################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:56 2021 # Report_file: c_1394_64.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00931.pdb # 2: usage_00932.pdb # 3: usage_00933.pdb # 4: usage_00934.pdb # 5: usage_00935.pdb # 6: usage_00937.pdb # 7: usage_00938.pdb # 8: usage_00939.pdb # 9: usage_01283.pdb # 10: usage_01284.pdb # # Length: 62 # Identity: 59/ 62 ( 95.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 59/ 62 ( 95.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 62 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00931.pdb 1 -GETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 59 usage_00932.pdb 1 -GETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 59 usage_00933.pdb 1 -GETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 59 usage_00934.pdb 1 -GETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 59 usage_00935.pdb 1 -GETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 59 usage_00937.pdb 1 LGETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 60 usage_00938.pdb 1 LGETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 60 usage_00939.pdb 1 LGETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 60 usage_01283.pdb 1 LGETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 60 usage_01284.pdb 1 -GETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE 59 GETMKIIAKHLPSEFARGVESPDSTDEKPLFPPSYKHGPREMDIMSKLERLPEILSSAE usage_00931.pdb 60 SA 61 usage_00932.pdb 60 SA 61 usage_00933.pdb 60 SA 61 usage_00934.pdb -- usage_00935.pdb 60 S- 60 usage_00937.pdb 61 S- 61 usage_00938.pdb 61 SA 62 usage_00939.pdb 61 S- 61 usage_01283.pdb 61 S- 61 usage_01284.pdb 60 S- 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################