################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:50 2021 # Report_file: c_1367_46.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00202.pdb # 2: usage_00378.pdb # 3: usage_00909.pdb # 4: usage_00973.pdb # 5: usage_01019.pdb # 6: usage_01028.pdb # 7: usage_01037.pdb # 8: usage_01048.pdb # # Length: 61 # Identity: 4/ 61 ( 6.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 61 ( 24.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 61 ( 6.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00202.pdb 1 NAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLN 60 usage_00378.pdb 1 NAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKY 60 usage_00909.pdb 1 NAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKD- 59 usage_00973.pdb 1 NAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEH 60 usage_01019.pdb 1 NAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKY 60 usage_01028.pdb 1 NAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKY 60 usage_01037.pdb 1 --FIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKY 58 usage_01048.pdb 1 TPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERN- 59 f R k P N sk Lg wk ek e l usage_00202.pdb - usage_00378.pdb - usage_00909.pdb - usage_00973.pdb - usage_01019.pdb - usage_01028.pdb 61 P 61 usage_01037.pdb - usage_01048.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################