################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:33:11 2021 # Report_file: c_1363_160.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01632.pdb # 2: usage_01634.pdb # 3: usage_01635.pdb # 4: usage_01636.pdb # 5: usage_01637.pdb # 6: usage_02055.pdb # # Length: 67 # Identity: 3/ 67 ( 4.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 67 ( 34.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 67 ( 14.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01632.pdb 1 -AAEVDALAKAGAAIDRVHARVPAFLV------PGRTEAQVAADIAEAIVAEG-HSAVAF 52 usage_01634.pdb 1 TDSEIKILKEAAQIADAAFEHILSFIR------PGVSEIEVSNELEFFMRKQG-ATSSSF 53 usage_01635.pdb 1 TDSEIKILKEAAQIADAAFEHILSFIR------PGVSEIEVSNELEFFMRKQG-ATSSSF 53 usage_01636.pdb 1 TDSEIKILKEAAQIADAAFEHILSFIR------PGVSEIEVSNELEFFMRKQG-ATSSSF 53 usage_01637.pdb 1 TDSEIKILKEAAQIADAAFEHILSFIR------PGVSEIEVSNELEFFMRKQG-ATSSSF 53 usage_02055.pdb 1 -DHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSF 59 d E l a daa l f pg Eiev qg sF usage_01632.pdb 53 VIVGS-- 57 usage_01634.pdb 54 DIIVASG 60 usage_01635.pdb 54 DIIVASG 60 usage_01636.pdb 54 DIIVASG 60 usage_01637.pdb 54 DIIVASG 60 usage_02055.pdb 60 DTISAVG 66 dii a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################