################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:11 2021 # Report_file: c_1297_94.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00198.pdb # 2: usage_00200.pdb # 3: usage_00202.pdb # 4: usage_00204.pdb # 5: usage_00338.pdb # 6: usage_00339.pdb # 7: usage_00701.pdb # 8: usage_00702.pdb # 9: usage_01011.pdb # 10: usage_01014.pdb # 11: usage_01723.pdb # 12: usage_02929.pdb # 13: usage_02931.pdb # # Length: 53 # Identity: 18/ 53 ( 34.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 53 ( 43.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 53 ( 11.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00198.pdb 1 -LTIVLAHKLNTRMADLRR-S---GVLPWLRPDSKTQVTVQYVQDNGAVIPVR 48 usage_00200.pdb 1 -LTIVLAHKLNTRMADLRR-S---GVLPWLRPDSKTQVTVQYVQDNGAVIPVR 48 usage_00202.pdb 1 -LTIVLAHKLNTRMADLRR-S---GVLPWLRPDSKTQVTVQYVQDNGAVIPVR 48 usage_00204.pdb 1 -LTIVLAHKLNTRMADLRR-S---GVLPWLRPDSKTQVTVQYVQDNGAVIPVR 48 usage_00338.pdb 1 PLTHVLSTKLILRLQECRE-K---GILPWLRPDSKSQVTLEYEEVEGHLKPIR 49 usage_00339.pdb 1 PLTHVLSTKLILRLQECRE-K---GILPWLRPDSKSQVTLEYEEVEGHLKPIR 49 usage_00701.pdb 1 -LTIVLAHKLNTRMADLRR-S---GVLPWLRPDSKTQVTVQYVQDNGAVIPVR 48 usage_00702.pdb 1 PLTIVLAHKLNTRMADLRR-S---GVLPWLRPDSKTQVTVQYVQDNGAVIPVR 49 usage_01011.pdb 1 PLTIVLAHKLNAKLAELRR-N---GTLPWLRPDSKTQVTVQYMQDRGAVLPIR 49 usage_01014.pdb 1 PLTIVLAHKLNAKLAELRR-N---GTLPWLRPDSKTQVTVQYMQDRGAVLPIR 49 usage_01723.pdb 1 PLTHVLATSITRELDYIRMKGVSS-RVGWLRPDGKAQVTVEYNCKHGVLIPKR 52 usage_02929.pdb 1 -LTIVLAHKLNTRMADLRR-S---GVLPWLRPDSKTQVTVQYVQDNGAVIPVR 48 usage_02931.pdb 1 -LTIVLAHKLNTRMADLRR-S---GVLPWLRPDSKTQVTVQYVQDNGAVIPVR 48 LT VL kl R lpWLRPDsK QVT Y G P R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################