################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:55:33 2021 # Report_file: c_1148_220.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00066.pdb # 2: usage_00067.pdb # 3: usage_01200.pdb # 4: usage_01201.pdb # 5: usage_01336.pdb # 6: usage_01337.pdb # 7: usage_01515.pdb # 8: usage_01516.pdb # 9: usage_01517.pdb # 10: usage_01705.pdb # 11: usage_02038.pdb # 12: usage_02727.pdb # 13: usage_02728.pdb # 14: usage_03116.pdb # 15: usage_03117.pdb # 16: usage_03118.pdb # 17: usage_03871.pdb # # Length: 30 # Identity: 10/ 30 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 30 ( 73.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 30 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00066.pdb 1 QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE 30 usage_00067.pdb 1 QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE 30 usage_01200.pdb 1 QAYSLTFTEAGTYDYHCTFHPFMRGKVVVE 30 usage_01201.pdb 1 QAYSLTFTEAGTYDYHCTFHPFMRGKVVVE 30 usage_01336.pdb 1 QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE 30 usage_01337.pdb 1 QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE 30 usage_01515.pdb 1 QAYAITFNEAGSYDYFCTPHPFMRGKVIVE 30 usage_01516.pdb 1 QAYAITFNEAGSYDYFCTPHPFMRGKVIVE 30 usage_01517.pdb 1 QAYAITFNEAGSYDYFCTPHPFMRGKVIVE 30 usage_01705.pdb 1 QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE 30 usage_02038.pdb 1 QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE 30 usage_02727.pdb 1 QAYAITFNEAGSYDYFCTPHPFMRGKVIVE 30 usage_02728.pdb 1 QAYAITFNEAGSYDYFCTPHPFMRGKVIVE 30 usage_03116.pdb 1 QAYSLTFTEAGTYDYHCTPHGFMRGKVVVE 30 usage_03117.pdb 1 QAYSLTFTEAGTYDYHCTPHGFMRGKVVVE 30 usage_03118.pdb 1 QAYSLTFTEAGTYDYHCTPHGFMRGKVVVE 30 usage_03871.pdb 1 DRFEHVFEEEGVYKYYCSFHPWRVGLVTVS 30 qay tF EaG YdY Ct H fmrGkV Ve #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################