################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:06 2021 # Report_file: c_1341_47.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00324.pdb # 2: usage_00345.pdb # 3: usage_00447.pdb # 4: usage_00473.pdb # 5: usage_00510.pdb # 6: usage_00511.pdb # 7: usage_00512.pdb # 8: usage_00522.pdb # 9: usage_00524.pdb # 10: usage_00586.pdb # 11: usage_00659.pdb # 12: usage_00670.pdb # 13: usage_00674.pdb # # Length: 32 # Identity: 2/ 32 ( 6.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 32 ( 25.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 32 ( 9.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00324.pdb 1 -VEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 30 usage_00345.pdb 1 -LAQSLTLIEQKRADATLNDELAVLDYLKKNP 31 usage_00447.pdb 1 -VEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 30 usage_00473.pdb 1 -PSEAMLMVANGQADAVVQTQISASYYVNRYF 31 usage_00510.pdb 1 GVEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 31 usage_00511.pdb 1 -VEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 30 usage_00512.pdb 1 -VEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 30 usage_00522.pdb 1 -VEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 30 usage_00524.pdb 1 -VEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 30 usage_00586.pdb 1 GVEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 31 usage_00659.pdb 1 -VEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 30 usage_00670.pdb 1 -VEDALVSLKTGKLDAFIYDAAVLNYKAGRD- 30 usage_00674.pdb 1 GVEDALVSLKTGKLDAFIYDAAVLNYKAGR-- 30 al g DA d y r #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################