################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 02:50:33 2021
# Report_file: c_1219_112.html
################################################################################################
#====================================
# Aligned_structures: 22
#   1: usage_00551.pdb
#   2: usage_00552.pdb
#   3: usage_00553.pdb
#   4: usage_00554.pdb
#   5: usage_00555.pdb
#   6: usage_00556.pdb
#   7: usage_00557.pdb
#   8: usage_00558.pdb
#   9: usage_00559.pdb
#  10: usage_00560.pdb
#  11: usage_01124.pdb
#  12: usage_01125.pdb
#  13: usage_01126.pdb
#  14: usage_01127.pdb
#  15: usage_01128.pdb
#  16: usage_01129.pdb
#  17: usage_01942.pdb
#  18: usage_01943.pdb
#  19: usage_01944.pdb
#  20: usage_01945.pdb
#  21: usage_02052.pdb
#  22: usage_02053.pdb
#
# Length:         31
# Identity:       31/ 31 (100.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     31/ 31 (100.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            0/ 31 (  0.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00551.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00552.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00553.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00554.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00555.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00556.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00557.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00558.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00559.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_00560.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01124.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01125.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01126.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01127.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01128.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01129.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01942.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01943.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01944.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_01945.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_02052.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
usage_02053.pdb         1  GITDQRTENVFEDLTGNRVRYTNWNEGEPNN   31
                           GITDQRTENVFEDLTGNRVRYTNWNEGEPNN


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################