################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:45 2021 # Report_file: c_0783_18.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00030.pdb # 2: usage_00043.pdb # 3: usage_00050.pdb # 4: usage_00051.pdb # 5: usage_00056.pdb # 6: usage_00057.pdb # 7: usage_00083.pdb # 8: usage_00142.pdb # # Length: 65 # Identity: 23/ 65 ( 35.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 65 ( 44.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 65 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00030.pdb 1 RVFRS-ADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAI 59 usage_00043.pdb 1 --FRSADTHNADDYPTVAAVKYMGELLEKKSGGKHKIKVFNKQALGSEKETIDQVKIGAL 58 usage_00050.pdb 1 --FRS-ADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAI 57 usage_00051.pdb 1 --FRS-ADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAI 57 usage_00056.pdb 1 --FRS-ADVHPADYPTVEAVKFMGKQLAAASGGKLGVKVFPNGALGSEKDTIEQLKIGAL 57 usage_00057.pdb 1 --FRS-ADVHPADYPTVEAVKFMGKQLAAASGGKLGVKVFPNGALGSEKDTIEQLKIGAL 57 usage_00083.pdb 1 --YRS-ADVQPADYPTVKAVQS-SDELNKETNGKISIKVFPNSQLGSEKDTIEQVKLGAL 56 usage_00142.pdb 1 --FRSADTHNADDYPTVAAVKYMGELLEKKSGGKHKIKVFNKQALGSEKETIDQVKIGAL 58 fRS PT AVk g L gGK KVF aLGSEK T Q iGA usage_00030.pdb 60 DMARV 64 usage_00043.pdb 59 DFTRV 63 usage_00050.pdb 58 DMARV 62 usage_00051.pdb 58 DMARV 62 usage_00056.pdb 58 DMMRI 62 usage_00057.pdb 58 DMMRI 62 usage_00083.pdb 57 DFIR- 60 usage_00142.pdb 59 DFTRV 63 D R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################