################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:55 2021 # Report_file: c_0833_18.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00097.pdb # 2: usage_00109.pdb # 3: usage_00201.pdb # 4: usage_00224.pdb # 5: usage_00287.pdb # 6: usage_00288.pdb # 7: usage_00384.pdb # 8: usage_00385.pdb # # Length: 62 # Identity: 4/ 62 ( 6.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 62 ( 14.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 62 ( 9.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00097.pdb 1 AAEGVLALRPDILIGTEEM--GPPPVLKQLEGAGVRVETLSAK-PDLEALESNLKKLGDW 57 usage_00109.pdb 1 SSEGILSLRPDSVITWQDA--GPQIVLDQLRAQKVNVVTLPRVPATLEQMYANIRQLAKT 58 usage_00201.pdb 1 NKEELIKAKPDLILAHESQKNSAGKVLKSLKDKGVKVVYVKDA-QSIDETYDTFKSIGQL 59 usage_00224.pdb 1 SAEGLLSLRPDLVLASAEA--GPPTAIAQVKGAGVTVTTFDER-HDVESVRAKITGVAQA 57 usage_00287.pdb 1 NLERIVALKPDLVIAWRGG--NAERQVDQLASLGIKV-WVD-A-TSIEQIANALRQLAPW 55 usage_00288.pdb 1 NLERIVALKPDLVIAWRGG--NAERQVDQLASLGIKV-WVD-A-TSIEQIANALRQLAPW 55 usage_00384.pdb 1 NLERIVALKPDLVIAWRGG--NAERQVDQLASLGIKVMWVD-A-TSIEQIANALRQLAPW 56 usage_00385.pdb 1 NLERIVALKPDLVIAWRGG--NAERQVDQLASLGIKVMWVD-A-TSIEQIANALRQLAPW 56 E l PD ql g V e usage_00097.pdb 58 L- 58 usage_00109.pdb 59 LQ 60 usage_00201.pdb 60 TD 61 usage_00224.pdb 58 LD 59 usage_00287.pdb 56 S- 56 usage_00288.pdb 56 S- 56 usage_00384.pdb 57 S- 57 usage_00385.pdb 57 S- 57 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################