################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:15:46 2021 # Report_file: c_0467_46.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00045.pdb # 2: usage_00048.pdb # 3: usage_00057.pdb # 4: usage_00130.pdb # 5: usage_00131.pdb # # Length: 127 # Identity: 48/127 ( 37.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/127 ( 38.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/127 ( 21.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00045.pdb 1 DYLMIATGPKLAFENVPGSDPHEGPVQAICTVDHAERAFAEYQALLREPGPIVIGAMAGA 60 usage_00048.pdb 1 ------------------------PVQSICTVDHAERAFAEYQALLREPGPIVIGAMAGA 36 usage_00057.pdb 1 ------------------------PVQSICTVDHAERAFAEYQALLREPGPIVIGAMAGA 36 usage_00130.pdb 1 -------------------------STSICTAEHALETQKKLQELYANPGPVVIGAIPGV 35 usage_00131.pdb 1 -------------------------STSICTAEHALETQKKLQELYANPGPVVIGAIPGV 35 sICT HA Q L PGP VIGA G usage_00045.pdb 61 SCFGPAYEYAMIVASDLKKRGMRDKIPSFTFITSEPYIGHLGIQGVGDSKGILTKGLKEE 120 usage_00048.pdb 37 SCFGPAYEYAMIVASDLKKRGMRDKIPSFTFITSEPYIGHLGIQGVGDSKGILTKGLKEE 96 usage_00057.pdb 37 SCFGPAYEYAMIVASDLKKRGMRDKIPSFTFITSEPYIGHLGIQGVGDSKGILTKGLKEE 96 usage_00130.pdb 36 S-FGPAYEFALMLHYELKKRGIRYKV-PMTFITSEPYLGHFGVGGIGASKRLVEDLFAER 93 usage_00131.pdb 36 S-FGPAYEFALMLHYELKKRGIRYKV-PMTFITSEPYLGHFGVGGIGASKRLVEDLFAER 93 S FGPAYE A LKKRG R K TFITSEPY GH G G G SK E usage_00045.pdb 121 GIEAYTN 127 usage_00048.pdb 97 GIEAYTN 103 usage_00057.pdb 97 GIEAYTN 103 usage_00130.pdb 94 NIDWIAN 100 usage_00131.pdb 94 NIDWIAN 100 I N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################