################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:50 2021 # Report_file: c_1105_35.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00202.pdb # 2: usage_00250.pdb # 3: usage_00559.pdb # 4: usage_00560.pdb # 5: usage_00561.pdb # 6: usage_00562.pdb # 7: usage_00978.pdb # 8: usage_00979.pdb # # Length: 72 # Identity: 29/ 72 ( 40.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 72 ( 40.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 72 ( 8.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00202.pdb 1 -MKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQL 59 usage_00250.pdb 1 --KDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQL 58 usage_00559.pdb 1 ALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSL 60 usage_00560.pdb 1 ALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSL 60 usage_00561.pdb 1 ALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQL-QYIASPVDQTAHMTSL 59 usage_00562.pdb 1 ALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQL-QYIASPVDQTAHMTSL 59 usage_00978.pdb 1 ALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSL 60 usage_00979.pdb 1 ALRELQDIKKEIENKAPGSQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSL 60 LQ IK E APGS QT RLA Q DPT DL L QY S H L usage_00202.pdb 60 DSLISEAETRG- 70 usage_00250.pdb 59 DSLISEAETR-G 69 usage_00559.pdb 61 TAAIAAAEAA-N 71 usage_00560.pdb 61 TAAIAAAEA--- 69 usage_00561.pdb 60 TAAIAAAEAA-- 69 usage_00562.pdb 60 TAAIAAAEAA-- 69 usage_00978.pdb 61 TAAIAAAEAA-N 71 usage_00979.pdb 61 TAAIAAAEAA-N 71 I AE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################