################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:18 2021 # Report_file: c_0821_36.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00012.pdb # 2: usage_00045.pdb # 3: usage_00521.pdb # 4: usage_00522.pdb # 5: usage_00523.pdb # 6: usage_00524.pdb # 7: usage_00581.pdb # # Length: 66 # Identity: 7/ 66 ( 10.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 66 ( 16.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 66 ( 28.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 --SLEADSLVETALSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEEKGA-V---- 53 usage_00045.pdb 1 ---LELSQLIYSARAAGAFGAKITGAGGGGC-VALTA-PEKCNQVAEAVAG-AGG---KV 51 usage_00521.pdb 1 --CRELESIVQTCRTYGALGAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCP-EAKFI 57 usage_00522.pdb 1 --CRELESIVQTCRTYGALGAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCP-EAKFI 57 usage_00523.pdb 1 --CRELESIVQTCRTYGALGAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCP-EAKFI 57 usage_00524.pdb 1 --CRELESIVQTCRTYGALGAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCP-EAKFI 57 usage_00581.pdb 1 KIEQLMKIGKENG----AIAGKLTGAGRGGSMLLLAKDLPTAKNIVKAVEKAGA-A-HTW 54 e A gaK G G GG aL usage_00012.pdb 54 QTWIES 59 usage_00045.pdb 52 TIT--- 54 usage_00521.pdb 58 WRYTVQ 63 usage_00522.pdb 58 WRYTVQ 63 usage_00523.pdb 58 WRYTVQ 63 usage_00524.pdb 58 WRYTVQ 63 usage_00581.pdb 55 IENLG- 59 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################