################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:38:40 2021
# Report_file: c_0905_77.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00345.pdb
#   2: usage_00545.pdb
#   3: usage_00546.pdb
#   4: usage_00551.pdb
#   5: usage_00552.pdb
#   6: usage_00598.pdb
#   7: usage_00727.pdb
#   8: usage_00789.pdb
#   9: usage_00790.pdb
#  10: usage_00791.pdb
#  11: usage_00833.pdb
#
# Length:         34
# Identity:       28/ 34 ( 82.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     28/ 34 ( 82.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            6/ 34 ( 17.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00345.pdb         1  -----GSGAFGTVYKGLWIPEGEKVKIPVAIKEL   29
usage_00545.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL   30
usage_00546.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL   30
usage_00551.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL   30
usage_00552.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL   30
usage_00598.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL   30
usage_00727.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL   30
usage_00789.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKE-   29
usage_00790.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKE-   29
usage_00791.pdb         1  ----LGSGAFGTVYKGLWIPEGEKVKIPVAIKEL   30
usage_00833.pdb         1  KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKEL   34
                                GSGAFGTVYKGLWIPEGEKVKIPVAIKE 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################