTTAGKPALLRPVSGDDRPVAGLN-GNGPFPAVSTDYVYLLM 45 usage_04353.pdb 1 --VSFGFTTAGKPALLRPVSGDDRPVAGLN-GNGPFPAVSTDYVYLLM 45 VSFGFTTAGKPALLRPVS STDYVYLLM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################