################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:10 2021 # Report_file: c_0773_15.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00046.pdb # 2: usage_00047.pdb # 3: usage_00048.pdb # 4: usage_00049.pdb # 5: usage_00310.pdb # 6: usage_00311.pdb # 7: usage_00312.pdb # # Length: 78 # Identity: 65/ 78 ( 83.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 72/ 78 ( 92.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 78 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 SSKIAVLEVSGTIQD--GYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKK 58 usage_00047.pdb 1 --AVLEVSG--TIQD--GYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKK 54 usage_00048.pdb 1 SSKIAVLEVSGTIQDNDGYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKK 60 usage_00049.pdb 1 SSKIAVLEVSGTIQDNDGYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKK 60 usage_00310.pdb 1 -SKIAVLEVSGTIQDN-GYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKK 58 usage_00311.pdb 1 SSKIAVLEVSGTIQDN-GYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKK 59 usage_00312.pdb 1 -SKIAVLEVSGTIQDN-GYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKK 58 kiavlev TIQD GYNHRTFLKNLERAKDDKTVKGIVLKVNSPGGGVYESAEIHKK usage_00046.pdb 59 LEEIKKETKKPIYVSMGS 76 usage_00047.pdb 55 LEEIKKETKKPIYVSMGS 72 usage_00048.pdb 61 LEEIKKETKKPIYVSMGS 78 usage_00049.pdb 61 LEEIKKETKKPIYVSMGS 78 usage_00310.pdb 59 LEEIKKETKKPIYVSMGS 76 usage_00311.pdb 60 LEEIKKETKKPIYVSMGS 77 usage_00312.pdb 59 LEEIKKETKKPIYVSMGS 76 LEEIKKETKKPIYVSMGS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################