################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:15:55 2021 # Report_file: c_0516_40.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00050.pdb # 2: usage_00202.pdb # 3: usage_00241.pdb # 4: usage_00242.pdb # 5: usage_00270.pdb # # Length: 88 # Identity: 25/ 88 ( 28.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 88 ( 37.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 88 ( 12.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00050.pdb 1 --HERK-AAAQEA------EAFIALPGGYGTE-ELL-EITWSQLGIHKKTVGLLNVDGYY 49 usage_00202.pdb 1 --HQRK-AEAKHS------DAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYY 51 usage_00241.pdb 1 -MHIRKRRMAELG------DGFIAMPGGAGTLEELFEVWTWQQLGIHQKPVALYDVDGFW 53 usage_00242.pdb 1 -MHIRKRRMAELG------DGFIAMPGGAGTLEELFEVWTWQQLGIHQKPVALYDVDGFW 53 usage_00270.pdb 1 DMHTRKKMMAEEVISGGPGSGFIGLSGGYGTMEEVFEVITWNQLGIHTKGICLLNVEGYW 60 H RK A FIa pGG GT El v TW QLGIH K v L VdG usage_00050.pdb 50 NNLLALFDTGVEEGFIKPGARNIVVSAP 77 usage_00202.pdb 52 NSLLSFIDKAVEEGFISPTAREIIVSAP 79 usage_00241.pdb 54 QPLLEMLEQMTQRGFIKRDFFECLIVES 81 usage_00242.pdb 54 QPLLEMLEQMTQRGFIKRDFFECLIVES 81 usage_00270.pdb 61 DGILQWINMAAAQGFVQPGNETIVVSAG 88 lL GFi #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################