################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:56 2021 # Report_file: c_1363_180.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00384.pdb # 2: usage_00804.pdb # 3: usage_01106.pdb # 4: usage_01247.pdb # 5: usage_01248.pdb # # Length: 77 # Identity: 14/ 77 ( 18.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 77 ( 33.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 77 ( 16.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00384.pdb 1 -------IPSKALLHVAKVIEEAK-A---LAEHG-IVFGEPKTDIDKIRTWKEKVINQLT 48 usage_00804.pdb 1 TCLNVGCIPSKALLNNSHLFHQMHTE---AQKRGIDVNGDIKINVANFQKAKDDAVKQLT 57 usage_01106.pdb 1 -----GCIPSKALIHVAEQFHQASRFTEP-SPLG-ISVASPRLDIGQSVAWKDGIVDRLT 53 usage_01247.pdb 1 -------IPSKALLDSSYKFHEAHES---FKLHG-ISTGEVAIDVPTMIARKDQIVRNLT 49 usage_01248.pdb 1 -------IPSKALLDSSYKFHEAHES---FKLHG-ISTGEVAIDVPTMIARKDQIVRNLT 49 IPSKALl fh a G i g d Kd v LT usage_00384.pdb 49 GGLAGMAKGRKVKVVNG 65 usage_00804.pdb 58 GGIELLFKKNKVTYYKG 74 usage_01106.pdb 54 TGVAALLKKHGVKVVHG 70 usage_01247.pdb 50 GGVASLIKANGVTLFEG 66 usage_01248.pdb 50 GGVASLIKANGVTLFEG 66 gG a l K V G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################