################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:19 2021 # Report_file: c_1221_61.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_01213.pdb # 2: usage_01394.pdb # 3: usage_01395.pdb # 4: usage_01396.pdb # 5: usage_01397.pdb # 6: usage_01398.pdb # 7: usage_02188.pdb # 8: usage_02190.pdb # 9: usage_02191.pdb # 10: usage_02193.pdb # 11: usage_02194.pdb # 12: usage_02195.pdb # # Length: 44 # Identity: 17/ 44 ( 38.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 44 ( 84.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 44 ( 15.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01213.pdb 1 YINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDG 44 usage_01394.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASR---- 40 usage_01395.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 44 usage_01396.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 44 usage_01397.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 44 usage_01398.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 44 usage_02188.pdb 1 -YNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 43 usage_02190.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 44 usage_02191.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 44 usage_02193.pdb 1 ---IGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 41 usage_02194.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 44 usage_02195.pdb 1 YYNIGIAVDTPDGLNVFVIKDADRKSMVEISAEISDKASRAREN 44 IGiAVDTPdGLnVfViKDadrKsmvEiSaEisdkasr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################