################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:40 2021 # Report_file: c_0982_103.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00141.pdb # 2: usage_00193.pdb # 3: usage_00194.pdb # 4: usage_00195.pdb # 5: usage_00196.pdb # 6: usage_00441.pdb # 7: usage_00672.pdb # 8: usage_00673.pdb # 9: usage_00674.pdb # 10: usage_00780.pdb # 11: usage_01009.pdb # # Length: 43 # Identity: 17/ 43 ( 39.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 43 ( 67.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 43 ( 7.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00141.pdb 1 AMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIG 43 usage_00193.pdb 1 AMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELI- 42 usage_00194.pdb 1 AMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELI- 42 usage_00195.pdb 1 AMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELI- 42 usage_00196.pdb 1 AMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELI- 42 usage_00441.pdb 1 -MDVEYTG-DRITYKVIGGIIDLYIFAGRTPEMVLDQYTKLI- 40 usage_00672.pdb 1 AMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELI- 42 usage_00673.pdb 1 AMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELI- 42 usage_00674.pdb 1 AMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELI- 42 usage_00780.pdb 1 AMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELI- 42 usage_01009.pdb 1 AMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELI- 42 M V qp pa TYrt GG lDfYvFlG TPE V q Y eLI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################