################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:28 2021 # Report_file: c_1410_61.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00091.pdb # 2: usage_00303.pdb # 3: usage_00783.pdb # 4: usage_01147.pdb # 5: usage_01284.pdb # 6: usage_01285.pdb # 7: usage_01286.pdb # # Length: 65 # Identity: 14/ 65 ( 21.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 65 ( 30.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 65 ( 3.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00091.pdb 1 -TQCEALTQVCVQVFGNHAALTFAGSQGHFELNVYNPL-AYNFLQSVQLLADAAISFTDN 58 usage_00303.pdb 1 -TQSEAVTMLCCQVFGNDVAVNFGGASGNFELNVFRPMIAHNVLQSVRLLADGAQGFNDH 59 usage_00783.pdb 1 PTQCEALTMLCCQVMGNDVAINMGGASGNFELNVFRPMVIHNFLQSVRLLADGMESFNKH 60 usage_01147.pdb 1 -VIPESVNQVCYQVIGNDLTVTMAAESGQLQLNAFEPLIVYNILSSMRLLGRAMTNLAER 59 usage_01284.pdb 1 -VMPEVMNQVAFQVFGNDLTITSASEAGQFELNVMEPVLFFNLIQSISIMTNVFKSFTEN 59 usage_01285.pdb 1 -VMPEVMNQVAFQVFGNDLTITSASEAGQFELNVMEPVLFFNLIQSISIMTNVFKSFTEN 59 usage_01286.pdb 1 -VMPEVMNQVAFQVFGNDLTITSASEAGQFELNVMEPVLFFNLIQSISIMTNVFKSFTEN 59 E QV GNd G feLNv P N qS f usage_00091.pdb 59 CVVGI 63 usage_00303.pdb 60 CAVGI 64 usage_00783.pdb 61 CAVGI 65 usage_01147.pdb 60 CVDGI 64 usage_01284.pdb 60 CLKGI 64 usage_01285.pdb 60 CLKGI 64 usage_01286.pdb 60 CLKGI 64 C GI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################