################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:16:39 2021
# Report_file: c_0719_20.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00098.pdb
#   2: usage_00099.pdb
#   3: usage_00106.pdb
#   4: usage_00107.pdb
#   5: usage_00108.pdb
#
# Length:         70
# Identity:       10/ 70 ( 14.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     20/ 70 ( 28.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           25/ 70 ( 35.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00098.pdb         1  MTIAVTGSIATDHLMRFPGRFSEQLLPEHLHKV--SLSFLVDDLVMHRGGVAGNMAFAIG   58
usage_00099.pdb         1  KKILVLGGAHIDRRGMIETET------------APG-ASNPGSWMEEAGGGGFNAARNLS   47
usage_00106.pdb         1  --ILCFGEALIDLAQPLVKKG-------------------PRAFLQCAGGAPANVAVAVA   39
usage_00107.pdb         1  -TILCFGEALIDLAQPLVKKG-------------------PRAFLQCAGGAPANVAVAVA   40
usage_00108.pdb         1  -TILCFGEALIDLAQPL-----------------------PRAFLQCAGGAPANVAVAVA   36
                             Il  G a iD                            p      aGG   N A a  

usage_00098.pdb        59  VLGGEVALVG   68
usage_00099.pdb        48  RLGFEVRIIA   57
usage_00106.pdb        40  RLGGAVQFVG   49
usage_00107.pdb        41  RLGGAVQFVG   50
usage_00108.pdb        37  RLGGAVQFVG   46
                           rLGg V  vg


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################