################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:11:46 2021
# Report_file: c_0384_5.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00002.pdb
#   2: usage_00043.pdb
#   3: usage_00046.pdb
#   4: usage_00063.pdb
#   5: usage_00091.pdb
#
# Length:         94
# Identity:        5/ 94 (  5.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     38/ 94 ( 40.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           47/ 94 ( 50.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00002.pdb         1  TVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVRE   60
usage_00043.pdb         1  --------------------FAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVRE   40
usage_00046.pdb         1  --------------------FAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVRE   40
usage_00063.pdb         1  --------------------FNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVRE   40
usage_00091.pdb         1  --------------------KAKEVLKGYVL--EGTLTAEKTTLVVKE--GTVTLSKNIS   36
                                               fay ladGteL  twt egnKl gkfKr  ng eL  vre

usage_00002.pdb        61  ISGNELIQTYTYEGVEAK-RI-------------   80
usage_00043.pdb        41  ISGNELIQTYTYEGVEAKRIFKKE----------   64
usage_00046.pdb        41  ISGNELIQTYTYEGVEAKRIFKKE----------   64
usage_00063.pdb        41  IIGDELVQTYVYEGVEAKRIFKK-----------   63
usage_00091.pdb        37  KS---GEVSVELN-------DTDSSAATKKTAAW   60
                           is   l qty ye                     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################