################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:40 2021 # Report_file: c_1417_58.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00084.pdb # 2: usage_00085.pdb # 3: usage_00086.pdb # 4: usage_00601.pdb # 5: usage_01048.pdb # 6: usage_01049.pdb # 7: usage_01112.pdb # 8: usage_01113.pdb # 9: usage_01217.pdb # 10: usage_01509.pdb # # Length: 58 # Identity: 14/ 58 ( 24.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 58 ( 34.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 58 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00084.pdb 1 RKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFS 58 usage_00085.pdb 1 -----IPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLF- 52 usage_00086.pdb 1 -----IPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFS 53 usage_00601.pdb 1 -----IPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFS 53 usage_01048.pdb 1 ---DIIEIAHALLGLMSLEEGKSFSRFSEPVLRLFESYSWPGNVRELQNVIRNIVVLN 55 usage_01049.pdb 1 ---DIIEIAHALLGLMSLEEGKSFSRFSEPVLRLFESYSWPGNVRELQNVIRNIVVLN 55 usage_01112.pdb 1 RKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFS 58 usage_01113.pdb 1 RKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFS 58 usage_01217.pdb 1 ---DVILLAEYFLKKFAKEYKKNCFELSEETKEYL-KQEWKGNVRELKNLIERAVILC 54 usage_01509.pdb 1 RKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFS 58 I A L s K f l sy W GNVREL NvI V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################