################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:33 2021 # Report_file: c_1461_45.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_01878.pdb # 2: usage_01960.pdb # 3: usage_01961.pdb # 4: usage_01966.pdb # 5: usage_02070.pdb # 6: usage_02071.pdb # 7: usage_02072.pdb # 8: usage_02514.pdb # # Length: 35 # Identity: 5/ 35 ( 14.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 35 ( 20.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 35 ( 22.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01878.pdb 1 ---EYWPRD--TTCSSCQAFLANLDEFAEDIFL-- 28 usage_01960.pdb 1 TWIEYWPRD--TTCSSCQAFLANLDEFAEDIFLNG 33 usage_01961.pdb 1 TWIEYWPRD--TTCSSCQAFLANLDEFAEDIF--- 30 usage_01966.pdb 1 TWIEYWPRD--TTCSSCQAFLANLDEFAEDIFLNG 33 usage_02070.pdb 1 TWIEYWPRD--TTCSSCQAFLANLDEFAEDIFLN- 32 usage_02071.pdb 1 TWIEYWPRD--TTCSSCQAFLANLDEFAEDIFLN- 32 usage_02072.pdb 1 TWIERWPHEDECQEEEFQKLCDDFAQFSYTLTEF- 34 usage_02514.pdb 1 TWVEHWPEEDECQDEENQKQCQDLGAFTESMVVF- 34 E WP Q l F e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################