################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:52 2021 # Report_file: c_0847_29.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00035.pdb # 2: usage_00536.pdb # 3: usage_00537.pdb # 4: usage_00538.pdb # 5: usage_00539.pdb # 6: usage_00826.pdb # # Length: 81 # Identity: 4/ 81 ( 4.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 81 ( 25.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/ 81 ( 39.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00035.pdb 1 SYSSSVAQGIAAVASAVNSFNSQCPSTKIVLVGYSQGGEIMDVALCGGGDPNQGYTNTAV 60 usage_00536.pdb 1 -----SVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASN------------- 42 usage_00537.pdb 1 -------QNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASN------------- 40 usage_00538.pdb 1 -----SVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASN------------- 42 usage_00539.pdb 1 -------QNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASN------------- 40 usage_00826.pdb 1 --------DLARGVSVVETTLRAHPNLKGIFGVSQVGGPAVAKVLNT------------- 39 a s l cPntK vlggysqG v a usage_00035.pdb 61 QL-SSS----AVNMVKAAIFM 76 usage_00536.pdb 43 -LDAAT----MSKISAVVLFG 58 usage_00537.pdb 41 -LDAAT----MSKISAVVLFG 56 usage_00538.pdb 43 -LDAAT----MSKISAVVLFG 58 usage_00539.pdb 41 -LDAAT----MSKISAVVLFG 56 usage_00826.pdb 40 -R----EFGAKG-KLEVLAF- 53 l v F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################