################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:42 2021 # Report_file: c_0900_148.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00012.pdb # 2: usage_00013.pdb # 3: usage_00014.pdb # 4: usage_00320.pdb # 5: usage_00479.pdb # 6: usage_00480.pdb # 7: usage_00481.pdb # 8: usage_01293.pdb # 9: usage_01294.pdb # # Length: 65 # Identity: 40/ 65 ( 61.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 65 ( 61.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 65 ( 9.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 --MTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGDRIFT 58 usage_00013.pdb 1 --MTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGDRIFT 58 usage_00014.pdb 1 EEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGDRIFT 60 usage_00320.pdb 1 --MTMHFRMEGCVDGHKFVIEGNGNGNPFKGKQFINLCVIEGGPLPFSEDILSAAFNRLF 58 usage_00479.pdb 1 --MTMHFRMEGCVDGHKFVIEGNGNGNPFKGKQFINLCVIEGGPLPFSEDILSAAFNRLF 58 usage_00480.pdb 1 --MTMHFRMEGCVDGHKFVIEGNGNGNPFKGKQFINLCVIEGGPLPFSEDILSAAFNRLF 58 usage_00481.pdb 1 --MTMHFRMEGCVDGHKFVIEGNGNGNPFKGKQFINLCVIEGGPLPFSEDILSAAFNRLF 58 usage_01293.pdb 1 EEMTMKYHME-GVNGHKFVITGEGIGYPFKGKQTINL-VIEGGPLPFSEDILSAG-DRIF 57 usage_01294.pdb 1 --MTMKYHME-GVNGHKFVITGEGIGYPFKGKQTINL-VIEGGPLPFSEDILSAG-DRIF 55 MTM ME V GHKFVI G G G PFKGKQ INL VIEGGPLPFSEDILSA usage_00012.pdb 59 EYPQ- 62 usage_00013.pdb 59 EYPQ- 62 usage_00014.pdb 61 EYPQ- 64 usage_00320.pdb 59 TEYPE 63 usage_00479.pdb 59 TEYPE 63 usage_00480.pdb 59 TEYPE 63 usage_00481.pdb 59 TEYPE 63 usage_01293.pdb 58 TEYPQ 62 usage_01294.pdb 56 TEYPQ 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################