################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:45:19 2021 # Report_file: c_1380_160.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_01689.pdb # 2: usage_01690.pdb # 3: usage_01691.pdb # 4: usage_01692.pdb # 5: usage_01693.pdb # 6: usage_01694.pdb # 7: usage_01695.pdb # # Length: 90 # Identity: 21/ 90 ( 23.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 90 ( 37.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 56/ 90 ( 62.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01689.pdb 1 DRNGRKEILMIHTRNMPLGMSEEEKNKFLEEMADYTYGFVGADLAALVRESAMNALRRYL 60 usage_01690.pdb 1 -RNGRKEILMIHTRNMPLGMS-----EEEKNKF--------------------------- 27 usage_01691.pdb 1 -RNGRKEILMIHTRNMPLGMS-----EEEKNKF--------------------------- 27 usage_01692.pdb 1 -RNGRKEILMIHTRNMPLGMS-----EEEKNKF--------------------------- 27 usage_01693.pdb 1 -RNGRKEILMIHTRNMPLGMS-----EEEKNKF--------------------------- 27 usage_01694.pdb 1 -RNGRKEILMIHTRNMPLGMS-----EEEKNKF--------------------------- 27 usage_01695.pdb 1 -RNGRKEILMIHTRNMPLGMS-----EEEKNKF--------------------------- 27 RNGRKEILMIHTRNMPLGMS eeeknkf usage_01689.pdb 61 PEIDLDKPIPTEILEKMVVTEDDFKNALK- 89 usage_01690.pdb 28 ----------------------LEEMADYT 35 usage_01691.pdb 28 ----------------------LEEMADYT 35 usage_01692.pdb 28 ----------------------LEEMADYT 35 usage_01693.pdb 28 ----------------------LEEMADYT 35 usage_01694.pdb 28 ----------------------LEEMADYT 35 usage_01695.pdb 28 ----------------------LEEMADYT 35 leemAdy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################