################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:27 2021 # Report_file: c_1367_90.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00108.pdb # 2: usage_00122.pdb # 3: usage_00183.pdb # 4: usage_00225.pdb # 5: usage_00226.pdb # 6: usage_00227.pdb # 7: usage_00228.pdb # 8: usage_00739.pdb # 9: usage_00740.pdb # 10: usage_00860.pdb # 11: usage_00931.pdb # 12: usage_01103.pdb # 13: usage_01114.pdb # 14: usage_01115.pdb # # Length: 44 # Identity: 16/ 44 ( 36.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 44 ( 40.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 44 ( 4.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00108.pdb 1 THYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKG- 43 usage_00122.pdb 1 TEFDRAIDAYSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEG- 43 usage_00183.pdb 1 -EFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEG- 42 usage_00225.pdb 1 TRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLG- 43 usage_00226.pdb 1 TRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLG- 43 usage_00227.pdb 1 TRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLG- 43 usage_00228.pdb 1 TRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLG- 43 usage_00739.pdb 1 TEFDHTLDFESLNPGEQILEKIISGMYLGEILRRVLLKMAEDAA 44 usage_00740.pdb 1 -EFDHTLDFESLNPGEQILEKIISGMYLGEILRRVLLKMAEDAA 43 usage_00860.pdb 1 TEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEE- 43 usage_00931.pdb 1 TEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEG- 43 usage_01103.pdb 1 -EFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEE- 42 usage_01114.pdb 1 TEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEG- 43 usage_01115.pdb 1 TEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEG- 43 fD D S NpG Q EK SGMY GE R L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################