################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:40 2021 # Report_file: c_1084_250.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_01405.pdb # 2: usage_01406.pdb # 3: usage_01407.pdb # 4: usage_01443.pdb # 5: usage_01866.pdb # # Length: 64 # Identity: 16/ 64 ( 25.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 64 ( 37.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 64 ( 15.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01405.pdb 1 TAEQIQARIAELGEQIGNDYR----TTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFM 56 usage_01406.pdb 1 TAEQIQARIAELGEQIGNDYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFM 60 usage_01407.pdb 1 TAEQIQARIAELGEQIGNDYRG-----Q-DLLLITVLKGAVLFVTDLARAIPVPTQFEFM 54 usage_01443.pdb 1 SEEQLQEKVKELALQIERDFEG-----E-EIVVIAVLKGSFVFAADLIRHIKNDVTIDFI 54 usage_01866.pdb 1 SREDISQKVKSLALQISEDYKK-----L-NPIFICVLKGGVYFFTDLTREIPFSVEINFV 54 Eqiq eL QI Dy I VLKG v F tDL R Ip F usage_01405.pdb 57 AVSS 60 usage_01406.pdb 61 AVSS 64 usage_01407.pdb 55 A--- 55 usage_01443.pdb 55 SASS 58 usage_01866.pdb 55 QAR- 57 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################