################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:57 2021 # Report_file: c_0777_148.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00490.pdb # 2: usage_00989.pdb # 3: usage_01065.pdb # 4: usage_01066.pdb # 5: usage_01067.pdb # 6: usage_01410.pdb # 7: usage_01411.pdb # # Length: 65 # Identity: 16/ 65 ( 24.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 65 ( 24.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 65 ( 10.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00490.pdb 1 VVFQAGSSETGRQFAAKNADAIFTHSNSLEETKAFYADVKSRAADEGRDPSSVRIFPGIS 60 usage_00989.pdb 1 VVFQAGSSETGRQFAAKNADAIFTHSNSLEETKAFYADVKSRAADEGRDPSSVRIFPGIS 60 usage_01065.pdb 1 VIYQAGMSERGREFAAKHAECVFLGGKDVETLKFFVDDIRKRAKKYGRNPDHIKMFAGIC 60 usage_01066.pdb 1 VIYQAGMSERGREFAAKHAECVFLGGKDVETLKFFVDDIRKRAKKYGRNPDHIKMFAGIC 60 usage_01067.pdb 1 VIYQAGMSERGREFAAKHAECVFLGGKDVETLKFFVDDIRKRAKKYGRNPDHIKMFAGIC 60 usage_01410.pdb 1 VIFQAGSSDDGIDLAGRSADAVFSNGSTFDEARVFYRRVKAAAAAAGRNPDHVKVFPG-- 58 usage_01411.pdb 1 VIFQAGSSDDGIDLAGRSADAVFSNGSTFDEARVFYRRVKAAAAAAGRNPDHVKVFPG-- 58 V QAG S G A A F F A GR P F G usage_00490.pdb ----- usage_00989.pdb ----- usage_01065.pdb 61 VIVGK 65 usage_01066.pdb 61 VIVGK 65 usage_01067.pdb 61 VIVGK 65 usage_01410.pdb ----- usage_01411.pdb ----- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################