################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:42 2021 # Report_file: c_0799_15.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00151.pdb # 2: usage_00152.pdb # 3: usage_00153.pdb # 4: usage_00155.pdb # 5: usage_00169.pdb # 6: usage_00170.pdb # # Length: 74 # Identity: 9/ 74 ( 12.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 74 ( 40.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 74 ( 10.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00151.pdb 1 PTLVHMVWYRVGSMDETTGTTGVAHALEHMMFKGT-K---DVGPGEFSKRVAAMGGRDNA 56 usage_00152.pdb 1 PTLVHMVWYRVGSMDETTGTTGVAHALEHMMFKGT-K---DVGPGEFSKRVAAMGGRDNA 56 usage_00153.pdb 1 PTLVHMVWYRVGSMDETTGTTGVAHALEHMMFKGT-K---DVGPGEFSKRVAAMGGRDNA 56 usage_00155.pdb 1 PMLDVQVDFDAGSAREPADQVGVASMTASLMDAGTGSGKSALDENAIADRLADIGARLGG 60 usage_00169.pdb 1 -VIEVDVLYKVGSRNEV-GKSGIAH-LEHLNFKST-K---NLKAGEFDKIVKRFGGVSNA 53 usage_00170.pdb 1 -VIEVDVLYKVGSRNEV-GKSGIAH-LEHLNFKST-K---NLKAGEFDKIVKRFGGVSNA 53 V y vGS E g G Ah leh fk T k gef k v Gg na usage_00151.pdb 57 FTTRDYTAYYQQV- 69 usage_00152.pdb 57 FTTRDYTAYYQQV- 69 usage_00153.pdb 57 FTTRDYTAYYQQVP 70 usage_00155.pdb 61 GAEADRASFSLRV- 73 usage_00169.pdb 54 STSFDITRYFIKT- 66 usage_00170.pdb 54 STSFDITRYFIKT- 66 t D t y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################