################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:56 2021 # Report_file: c_1081_3.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00009.pdb # 2: usage_00227.pdb # 3: usage_00564.pdb # 4: usage_00565.pdb # 5: usage_00566.pdb # 6: usage_00630.pdb # 7: usage_00631.pdb # 8: usage_00812.pdb # # Length: 74 # Identity: 22/ 74 ( 29.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/ 74 ( 82.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 74 ( 17.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00009.pdb 1 TLAQMTDKAIELLSKNEKGFFLQVEGAS--------ANPCGQIGETVDLDEAVQRALEFA 52 usage_00227.pdb 1 SLAEMTEVAVRLLSRNPQGFYLFVEGGR-I---DQGHTAYLALTEAVMFDSAIEKASQLT 56 usage_00564.pdb 1 TLAQMTDKAIELLSKNEKGFFLQVEGASI-------ANPCGQIGETVDLDEAVQRALEFA 53 usage_00565.pdb 1 TLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHA-ANPCGQIGETVDLDEAVQRALEFA 59 usage_00566.pdb 1 TLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHA-ANPCGQIGETVDLDEAVQRALEFA 59 usage_00630.pdb 1 TLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHA-ANPCGQIGETVDLDEAVQRALEFA 59 usage_00631.pdb 1 TLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHA-ANPCGQIGETVDLDEAVQRALEFA 59 usage_00812.pdb 1 TLAQMTDKAIELLSKNEKGFFLQVEGASI-------ANPCGQIGETVDLDEAVQRALEFA 53 tLAqMTdkAieLLSkNekGFfLqVEGas anpcgqigEtVdlDeAvqrAlefa usage_00009.pdb 53 KKEGNTLVIVT--- 63 usage_00227.pdb 57 NE-KDTLTLIT--- 66 usage_00564.pdb 54 KKEGNTLVIVT--- 64 usage_00565.pdb 60 KKEGNTLVIVT--- 70 usage_00566.pdb 60 KKEGNTLVIVT--- 70 usage_00630.pdb 60 KKEGNTLVIV---- 69 usage_00631.pdb 60 KKEGNTLVIVTADH 73 usage_00812.pdb 54 KKEGNTLVIVT--- 64 kk gnTLviv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################