################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:02:39 2021 # Report_file: c_0905_86.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00072.pdb # 2: usage_00075.pdb # 3: usage_00076.pdb # 4: usage_00077.pdb # 5: usage_00078.pdb # 6: usage_00079.pdb # 7: usage_00161.pdb # 8: usage_00531.pdb # 9: usage_00532.pdb # 10: usage_00958.pdb # 11: usage_00969.pdb # 12: usage_00972.pdb # 13: usage_00973.pdb # # Length: 57 # Identity: 6/ 57 ( 10.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 57 ( 12.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 57 ( 38.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00072.pdb 1 PTQTVDFGRPAVFTCQYTGNPIKTVSWMKDG-KAIGH-----------SEPVLRI-- 43 usage_00075.pdb 1 PTQTVDFGRPAVFTCQYTGNPIKTVSWMKDG-KAIGH-----------SEPVLRI-- 43 usage_00076.pdb 1 --QTVDFGRPAVFTCQYTGNPIKTVSWMKDG-KAIGH-----------SEPVLRI-- 41 usage_00077.pdb 1 PTQTVDFGRPAVFTCQYTGNPIKTVSWMKDG-KAIGH-----------SEPVLRIES 45 usage_00078.pdb 1 PTQTVDFGRPAVFTCQYTGNPIKTVSWMKDG-KAIGH-----------SEPVLRIES 45 usage_00079.pdb 1 PTQTVDFGRPAVFTCQYTGNPIKTVSWMKDG-KAIGH-----------SEPVLRI-- 43 usage_00161.pdb 1 RLHAVPAANTVKFRCPAGGNPMPTMRWLKNG-KEFKQEHRIGGYKVRNQHWSLIMES 56 usage_00531.pdb 1 -TRVIEVGHTVLMTCKAIGNPTPNIYWIKNQ-TKVDMSN--PR-YSL-KDGFLQIEN 51 usage_00532.pdb 1 -LKVVERTRTATMLCAASGNPDPEITWFKDF-LPVDPSASNGRIKQL-RSGALQIES 54 usage_00958.pdb 1 AETYALVGQQVTLECFAFGNPVPRIKWRKV------------------AEPTLQIPS 39 usage_00969.pdb 1 PTQTVDFGRPAVFTCQYTGNPIKTVSWMKDG-KAIGH-----------SEPVLRIES 45 usage_00972.pdb 1 NRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDV--PGLRQIS-SDGKLVFPP 54 usage_00973.pdb 1 PTQTVDFGRPAVFTCQYTGNPIKTVSWMKDG-KAIGH-----------SEPVLRIE- 44 C GNP W k L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################