################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 03:16:15 2021 # Report_file: c_1254_18.html ################################################################################################ #==================================== # Aligned_structures: 25 # 1: usage_00006.pdb # 2: usage_00561.pdb # 3: usage_00562.pdb # 4: usage_00563.pdb # 5: usage_00564.pdb # 6: usage_00565.pdb # 7: usage_00566.pdb # 8: usage_00567.pdb # 9: usage_00568.pdb # 10: usage_00569.pdb # 11: usage_00673.pdb # 12: usage_00674.pdb # 13: usage_00675.pdb # 14: usage_00676.pdb # 15: usage_00678.pdb # 16: usage_00679.pdb # 17: usage_01009.pdb # 18: usage_01032.pdb # 19: usage_01034.pdb # 20: usage_01046.pdb # 21: usage_01047.pdb # 22: usage_01048.pdb # 23: usage_01049.pdb # 24: usage_01092.pdb # 25: usage_01093.pdb # # Length: 34 # Identity: 1/ 34 ( 2.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 34 ( 8.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 34 ( 32.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00006.pdb 1 I--VSWTGGWGGYDVASSKLLAEKGHQILNTND- 31 usage_00561.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNGD 33 usage_00562.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00563.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00564.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00565.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00566.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00567.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00568.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00569.pdb 1 -IVSMWTGGWGGYDVASSKLLAEKGHQILNTND- 32 usage_00673.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00674.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00675.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00676.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00678.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_00679.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_01009.pdb 1 ----TGYVAPWWEFSNITNELLLKHGFKY-DHS- 28 usage_01032.pdb 1 -VIEYWYGA-----GRKPQELVQDGYTLMNATQ- 27 usage_01034.pdb 1 -VIEYWYGA-----GRKPQELVQDGYTLMNATQ- 27 usage_01046.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_01047.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_01048.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_01049.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_01092.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 usage_01093.pdb 1 -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG- 32 w L g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################