################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:13 2021 # Report_file: c_0821_37.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00077.pdb # 2: usage_00557.pdb # 3: usage_00674.pdb # 4: usage_00675.pdb # 5: usage_00695.pdb # 6: usage_00916.pdb # 7: usage_00917.pdb # 8: usage_00918.pdb # 9: usage_01163.pdb # 10: usage_01406.pdb # 11: usage_01407.pdb # # Length: 69 # Identity: 68/ 69 ( 98.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 68/ 69 ( 98.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 69 ( 1.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00077.pdb 1 -PIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 59 usage_00557.pdb 1 KPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 60 usage_00674.pdb 1 KPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 60 usage_00675.pdb 1 KPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 60 usage_00695.pdb 1 KPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 60 usage_00916.pdb 1 -PIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 59 usage_00917.pdb 1 KPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 60 usage_00918.pdb 1 -PIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 59 usage_01163.pdb 1 KPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 60 usage_01406.pdb 1 KPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 60 usage_01407.pdb 1 KPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE 60 PIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKE usage_00077.pdb 60 KITVTVGVA 68 usage_00557.pdb 61 KITVTVGVA 69 usage_00674.pdb 61 KITVTVGVA 69 usage_00675.pdb 61 KITVTVGVA 69 usage_00695.pdb 61 KITVTVGVA 69 usage_00916.pdb 60 KITVTVGVA 68 usage_00917.pdb 61 KITVTVGVA 69 usage_00918.pdb 60 KITVTVGVA 68 usage_01163.pdb 61 KITVTVGVA 69 usage_01406.pdb 61 KITVTVGVA 69 usage_01407.pdb 61 KITVTVGVA 69 KITVTVGVA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################