################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:40 2021 # Report_file: c_0726_17.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00020.pdb # 2: usage_00144.pdb # 3: usage_00145.pdb # 4: usage_00146.pdb # 5: usage_00147.pdb # 6: usage_00153.pdb # 7: usage_00158.pdb # 8: usage_00274.pdb # 9: usage_00275.pdb # # Length: 67 # Identity: 11/ 67 ( 16.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 67 ( 38.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 67 ( 28.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00020.pdb 1 PTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFV--SPTEIIAFSEAAKKFEEQGA 58 usage_00144.pdb 1 ----GQAVINGEFKEICLKDYRGKYVVLFFYPADFTFV-P-PTEIIAFSDQVEEFNSRNC 54 usage_00145.pdb 1 ----GQAVINGEFKEICLKDYRGKYVVLFFYPADFTFV-P-PTEIIAFSDQVEEFNSRNC 54 usage_00146.pdb 1 ----GQAVINGEFKEICLKDYRGKYVVLFFYPADFTFV-P-PTEIIAFSDQVEEFNSRNC 54 usage_00147.pdb 1 ----GQAVINGEFKEICLKDYRGKYVVLFFYPADFTFV-P-PTEIIAFSDQVEEFNSRNC 54 usage_00153.pdb 1 PEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTF---CPTEIIAFSDQVEEFNSRNC 57 usage_00158.pdb 1 -D--FELPD-TELKKVKLSALKGKVVVLAFYPAAFTQVF--RDSMAKFNQV-------NA 47 usage_00274.pdb 1 ----KTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFV-C-PTEIVAFSDAAKKFEDQGA 54 usage_00275.pdb 1 ----KTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFV-C-PTEIVAFSDAAKKFEDQGA 54 av g f e L y GKyVVL F P F f ptei aFs usage_00020.pdb 59 QVLFAST 65 usage_00144.pdb 55 QVIACST 61 usage_00145.pdb 55 QVIACS- 60 usage_00146.pdb 55 QVIA--- 58 usage_00147.pdb 55 QVIACST 61 usage_00153.pdb 58 QVIACST 64 usage_00158.pdb 48 VVLGIS- 53 usage_00274.pdb 55 QVLFAST 61 usage_00275.pdb 55 QVLFAST 61 qV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################