################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:28 2021 # Report_file: c_0970_90.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00042.pdb # 2: usage_00043.pdb # 3: usage_00044.pdb # 4: usage_00045.pdb # 5: usage_01002.pdb # # Length: 66 # Identity: 53/ 66 ( 80.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 53/ 66 ( 80.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 66 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 ---GAKTGTA---KHVATFIGFAPAKNPRVIVAVTIDEPTAHGYYGGVVAGPPFKKI-GG 53 usage_00043.pdb 1 FDVGAKTGTARKNKHVATFIGFAPAKNPRVIVAVTIDEPTAHGYYGGVVAGPPFKKI-GG 59 usage_00044.pdb 1 ----AKTGTARKNKHVGTFIGFAPAKNPRVIVAVTIDEPTAHGYYGGVVAGSPFKKIMGG 56 usage_00045.pdb 1 ---GAKTGTARKNKHVGTFIGFAPAKNPRVIVAVTIDEPTAHGYYGGVVAGSPFKKIMGG 57 usage_01002.pdb 1 ---GAKTGTARKNKHVGTFIGFAPAKNPRVIVAVTIDEPTAHG---GVVAGSPFKKIMGG 54 AKTGTA KHV TFIGFAPAKNPRVIVAVTIDEPTAHG GVVAG PFKKI GG usage_00042.pdb 54 SLNILG 59 usage_00043.pdb 60 SLNILG 65 usage_00044.pdb 57 SLNILG 62 usage_00045.pdb 58 SLNILG 63 usage_01002.pdb 55 SLNILG 60 SLNILG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################