################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:17 2021 # Report_file: c_0637_2.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00020.pdb # 2: usage_00022.pdb # 3: usage_00023.pdb # 4: usage_00024.pdb # 5: usage_00025.pdb # 6: usage_00045.pdb # 7: usage_00046.pdb # 8: usage_00049.pdb # 9: usage_00050.pdb # # Length: 92 # Identity: 27/ 92 ( 29.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 92 ( 31.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/ 92 ( 31.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00020.pdb 1 -QQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVE 59 usage_00022.pdb 1 --KRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDLKYGDQSKVKEKAE 58 usage_00023.pdb 1 -KMRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDLKYGDQSKVKEKAE 59 usage_00024.pdb 1 TKMRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDLKYGDQSKVKEKAE 60 usage_00025.pdb 1 TKMRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDLKYGDQSKVKEKAE 60 usage_00045.pdb 1 TKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAE 60 usage_00046.pdb 1 -KMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAE 59 usage_00049.pdb 1 SQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQ 60 usage_00050.pdb 1 SQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQ 60 RV RW F E Dp GR F FL EFS ENL FW A eDLK V usage_00020.pdb 60 EIWQE--------------------------- 64 usage_00022.pdb 59 EIYKLFLAPGARRWINIDGKT-DITVKGLK-- 87 usage_00023.pdb 60 EIYKLFLAPGARRWINIDGKTMDITVKGLK-- 89 usage_00024.pdb 61 EIYKLFLAPGARRWINIDGKTMDITVKGLK-- 90 usage_00025.pdb 61 EIYKLFLAPGARRWINIDGKTMDITVKGLK-- 90 usage_00045.pdb 61 EIYKLFLAPGARRWINIDGKTMDITVKGLR-- 90 usage_00046.pdb 60 EIYKLFLAPGARRWINIDGKTMDITVKGLR-- 89 usage_00049.pdb 61 EIWQEFLAPGAPSAINLDSKSYDKTTHNVKEP 92 usage_00050.pdb 61 EIWQEFLAPGAPSAINLDSKSYDKTTHNVKEP 92 EI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################