################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:36 2021 # Report_file: c_0760_20.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00022.pdb # 2: usage_00547.pdb # 3: usage_00548.pdb # 4: usage_00549.pdb # 5: usage_00550.pdb # 6: usage_00575.pdb # 7: usage_00745.pdb # 8: usage_00757.pdb # # Length: 67 # Identity: 5/ 67 ( 7.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 67 ( 31.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 67 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 --MIFAVRTMVGQEKNIAGLMASRAEKEQ-------LDVYSILASESLKGYVLVEAETKG 51 usage_00547.pdb 1 -HMIFAVRTMVGQEKNIAGLMASRAEKEQ-------LDVYSILASESLKGYVLVEAETKG 52 usage_00548.pdb 1 -HMIFAVRTMVGQEKNIAGLMASRAEKEQ-------LDVYSILASESLKGYVLVEAETKG 52 usage_00549.pdb 1 -HMIFAVRTMVGQEKNIAGLMASRAEKEQ-------LDVYSILASESLKGYVLVEAETKG 52 usage_00550.pdb 1 -HMIFAVRTMVGQEKNIAGLMASRAEKEQ-------LDVYSILASESLKGYVLVEAETKG 52 usage_00575.pdb 1 --NKVVLLCRPGFEKECAAEITDKAGQRE-------IF-GFARVKEN-AGYVIYECYQPD 49 usage_00745.pdb 1 SATIWGVRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSIFQRDNYTGRIYIEAPKQS 60 usage_00757.pdb 1 --MIFAVRTMVGQEKNIAGLMASRAEKEQ-------LDVYSILASESLKGYVLVEAETKG 51 i vr G EK a a l si e Gyv Ea usage_00022.pdb 52 DVEELI- 57 usage_00547.pdb 53 DVEELI- 58 usage_00548.pdb 53 DVEELI- 58 usage_00549.pdb 53 DVEELI- 58 usage_00550.pdb 53 DVEELI- 58 usage_00575.pdb 50 DGDKLIR 56 usage_00745.pdb 61 VIEKFC- 66 usage_00757.pdb 52 DVEELI- 57 d e li #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################