################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:17:05 2021
# Report_file: c_1260_47.html
################################################################################################
#====================================
# Aligned_structures: 17
#   1: usage_00207.pdb
#   2: usage_00208.pdb
#   3: usage_00209.pdb
#   4: usage_00489.pdb
#   5: usage_00490.pdb
#   6: usage_00491.pdb
#   7: usage_00492.pdb
#   8: usage_00493.pdb
#   9: usage_00494.pdb
#  10: usage_00495.pdb
#  11: usage_00496.pdb
#  12: usage_00497.pdb
#  13: usage_00849.pdb
#  14: usage_00850.pdb
#  15: usage_01257.pdb
#  16: usage_01258.pdb
#  17: usage_01259.pdb
#
# Length:         32
# Identity:       11/ 32 ( 34.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     11/ 32 ( 34.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            1/ 32 (  3.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00207.pdb         1  NYILVGEI-RDKEGNVAFQAMQTGHSVMATFH   31
usage_00208.pdb         1  NYILVGEI-RDKEGNVAFQAMQTGHSVMATFH   31
usage_00209.pdb         1  NYILVGEI-RDKEGNVAFQAMQTGHSVMATFH   31
usage_00489.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00490.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00491.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00492.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00493.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00494.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00495.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00496.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00497.pdb         1  DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH   32
usage_00849.pdb         1  DIILVGEMRDLETIRLALTAAETGHLVFGTLH   32
usage_00850.pdb         1  DIILVGEMRDLETIRLALTAAETGHLVFGTLH   32
usage_01257.pdb         1  DIIMVGEIRDSETAKIATEAALTGHLVIATLH   32
usage_01258.pdb         1  DIIMVGEIRDSETAKIATEAALTGHLVIATLH   32
usage_01259.pdb         1  DIIMVGEIRDSETAKIATEAALTGHLVIATLH   32
                               VGE         A  A  TGH V  T H


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################