################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:21 2021 # Report_file: c_1420_21.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00001.pdb # 2: usage_00002.pdb # 3: usage_00127.pdb # 4: usage_00212.pdb # 5: usage_00213.pdb # 6: usage_00214.pdb # 7: usage_00234.pdb # 8: usage_01140.pdb # # Length: 68 # Identity: 34/ 68 ( 50.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/ 68 ( 89.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 68 ( 10.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 DYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYL-PGSHRKVIKNVAEVKEYVSE 59 usage_00002.pdb 1 DYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYL-PGSHRKVIKNVAEVKEYVSE 59 usage_00127.pdb 1 ----QQFLNLMEKLNENIEILSSPWIQVYNNFPA-LLDYFPGTHNKLLKNVAFMKSYILE 55 usage_00212.pdb 1 DYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYL-PGSHRKVIKNVAEVKEYVSE 59 usage_00213.pdb 1 DYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYL-PGSHRKVIKNVAEVKEYVSE 59 usage_00214.pdb 1 DYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYL-PGSHRKVIKNVAEVKEYVSE 59 usage_00234.pdb 1 -----KFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYL-PGSHRKVIKNVAEVKEYVSE 54 usage_01140.pdb 1 ----EKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYL-PGSHRKVIKNVAEVKEYVSE 55 kFLrLMylfNENfhlLStPWlQlYNNFPs Lhyl PGsHrKviKNVAevKeYvsE usage_00001.pdb 60 RVKEHHQS 67 usage_00002.pdb 60 RVKEHHQS 67 usage_00127.pdb 56 KVKEHQES 63 usage_00212.pdb 60 RVKEHHQS 67 usage_00213.pdb 60 RVKEHHQS 67 usage_00214.pdb 60 RVKEHHQS 67 usage_00234.pdb 55 RVKEHHQS 62 usage_01140.pdb 56 RVKEHHQS 63 rVKEHhqS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################