################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:31 2021 # Report_file: c_1297_267.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00380.pdb # 2: usage_00602.pdb # 3: usage_00603.pdb # 4: usage_01082.pdb # 5: usage_01083.pdb # 6: usage_01084.pdb # 7: usage_01488.pdb # 8: usage_01510.pdb # 9: usage_01531.pdb # 10: usage_01557.pdb # 11: usage_02174.pdb # 12: usage_02209.pdb # # Length: 34 # Identity: 6/ 34 ( 17.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 34 ( 38.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 34 ( 17.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00380.pdb 1 NEPAVFHNLRVRYN-QDLIYTYSGLFLVAVN--- 30 usage_00602.pdb 1 HEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYE 34 usage_00603.pdb 1 HEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYE 34 usage_01082.pdb 1 HEPAVLYNLKERYA-AWMIYTYSGLFCVTVNPYK 33 usage_01083.pdb 1 HEPAVLYNLKERYA-AWMIYTYSGLFCVTVNPYK 33 usage_01084.pdb 1 HEPAVLYNLKERYA-AWMIYTYSGLFCVTVNPYK 33 usage_01488.pdb 1 NEPAVFHNLRVRYN-QDLIYTYSGLFLVAVN--- 30 usage_01510.pdb 1 NEPAVFHNLRVRYN-QDLIYTYSGLFLVAVNPFK 33 usage_01531.pdb 1 EPAVLHNLKVRFID-SKLIYTYCGIVLVAINPYE 33 usage_01557.pdb 1 NEPAVFHNLRVRYN-QDLIYTYSGLFLVAV---- 29 usage_02174.pdb 1 NEPAVFHNLRVRYN-QDLIYTYSGLFLVAVNPFK 33 usage_02209.pdb 1 -EPAVFHNLRVRYN-QDLIYTYSGLFLVAVNPFK 32 epav nl r IYTY G V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################