################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:28:50 2021 # Report_file: c_1410_40.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00251.pdb # 2: usage_00434.pdb # 3: usage_00788.pdb # 4: usage_00934.pdb # 5: usage_00971.pdb # 6: usage_01028.pdb # 7: usage_01141.pdb # 8: usage_01149.pdb # 9: usage_01248.pdb # 10: usage_01295.pdb # 11: usage_01334.pdb # 12: usage_01368.pdb # 13: usage_01482.pdb # 14: usage_01592.pdb # 15: usage_01596.pdb # # Length: 32 # Identity: 30/ 32 ( 93.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 32 ( 96.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 32 ( 3.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00251.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLAKREVWDQS 32 usage_00434.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_00788.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_00934.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_00971.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01028.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01141.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQ- 31 usage_01149.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01248.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01295.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01334.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01368.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01482.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01592.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 usage_01596.pdb 1 YPKLFSSVKWGQQEIVAKTYQLLARREVWDQS 32 YPKLFSSVKWGQQEIVAKTYQLLArREVWDQ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################