################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:56 2021 # Report_file: c_1233_101.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00606.pdb # 2: usage_00805.pdb # 3: usage_00806.pdb # 4: usage_01275.pdb # 5: usage_01276.pdb # 6: usage_01442.pdb # 7: usage_01443.pdb # 8: usage_01557.pdb # 9: usage_01558.pdb # 10: usage_01559.pdb # 11: usage_01560.pdb # 12: usage_01561.pdb # 13: usage_01562.pdb # # Length: 34 # Identity: 24/ 34 ( 70.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 34 ( 70.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 34 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00606.pdb 1 NPLTVEVPHICTKEEDQITVWGFHSDDKTQMKNL 34 usage_00805.pdb 1 NPVTVEVPYICSEGEDQITVWGFHSDDKTQMERL 34 usage_00806.pdb 1 NPVTVEVPYICSEGEDQITVWGFHSDDKTQMERL 34 usage_01275.pdb 1 NPLTIEVPYICTEGEDQITVWGFHSDNETQMAKL 34 usage_01276.pdb 1 NPLTIEVPYICTEGEDQITVWGFHSDNETQMAKL 34 usage_01442.pdb 1 NPLTVEVPHICTKEEDQITVWGFHSDDKTQMKNL 34 usage_01443.pdb 1 NPLTVEVPHICTKEEDQITVWGFHSDDKTQMKNL 34 usage_01557.pdb 1 NPLTIEVPYICTEGEDQITVWGFHSDNETQMAKL 34 usage_01558.pdb 1 NPLTIEVPYICTEGEDQITVWGFHSDNETQMAKL 34 usage_01559.pdb 1 NPLTIEVPYICTEGEDQITVWGFHSDNETQMAKL 34 usage_01560.pdb 1 NPLTIEVPYICTEGEDQITVWGFHSDNETQMAKL 34 usage_01561.pdb 1 NPLTIEVPYICTEGEDQITVWGFHSDNETQMAKL 34 usage_01562.pdb 1 NPLTIEVPYICTEGEDQITVWGFHSDNETQMAKL 34 NP T EVP IC EDQITVWGFHSD TQM L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################