################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:03:29 2021 # Report_file: c_0414_9.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00139.pdb # 2: usage_00140.pdb # 3: usage_00155.pdb # 4: usage_00200.pdb # 5: usage_00201.pdb # 6: usage_00322.pdb # 7: usage_00455.pdb # 8: usage_00456.pdb # 9: usage_00513.pdb # # Length: 86 # Identity: 60/ 86 ( 69.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/ 86 ( 70.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 86 ( 27.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00139.pdb 1 HVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 usage_00140.pdb 1 HVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 usage_00155.pdb 1 HVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 usage_00200.pdb 1 HVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 usage_00201.pdb 1 HVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 usage_00322.pdb 1 HVELSWWVNGKEVHSGVCTDPQAYKESNYSYSLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 usage_00455.pdb 1 HVELSWWVNGKEVHSGVSTDPQAYKESNYSYSLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 usage_00456.pdb 1 HVELSWWVNGKEVHSGVSTDPQAYKESNYSYSLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 usage_00513.pdb 1 HVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGL 60 HVELSWWVNGKEVHSGVsTDPQAYKESNYSY LSSRLRVSATFWHNPRNHFRCQVQFHGL usage_00139.pdb 61 SEEDKWPEGSPKPVTQNISAEAWG-- 84 usage_00140.pdb 61 SEEDKWPEGSPKPVTQNISAEAWG-- 84 usage_00155.pdb 61 SEEDKWPEGSPKPVTQNISAEAW--- 83 usage_00200.pdb 61 SEEDKWPEGSPKPVTQNISAEAWG-- 84 usage_00201.pdb 61 SEEDKWPEGSPKPVTQNISAEAWG-- 84 usage_00322.pdb 61 SEEDKWPEGSPKPVTQNISAEAWGRA 86 usage_00455.pdb 61 SEEDKWPEGSPKPVTQNISAEAWG-- 84 usage_00456.pdb 61 SEEDKWPEGSPKPVTQNISAEAWG-- 84 usage_00513.pdb 61 SE------------------------ 62 SE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################