################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:11:25 2021 # Report_file: c_0263_3.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00003.pdb # 2: usage_00006.pdb # 3: usage_00009.pdb # 4: usage_00012.pdb # 5: usage_00013.pdb # # Length: 138 # Identity: 19/138 ( 13.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/138 ( 23.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/138 ( 15.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 ----WKSFYEEVKKHNELPTTSQPPIGELVALYEELGK-SYDAVISIHLSSGISGTFSSA 55 usage_00006.pdb 1 T---PTEIFQKVREGAAFPTTSQPSPEDFARVYREALE-EADHVLSLHISGKLSGTVQSA 56 usage_00009.pdb 1 --PEEINFYKRIREAGSVPKTSQPSVEDFKKRYLKYKEEDYDVVLVLTLSSKLSGTYNSA 58 usage_00012.pdb 1 -EPEEINFYKRIREAGSVPKTSQPSVEDFKKRYLKYKEEDYDVVLVLTLSSKLSGTYNSA 59 usage_00013.pdb 1 TRDECYQRVDDP---KLFPKTSLPSVESYADVFRSFVE-QGFPVVCFTITTLFSGSYNSA 56 P TSqPs e y e d V s SGt SA usage_00003.pdb 56 AAADSMV---D-NIDVYPFDSEISCLAQGFYALKAA-ELIKNGASSPEDIIKELEEMK-K 109 usage_00006.pdb 57 ELAAQEF---P--GRVTVVDTQAASLGVG--VLRAKELL-EEG-QSLEAVLAELERLR-R 106 usage_00009.pdb 59 VLASKEV---D--IPVYVVDTLLASGAIPLPARVAR-EL-ENG-ATIEEVLKKLDERKNK 110 usage_00012.pdb 60 VLASKEV---D--IPVYVVDTLLASGAIPLPARVAR-EL-ENG-ATIEEVLKKLDERKNK 111 usage_00013.pdb 57 INAKSLVLEDYPDANICVIDSKQNTVTQALLIDQFV-RL-EDG-LSFEQAS-KLDAL--A 110 A v v v D a L e G E L usage_00003.pdb 110 TVRAYFMVDDLAHLQRGG 127 usage_00006.pdb 107 DHFVRFSVATLEFLKRGG 124 usage_00009.pdb 111 DFKAIFYVSNFDYLVKGG 128 usage_00012.pdb 112 DFKAIFYVSNFDYLVKGG 129 usage_00013.pdb 111 SARIFFTVGSLDYLKGG- 127 F V L G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################