################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 03:40:05 2021
# Report_file: c_1307_108.html
################################################################################################
#====================================
# Aligned_structures: 27
#   1: usage_00013.pdb
#   2: usage_00223.pdb
#   3: usage_00224.pdb
#   4: usage_00225.pdb
#   5: usage_00226.pdb
#   6: usage_00227.pdb
#   7: usage_00272.pdb
#   8: usage_00273.pdb
#   9: usage_00333.pdb
#  10: usage_00334.pdb
#  11: usage_00476.pdb
#  12: usage_00661.pdb
#  13: usage_00662.pdb
#  14: usage_00705.pdb
#  15: usage_00706.pdb
#  16: usage_00707.pdb
#  17: usage_01390.pdb
#  18: usage_01755.pdb
#  19: usage_01756.pdb
#  20: usage_01757.pdb
#  21: usage_01849.pdb
#  22: usage_01850.pdb
#  23: usage_02226.pdb
#  24: usage_02331.pdb
#  25: usage_02572.pdb
#  26: usage_02582.pdb
#  27: usage_02583.pdb
#
# Length:         30
# Identity:       18/ 30 ( 60.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     18/ 30 ( 60.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            1/ 30 (  3.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00013.pdb         1  AFLELFILRLAYRSKPGEGKLIFCSGLVLH   30
usage_00223.pdb         1  AFLELFVLRLAYRSNPVEGKLIFCNGVVLH   30
usage_00224.pdb         1  AFLELFVLRLAYRSNPVEGKLIFCNGVVLH   30
usage_00225.pdb         1  AFLELFVLRLAYRSNPVEGKLIFCNGVVLH   30
usage_00226.pdb         1  AFLELFVLRLAYRSNPVEGKLIFCNGVVLH   30
usage_00227.pdb         1  -FLELFVLRLAYRSNPVEGKLIFCNGVVLH   29
usage_00272.pdb         1  ASLELFVLRLAYRARIDDTKLIFCNGTVLH   30
usage_00273.pdb         1  -SLELFVLRLAYRARIDDTKLIFCNGTVLH   29
usage_00333.pdb         1  AFLELFILRLAYRSKPGEGKLIFCSGLVLH   30
usage_00334.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_00476.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_00661.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_00662.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_00705.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_00706.pdb         1  -FLELFIWRLAYRSKPGEGKLIFCSGLVLH   29
usage_00707.pdb         1  -FLELFIWRLAYRSKPGEGKLIFCSGLVLH   29
usage_01390.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_01755.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_01756.pdb         1  -FLELFIWRLAYRSKPGEGKLIFCSGLVLH   29
usage_01757.pdb         1  -FLELFIWRLAYRSKPGEGKLIFCSGLVLH   29
usage_01849.pdb         1  AFLELFILRLAYRSKPGEGKLIFCSGLVLH   30
usage_01850.pdb         1  AFLELFILRLAYRSKPGEGKLIFCSGLVLH   30
usage_02226.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_02331.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_02572.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
usage_02582.pdb         1  AFLELFILRLAYRSKPGEGKLIFCSGLVLH   30
usage_02583.pdb         1  -FLELFILRLAYRSKPGEGKLIFCSGLVLH   29
                             LELF  RLAYR      KLIFC G VLH


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################