################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:48 2021 # Report_file: c_1084_105.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00132.pdb # 2: usage_00133.pdb # 3: usage_00211.pdb # 4: usage_00384.pdb # 5: usage_01561.pdb # 6: usage_01562.pdb # 7: usage_01720.pdb # 8: usage_01721.pdb # # Length: 66 # Identity: 25/ 66 ( 37.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 66 ( 37.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 66 ( 13.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00132.pdb 1 -IPLIASSIMSKKIAAGADAIVLDVKTGAGAFMKKLDEARRLARVMVDIGKRVGRRTMAV 59 usage_00133.pdb 1 -IPLIASSIMSKKIAAGADAIVLDVKTGAGAFMKKLDEARRLARVMVDIGKRVGRRTMAV 59 usage_00211.pdb 1 ---------LAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTAL 51 usage_00384.pdb 1 SIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTAL 60 usage_01561.pdb 1 SIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTAL 60 usage_01562.pdb 1 SIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTAL 60 usage_01720.pdb 1 SIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTAL 60 usage_01721.pdb 1 SIPLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTAL 60 KK A G DA V DVK G GAFM LA V G RT A usage_00132.pdb 60 ISDMSQ 65 usage_00133.pdb 60 ISDMSQ 65 usage_00211.pdb 52 LTDMNQ 57 usage_00384.pdb 61 LTDMNQ 66 usage_01561.pdb 61 LTDMNQ 66 usage_01562.pdb 61 LTDMNQ 66 usage_01720.pdb 61 LTDMNQ 66 usage_01721.pdb 61 LTDMNQ 66 DM Q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################