################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:22 2021 # Report_file: c_0513_26.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00226.pdb # 2: usage_00339.pdb # 3: usage_00340.pdb # 4: usage_00604.pdb # 5: usage_00605.pdb # 6: usage_00606.pdb # # Length: 97 # Identity: 22/ 97 ( 22.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 81/ 97 ( 83.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 97 ( 14.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00226.pdb 1 DPVELVEKLIEEGFTLIHVVDLSNAIEN----SGENLPVLEKLSEFAE---HIQIGGGIR 53 usage_00339.pdb 1 DPVELGKFYSEIGIDELSFWDIT----ASVEKRKTMLELVEKVAEQ--IDIPFTVGGGIH 54 usage_00340.pdb 1 DPVELGKFYSEIGIDELSFWDIT----A---KRKTMLELVEKVAEQ--IDIPFTVGGGIH 51 usage_00604.pdb 1 DPVELGKFYSEIGIDELSFWDIT----ASVEKRKTMLELVEKVAEQ--IDIPITVGGGIY 54 usage_00605.pdb 1 DPVELGKFYSEIGIDELSFWDIT----ASVEKRKTMLELVEKVAEQ--IDIPITVGGGIY 54 usage_00606.pdb 1 DPVELGKFYSEIGIDELSFWDIT----ASVEKRKTMLELVEKVAEQ--IDIPITVGGGIY 54 DPVELgkfysEiGidelsfwDit a rktmLelvEKvaEq p tvGGGI usage_00226.pdb 54 SLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSLREID- 89 usage_00339.pdb 55 DFETASELILRGADKVEINTAAVENPSLITQIAQTFG 91 usage_00340.pdb 52 DFETASELILRGADKVEINTAAVENPSLITQIAQTFG 88 usage_00604.pdb 55 DFETASELILRGADKVEINTAAVENPSLITQIAQTFG 91 usage_00605.pdb 55 DFETASELILRGADKVEINTAAVENPSLITQIAQTFG 91 usage_00606.pdb 55 DFETASELILRGADKVEINTAAVENPSLITQIAQTFG 91 dfetAseLilrGadkveintaavEnPSlitqiaqtf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################