################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:06:26 2021 # Report_file: c_0685_12.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00427.pdb # 2: usage_01204.pdb # 3: usage_01243.pdb # 4: usage_01268.pdb # # Length: 76 # Identity: 62/ 76 ( 81.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 66/ 76 ( 86.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 76 ( 13.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00427.pdb 1 GALTGTYE-------SRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQY 53 usage_01204.pdb 1 GALTGTYESAVGNAESRYVLTGRYDSAPA---SGTALGWTVAWKNNYRNAHSATTWSGQY 57 usage_01243.pdb 1 GALTGTYENAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNSKNAHSATTWSGQY 60 usage_01268.pdb 1 GALTGTYE-----AESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQY 55 GALTGTYE SRYVLTGRYDSAPA SGTALGWTVAWKNNyrNAHSATTWSGQY usage_00427.pdb 54 VGGAEARINTQWLLTS 69 usage_01204.pdb 58 VGGAEARINTQWLLTS 73 usage_01243.pdb 61 VGGADAKINTQWLLTS 76 usage_01268.pdb 56 VGGAEARINTQWLLTS 71 VGGAeArINTQWLLTS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################