################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:23:00 2021 # Report_file: c_1270_9.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00065.pdb # 2: usage_00168.pdb # 3: usage_00315.pdb # 4: usage_00416.pdb # 5: usage_00483.pdb # 6: usage_00520.pdb # 7: usage_00521.pdb # 8: usage_00522.pdb # 9: usage_00538.pdb # 10: usage_00544.pdb # 11: usage_00972.pdb # 12: usage_00973.pdb # 13: usage_00974.pdb # 14: usage_01118.pdb # 15: usage_01207.pdb # # Length: 59 # Identity: 5/ 59 ( 8.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 59 ( 32.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/ 59 ( 44.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00065.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_00168.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYT-------EIPE--FPIAPEIALELLMAANFLD 50 usage_00315.pdb 1 NRVEINDVEPEVFKE------CFI----YT---GKAPNLD------KADDLLAAADKY- 39 usage_00416.pdb 1 GRIELKQFDSHILEKAVEYLNYNLKYSGVSEDDDEIPE--FEIPTEMSLELLLAADYLS 57 usage_00483.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_00520.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_00521.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_00522.pdb 1 -EVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 52 usage_00538.pdb 1 -EVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFLD 53 usage_00544.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_00972.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_00973.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_00974.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_01118.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 usage_01207.pdb 1 NEVNFREIPSHVLSKVCMYFTYKVRYTNSS---TEIPE--FPIAPEIALELLMAANFL- 53 v shvl k y eiPe aleLL AA l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################