################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:23 2021 # Report_file: c_1255_67.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00078.pdb # 2: usage_00079.pdb # 3: usage_00701.pdb # 4: usage_00702.pdb # 5: usage_00709.pdb # 6: usage_00727.pdb # 7: usage_00728.pdb # 8: usage_00729.pdb # 9: usage_00730.pdb # 10: usage_00731.pdb # 11: usage_01648.pdb # 12: usage_01649.pdb # # Length: 47 # Identity: 14/ 47 ( 29.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 47 ( 29.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 47 ( 10.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00078.pdb 1 CKVIPFPVNVVTYPPPSGKRCFALGDSIRAAVESFPEDLNVHVWG-- 45 usage_00079.pdb 1 CKVIPFPVNVVTYPPPSGKRCFALGDSIRAAVESFPEDLNVHVWG-- 45 usage_00701.pdb 1 CRIVPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAGTG 47 usage_00702.pdb 1 CRIVPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAG-- 45 usage_00709.pdb 1 CRIVPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAG-- 45 usage_00727.pdb 1 ---VPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAG-- 42 usage_00728.pdb 1 ---VPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAG-- 42 usage_00729.pdb 1 ---VPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAG-- 42 usage_00730.pdb 1 ---VPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAG-- 42 usage_00731.pdb 1 ---VPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAGT- 43 usage_01648.pdb 1 CRIVPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAG-- 45 usage_01649.pdb 1 CRIVPLQCGVLQHPIPKARRFWNFGRSLRRAIQSYPRDIKVAIAGTG 47 P V P P R G S R A S P D V G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################