################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:24:28 2021 # Report_file: c_0612_56.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00170.pdb # 2: usage_00171.pdb # 3: usage_00172.pdb # 4: usage_00174.pdb # 5: usage_00175.pdb # 6: usage_00176.pdb # 7: usage_00220.pdb # 8: usage_00221.pdb # 9: usage_00222.pdb # 10: usage_00250.pdb # # Length: 70 # Identity: 69/ 70 ( 98.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 69/ 70 ( 98.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 70 ( 1.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00170.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00171.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00172.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00174.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00175.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00176.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00220.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00221.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00222.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 usage_00250.pdb 1 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL 60 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAASINERPVIFALSNPTAQAECTAEEAYTL usage_00170.pdb 61 TEGRCLFAS- 69 usage_00171.pdb 61 TEGRCLFASG 70 usage_00172.pdb 61 TEGRCLFAS- 69 usage_00174.pdb 61 TEGRCLFASG 70 usage_00175.pdb 61 TEGRCLFASG 70 usage_00176.pdb 61 TEGRCLFASG 70 usage_00220.pdb 61 TEGRCLFAS- 69 usage_00221.pdb 61 TEGRCLFAS- 69 usage_00222.pdb 61 TEGRCLFAS- 69 usage_00250.pdb 61 TEGRCLFAS- 69 TEGRCLFAS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################