################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:14:00 2021 # Report_file: c_1208_87.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00169.pdb # 2: usage_01117.pdb # 3: usage_01118.pdb # 4: usage_01119.pdb # 5: usage_01120.pdb # 6: usage_01121.pdb # 7: usage_01122.pdb # 8: usage_01123.pdb # 9: usage_01124.pdb # 10: usage_01125.pdb # 11: usage_01170.pdb # 12: usage_01969.pdb # 13: usage_02019.pdb # 14: usage_02475.pdb # # Length: 32 # Identity: 13/ 32 ( 40.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 32 ( 84.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 32 ( 12.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00169.pdb 1 FFSKLGESG-SYVPRAIMVDLEPSVIDNVKAT 31 usage_01117.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01118.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01119.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01120.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01121.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01122.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01123.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01124.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01125.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01170.pdb 1 YYNEAA--GNKYVPRAILVDLEPGTMDSVRS- 29 usage_01969.pdb 1 YYNEAS--SHKYVPRAILVDLEPGTMDSVRS- 29 usage_02019.pdb 1 YYNEAT--GNKYVPRAILVDLEPGTMDSVRSG 30 usage_02475.pdb 1 YYNEAT--GNKYVPRAILVDLEPGTMDSVRSG 30 yynea g kYVPRAIlVDLEPgtmDsVrs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################