################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:06 2021 # Report_file: c_0753_43.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00053.pdb # 2: usage_00201.pdb # 3: usage_00388.pdb # 4: usage_00482.pdb # 5: usage_00498.pdb # 6: usage_00499.pdb # 7: usage_00638.pdb # 8: usage_00662.pdb # 9: usage_00758.pdb # 10: usage_00854.pdb # # Length: 51 # Identity: 13/ 51 ( 25.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 51 ( 74.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 51 ( 13.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00053.pdb 1 --VVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHG- 48 usage_00201.pdb 1 -QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGI 50 usage_00388.pdb 1 -QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGI 50 usage_00482.pdb 1 TLAIVPGD-PDRVEKIAAL-DKPVKLASHREFTTWRAELDGKPVIVCSTGI 49 usage_00498.pdb 1 -QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCS--- 47 usage_00499.pdb 1 -QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGI 50 usage_00638.pdb 1 -QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGI 50 usage_00662.pdb 1 -QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGI 50 usage_00758.pdb 1 -QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGI 50 usage_00854.pdb 1 -QLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCS--- 47 v g P RVeKIaal DkpVkLAshREftswraeldGk vivcS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################