################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:38 2021 # Report_file: c_0932_136.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00109.pdb # 2: usage_00110.pdb # 3: usage_00152.pdb # 4: usage_00274.pdb # 5: usage_00465.pdb # 6: usage_00505.pdb # 7: usage_00908.pdb # 8: usage_01099.pdb # 9: usage_01100.pdb # 10: usage_01115.pdb # 11: usage_02132.pdb # # Length: 41 # Identity: 21/ 41 ( 51.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 41 ( 51.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 41 ( 14.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00109.pdb 1 RPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIRE-- 39 usage_00110.pdb 1 RPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREI- 40 usage_00152.pdb 1 RPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIRE-- 39 usage_00274.pdb 1 RPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREI- 40 usage_00465.pdb 1 ----MQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIRE-- 35 usage_00505.pdb 1 RPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREI- 40 usage_00908.pdb 1 NAAPIQLPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIEEIE 41 usage_01099.pdb 1 RPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREI- 40 usage_01100.pdb 1 RPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREI- 40 usage_01115.pdb 1 ----IQLPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIEEIE 37 usage_02132.pdb 1 RPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIRE-- 39 QLPIG ED F IID MK Y NDLGT I E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################