################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:35 2021 # Report_file: c_1481_60.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_01220.pdb # 2: usage_01414.pdb # 3: usage_02402.pdb # 4: usage_02622.pdb # 5: usage_02627.pdb # 6: usage_02861.pdb # 7: usage_02862.pdb # 8: usage_02863.pdb # # Length: 47 # Identity: 26/ 47 ( 55.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 47 ( 55.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 47 ( 6.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01220.pdb 1 -AWIALLLLVIFYVFAVMGTKLFAQSFPEWFGTLGASMYTLFQVMTL 46 usage_01414.pdb 1 -LSVIALMTLFFYIFAIMATQLFGERFPEWFGTLGESFYTLFQVMT- 45 usage_02402.pdb 1 -AWIALLLLVIFYVFAVMGTKLFAQSFPEWFGTLGASMYTLFQVMTL 46 usage_02622.pdb 1 -LSVIALMTLFFYIFAIMATQLFGERFPEWFGTLGESFYTLFQVM-- 44 usage_02627.pdb 1 -LSVIALMTLFFYIFAIMATQLFGERFPEWFGTLGESFYTLFQVMT- 45 usage_02861.pdb 1 IAWIALLLLVIFYVFAVMGTKLFAQSFPEWFGTLGASMYTLFQVMTL 47 usage_02862.pdb 1 IAWIALLLLVIFYVFAVMGTKLFAQSFPEWFGTLGASMYTLFQVMTL 47 usage_02863.pdb 1 IAWIALLLLVIFYVFAVMGTKLFAQSFPEWFGTLGASMYTLFQVMTL 47 L FY FA M T LF FPEWFGTLG S YTLFQVM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################