################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:52 2021 # Report_file: c_0558_52.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00166.pdb # 2: usage_00233.pdb # 3: usage_00263.pdb # 4: usage_00284.pdb # 5: usage_00329.pdb # 6: usage_00339.pdb # 7: usage_00340.pdb # 8: usage_00359.pdb # # Length: 66 # Identity: 23/ 66 ( 34.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 66 ( 53.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 66 ( 9.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00166.pdb 1 -EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTR 59 usage_00233.pdb 1 GQEFDETTADNRKAKSTVTLAAGALNQVQKWNGNETTIKRKLVDGKMVVECKMASVVCTR 60 usage_00263.pdb 1 GQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTR 60 usage_00284.pdb 1 GQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTR 60 usage_00329.pdb 1 ---FDETTADDRKTKNVITLDNGILNQVQKWDGKETVIKRKVMDGNLVVECTMNTVTSKR 57 usage_00339.pdb 1 GVEFDEITADDRKVKSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVMKGVTSTR 60 usage_00340.pdb 1 GQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTR 60 usage_00359.pdb 1 GQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTR 60 F E TAD RK k tl G L qvQ WdGk ttIkRK k V EC M V tR usage_00166.pdb 60 IYEKVE 65 usage_00233.pdb 61 IYEKV- 65 usage_00263.pdb 61 IYE--- 63 usage_00284.pdb 61 VYER-- 64 usage_00329.pdb 58 VYE--- 60 usage_00339.pdb 61 VYER-- 64 usage_00340.pdb 61 IYEKV- 65 usage_00359.pdb 61 IYEKV- 65 YE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################