################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:42 2021 # Report_file: c_1250_64.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00133.pdb # 2: usage_00134.pdb # 3: usage_00423.pdb # 4: usage_00424.pdb # 5: usage_00425.pdb # 6: usage_00777.pdb # 7: usage_00778.pdb # 8: usage_01246.pdb # 9: usage_01520.pdb # 10: usage_01571.pdb # # Length: 36 # Identity: 4/ 36 ( 11.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 36 ( 22.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 36 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00133.pdb 1 EVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVE 36 usage_00134.pdb 1 -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE 31 usage_00423.pdb 1 -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE 31 usage_00424.pdb 1 -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE 31 usage_00425.pdb 1 -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE 31 usage_00777.pdb 1 -----KIAIFGTVGAGKSTISAEISKKLGYEIFKE- 30 usage_00778.pdb 1 -----KIAIFGTVGAGKSTISAEISKKLGYEIFKE- 30 usage_01246.pdb 1 -----HVLLVGDPGVAKSQILRYVANLAPRAIYTS- 30 usage_01520.pdb 1 -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE 31 usage_01571.pdb 1 -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE 31 i G G gK I k k #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################