################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:52:26 2021 # Report_file: c_1059_13.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00018.pdb # 2: usage_00047.pdb # 3: usage_00050.pdb # 4: usage_00052.pdb # 5: usage_00059.pdb # 6: usage_00069.pdb # 7: usage_00070.pdb # 8: usage_00074.pdb # 9: usage_00088.pdb # 10: usage_00115.pdb # 11: usage_00132.pdb # 12: usage_00221.pdb # # Length: 31 # Identity: 0/ 31 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 31 ( 51.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 31 ( 22.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 CLYCGSVFLRYLT---TGAIMDIIIIDS--- 25 usage_00047.pdb 1 -AEDAATYYCQQYSGYPLTFGAGTKLELKRA 30 usage_00050.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 usage_00052.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 usage_00059.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 usage_00069.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 usage_00070.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 usage_00074.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 usage_00088.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 usage_00115.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 usage_00132.pdb 1 -SEDFADYYCLQYASSPYTFGGGTKLEILRA 30 usage_00221.pdb 1 EAEDAATYYCQQWSSHPQTFGGGTKLEILRA 31 ed a yyc q p tfg gtkle #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################