################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:10 2021 # Report_file: c_1408_81.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00062.pdb # 2: usage_00934.pdb # 3: usage_01214.pdb # 4: usage_01217.pdb # 5: usage_01218.pdb # 6: usage_01379.pdb # # Length: 69 # Identity: 13/ 69 ( 18.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 69 ( 31.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 69 ( 8.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00062.pdb 1 -----MPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMP 55 usage_00934.pdb 1 GPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMN 60 usage_01214.pdb 1 -IWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMN 59 usage_01217.pdb 1 -IWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMN 59 usage_01218.pdb 1 TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMN 60 usage_01379.pdb 1 -LPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMP 59 L T N lV L Tv Ny SLa aDLi g M usage_00062.pdb 56 MNILYLLM- 63 usage_00934.pdb 61 LYTTYLLMG 69 usage_01214.pdb 60 LFTTYIIMN 68 usage_01217.pdb 60 LFTTYIIMN 68 usage_01218.pdb 61 LFTTYIIMN 69 usage_01379.pdb 60 ISTMYTVTG 68 t Y m #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################