################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:55 2021 # Report_file: c_1491_12.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00112.pdb # 2: usage_00857.pdb # 3: usage_03006.pdb # 4: usage_03162.pdb # 5: usage_03177.pdb # # Length: 69 # Identity: 64/ 69 ( 92.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 65/ 69 ( 94.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 69 ( 5.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00112.pdb 1 ----WLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVLK 56 usage_00857.pdb 1 TLDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVIK 60 usage_03006.pdb 1 -LDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVIK 59 usage_03162.pdb 1 TLDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVIK 60 usage_03177.pdb 1 -LDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLVIK 59 WLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDSGLViK usage_00112.pdb 57 TLVDLFRNG 65 usage_00857.pdb 61 TLVDLFRNG 69 usage_03006.pdb 60 TLVDLFRNG 68 usage_03162.pdb 61 TLVDLFRNG 69 usage_03177.pdb 60 TLVDLFRNG 68 TLVDLFRNG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################