################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:25:31 2021
# Report_file: c_0848_87.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00164.pdb
#   2: usage_00298.pdb
#   3: usage_00299.pdb
#   4: usage_00352.pdb
#   5: usage_00353.pdb
#   6: usage_00450.pdb
#   7: usage_00451.pdb
#   8: usage_00681.pdb
#   9: usage_00705.pdb
#  10: usage_00706.pdb
#
# Length:         49
# Identity:       15/ 49 ( 30.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     17/ 49 ( 34.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           12/ 49 ( 24.5%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00164.pdb         1  -----------LLPLTKEDIDTLILGCTHYPLLESYIKKELGEDVTIIS   38
usage_00298.pdb         1  -----------LQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLID   38
usage_00299.pdb         1  -----------LQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLID   38
usage_00352.pdb         1  -----------LQPLKNTDIDTLILGCTHYPILGPVIKQVMGDKVQLIS   38
usage_00353.pdb         1  -----------LQPLKNTDIDTLILGCTHYPILGPVIKQVMGDKVQLIS   38
usage_00450.pdb         1  SSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLID   49
usage_00451.pdb         1  ------------QALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLID   37
usage_00681.pdb         1  ------------EPLQRAEVDTLVLGCTHYPLLSGLIQLAMGENVTLVS   37
usage_00705.pdb         1  ------------EPLQLAEVDTLVLGCTHYPMLSGLIQLAMGDNVTLVS   37
usage_00706.pdb         1  ------------EPLQLAEVDTLVLGCTHYPMLSGLIQLAMGDNVTLVS   37
                                         L     DTL LGCTHYP L   I   mG  V l  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################