################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:39 2021 # Report_file: c_0512_118.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00022.pdb # 2: usage_00023.pdb # 3: usage_00129.pdb # 4: usage_00242.pdb # 5: usage_00536.pdb # 6: usage_00781.pdb # # Length: 95 # Identity: 23/ 95 ( 24.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 95 ( 29.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 95 ( 15.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 KIEEAVINFSKISYENGLDGMVCSVFESKKIKEHTSSNFLTLTPGIRPFG------ANLA 54 usage_00023.pdb 1 KIEEAVINFSKISYENGLDGMVCSVFESKKIKEHTSSNFLTLTPGIRPFGV-----ANLA 55 usage_00129.pdb 1 --AEQVLSLAK-AKHSGADGVICSPLEVKKLHENIGDDFLYVTPGIRP---------ATP 48 usage_00242.pdb 1 -PQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPAG-SQRRIMTPA 58 usage_00536.pdb 1 -PQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPA---QRRIMTPA 56 usage_00781.pdb 1 -VPDIVCR-ATLAKSAGLDGVVCSAQEAALLRKQFDRNFLLVTPGIRL---------TPR 49 V GlDG vCS E F TPGIRp usage_00022.pdb 55 MARENLSDYIVVGRPIYKNENPRAVCEKILNKI-- 87 usage_00023.pdb 56 MARENLSDYIVVGRPIYKNENPRAVCEKILNKI-- 88 usage_00129.pdb 49 KAKEWGSSAIVVGRPITLASDPKAAYEAIKKEFNA 83 usage_00242.pdb 59 QAIASGSDYLVIGRPITQAAHPEVVLEEINSSL-- 91 usage_00536.pdb 57 QAIASGSDYLVIGRPITQAAHPEVVLEEINSSLV- 90 usage_00781.pdb 50 AAIQAGSDYLVIGRPITQSTDPLKALEAIDKDIK- 83 A Sdy V GRPI P E I #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################