################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:36 2021 # Report_file: c_1032_75.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00267.pdb # 2: usage_00268.pdb # 3: usage_00413.pdb # 4: usage_00660.pdb # 5: usage_00698.pdb # # Length: 62 # Identity: 13/ 62 ( 21.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 62 ( 32.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 62 ( 27.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00267.pdb 1 MKLLFV------RSPAAEAVMKKVIQNHHLTEKYICDSAG--------QADSRMRKVGKS 46 usage_00268.pdb 1 MKLLFV------RSPAAEAVMKKVIQNHHLTEKYICDSAG----------DSRMRKVGKS 44 usage_00413.pdb 1 MKLLFVCLGNICRSPAAEAVMKKVIQNHHLTEKYICDSAGTCSYHEGQQADSRMRKVGKS 60 usage_00660.pdb 1 ISVLFVCLGNICRSPMAEAIFRDLAAKKGLEGKIKADSAGIGGWHIGNPPHEGTQEILRR 60 usage_00698.pdb 1 VRVLFVCLGNICRSPMAEGIFRKLLKERGLEDRFEVDSAGTGAWHVGEPMDPRARRVLEE 60 LFV RSP AEa k L k DSAG d r r v usage_00267.pdb 47 RG 48 usage_00268.pdb 45 RG 46 usage_00413.pdb 61 RG 62 usage_00660.pdb 61 EG 62 usage_00698.pdb 61 E- 61 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################