################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:28 2021 # Report_file: c_0738_12.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00077.pdb # 2: usage_00078.pdb # 3: usage_00140.pdb # 4: usage_00377.pdb # 5: usage_00378.pdb # 6: usage_00379.pdb # # Length: 77 # Identity: 40/ 77 ( 51.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 77 ( 51.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 77 ( 13.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00077.pdb 1 -LCQVAGWGHQFEGAEEY-ASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGT 58 usage_00078.pdb 1 TLCQVAGWGHQFEGAEEY-ASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLE--- 56 usage_00140.pdb 1 -KCQIAGWGHLDENVSGYS-SSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFD-CK 57 usage_00377.pdb 1 --CQIAGWGHLDENVSGYS-SSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFD-CK 56 usage_00378.pdb 1 --CQIAGWGHLDENVSGYS-SSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFD-CK 56 usage_00379.pdb 1 --CQIAGWGHLDENVSGYS-SSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFD-CK 56 CQ AGWGH E Y S L EA VP CS P V G I P MLCAG usage_00077.pdb 59 -DACQGDSGGPLVCE-- 72 usage_00078.pdb 57 -DACQGDSGGPLVCE-- 70 usage_00140.pdb 58 SDACQGDSGGPLACEK- 73 usage_00377.pdb 57 SDACQGDSGGPLACEKN 73 usage_00378.pdb 57 SDACQGDSGGPLACEKN 73 usage_00379.pdb 57 SDACQGDSGGPLACEK- 72 DACQGDSGGPL CE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################