################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:50:54 2021 # Report_file: c_0685_43.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00375.pdb # 2: usage_00638.pdb # 3: usage_00966.pdb # 4: usage_01007.pdb # 5: usage_01008.pdb # 6: usage_01013.pdb # 7: usage_01025.pdb # 8: usage_01044.pdb # 9: usage_01046.pdb # 10: usage_01123.pdb # 11: usage_01260.pdb # 12: usage_01328.pdb # # Length: 55 # Identity: 52/ 55 ( 94.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 52/ 55 ( 94.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 55 ( 5.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00375.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_00638.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_00966.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_01007.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_01008.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_01013.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_01025.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_01044.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLE 55 usage_01046.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLE 55 usage_01123.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_01260.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 usage_01328.pdb 1 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR--- 52 KVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################