################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:52 2021 # Report_file: c_1212_72.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00445.pdb # 2: usage_00446.pdb # 3: usage_00447.pdb # 4: usage_01009.pdb # 5: usage_01391.pdb # 6: usage_01412.pdb # 7: usage_01415.pdb # 8: usage_01416.pdb # 9: usage_01417.pdb # 10: usage_01418.pdb # # Length: 57 # Identity: 26/ 57 ( 45.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 57 ( 45.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/ 57 ( 54.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00445.pdb 1 FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKA 57 usage_00446.pdb 1 FARVCEVDNELRICARDKEVGNLYDM------------------------------- 26 usage_00447.pdb 1 FARVCEVDNELRICARDKEVGNLYDM------------------------------- 26 usage_01009.pdb 1 FARVCEVDNELRICARDKEVGNLYDM------------------------------- 26 usage_01391.pdb 1 FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQH----------------- 40 usage_01412.pdb 1 FARVCEVDNELRICARDKEVGNLYDM------------------------------- 26 usage_01415.pdb 1 FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR---------------------- 35 usage_01416.pdb 1 FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR---------------------- 35 usage_01417.pdb 1 FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR---------------------- 35 usage_01418.pdb 1 FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR---------------------- 35 FARVCEVDNELRICARDKEVGNLYDM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################