################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:22 2021 # Report_file: c_0680_32.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00240.pdb # 2: usage_00241.pdb # 3: usage_00242.pdb # 4: usage_00243.pdb # 5: usage_00382.pdb # 6: usage_00383.pdb # 7: usage_00519.pdb # 8: usage_01392.pdb # # Length: 72 # Identity: 9/ 72 ( 12.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 72 ( 20.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 72 ( 18.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00240.pdb 1 --TNLK--GNQTLTASIELTNSGDYDGAEVVQLYIRDLVGSTTRPVKELKGFQKVFLKKG 56 usage_00241.pdb 1 --TNLK--GNQTLTASIELTNSGDYDGAEVVQLYIRDLVGSTTRPVKELKGFQKVFLKKG 56 usage_00242.pdb 1 --TNLK--GNQTLTASIELTNSGDYDGAEVVQLYIRDLVGSTTRPVKELKGFQKVFLKKG 56 usage_00243.pdb 1 --TNLK--GNQTLTASIELTNSGDYDGAEVVQLYIRDLVGSTTRPVKELKGFQKVFLKKG 56 usage_00382.pdb 1 --KELN--LGESLHVEVTIKNISDIAGKEVIQVYLQDVTASISRPVKELKAFEKVALQAG 56 usage_00383.pdb 1 --KELN--LGESLHVEVTIKNISDIAGKEVIQVYLQDVTASISRPVKELKAFEKVALQAG 56 usage_00519.pdb 1 LNVSFD--G-ETLRVQYRIENTGGRAGKEVSQVYIKAPKGKIDKPFQELKAFHKTRLLNP 57 usage_01392.pdb 1 GEFTADINS-RTFTASCTVKNTGSVAGKDVAQFYVSAPQGKLGKPEKVLVAFKKTGILNP 59 l N G eV Q Y P keLk F K l usage_00240.pdb 57 -ETK-T------ 60 usage_00241.pdb 57 -ETK-T------ 60 usage_00242.pdb 57 -ETK-T------ 60 usage_00243.pdb 57 -ETK-T------ 60 usage_00382.pdb 57 -EEK-T-VTFE- 64 usage_00383.pdb 57 -EEK-T-VTFE- 64 usage_00519.pdb 58 -GESEEVVLEIP 68 usage_01392.pdb 60 GKEE-KITVT-- 68 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################