################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 22:56:30 2021 # Report_file: c_0288_29.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: usage_00119.pdb # 2: usage_00292.pdb # 3: usage_00293.pdb # # Length: 133 # Identity: 34/133 ( 25.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 116/133 ( 87.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/133 ( 12.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00119.pdb 1 --YD-SGWLDTG--DGHRIYWELSGNPNGKPAVFIHGGPGGGIS---PHHRQLFDP-ERY 51 usage_00292.pdb 1 ---LYFQGAMDPEFRVINLAYDDN-GT-GDPVVFIAGRG-GAGRTWHPHQVPAFL-AAGY 53 usage_00293.pdb 1 EN-LYFQGAMDPEFRVINLAYDDN-GT-GDPVVFIAGRG-GAGRTWHPHQVPAFL-AAGY 55 l fqgamdp rvinlayddn gt GdPvVFIaGrg Gagr PHqvpaFl agY usage_00119.pdb 52 KVLLFDQRGCGRSRPHASLDNNTTWHLVADIERLREMAGVEQWLVFGGSWGSTLALAYAQ 111 usage_00292.pdb 54 RCITFDNRGIG--ATENA-EGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMV 110 usage_00293.pdb 56 RCITFDNRGIG--ATENA-EGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMV 112 rcitFDnRGiG atena egfTTqtmVADtaaLiEtldiaparVvGvSmGafiAqelmv usage_00119.pdb 112 THPERVSEMVLRG 124 usage_00292.pdb 111 VAPELVSSAVLMA 123 usage_00293.pdb 113 VAPELVSSAVLMA 125 vaPElVSsaVLma #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################