################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:00 2021 # Report_file: c_0837_35.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00043.pdb # 2: usage_00092.pdb # 3: usage_00231.pdb # 4: usage_00310.pdb # 5: usage_00448.pdb # # Length: 83 # Identity: 8/ 83 ( 9.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 83 ( 22.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 83 ( 25.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00043.pdb 1 -TKEDFVRATLQAVAYQSKDVIDTMKKDSGIDIPLLKVDGGAAK-NDLLMQFQADILDID 58 usage_00092.pdb 1 -TKEDFVRATLQAVAYQSKDVIDTMKKDSGIDIPLLKVDGGAAK-NDLLMQFQADILDID 58 usage_00231.pdb 1 --RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSK-NGLLMEIQASLLGVD 57 usage_00310.pdb 1 PEDALRYLATIQALALGTRHIIET-NQN-GYNIDT--ASGGGTK-NPIFVQEHANATGCA 55 usage_00448.pdb 1 -KPEEIYRALLEATAFGTRAIVDAFHGR-GVEVHELYACGGLPQKNHLLMQIFADVTNRE 58 rA lqA A G GG k N llmq A usage_00043.pdb 59 VQRAANLETTALGAAYLAGL-AV 80 usage_00092.pdb 59 VQRAANLETTA------------ 69 usage_00231.pdb 58 ILVPSMHETTALGAALCAGL-AA 79 usage_00310.pdb 56 -LLPEESEA-LLGSA-GTVAAG- 74 usage_00448.pdb 59 IKVAASKQTPALGAAMFASVAAG 81 et a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################