################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:14:36 2021 # Report_file: c_0705_50.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00032.pdb # 2: usage_00033.pdb # 3: usage_00237.pdb # 4: usage_00315.pdb # 5: usage_00316.pdb # 6: usage_00337.pdb # 7: usage_00346.pdb # 8: usage_00554.pdb # 9: usage_00555.pdb # 10: usage_00634.pdb # 11: usage_00635.pdb # 12: usage_00664.pdb # 13: usage_00665.pdb # 14: usage_00749.pdb # # Length: 52 # Identity: 23/ 52 ( 44.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 52 ( 44.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 52 ( 5.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00032.pdb 1 ---SIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVC 49 usage_00033.pdb 1 ---SIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVC 49 usage_00237.pdb 1 ---SIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVC 49 usage_00315.pdb 1 ---SIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVC 49 usage_00316.pdb 1 ---SIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVC 49 usage_00337.pdb 1 ---IIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVG 49 usage_00346.pdb 1 ---IIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVG 49 usage_00554.pdb 1 ---SIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTVKMSTYLVAFIIS 49 usage_00555.pdb 1 ASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTVKMSTYLVAFIIS 52 usage_00634.pdb 1 ---SIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVC 49 usage_00635.pdb 1 ---SIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVC 49 usage_00664.pdb 1 ---SIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTVKMSTYLVAFIIS 49 usage_00665.pdb 1 ---SIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTVKMSTYLVAFIIS 49 usage_00749.pdb 1 ---SIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVC 49 IKI R A SNMP GL D F VKMSTYLVA I #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################