################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:03 2021 # Report_file: c_1052_22.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00112.pdb # 2: usage_00212.pdb # 3: usage_00269.pdb # 4: usage_00344.pdb # 5: usage_00443.pdb # 6: usage_00479.pdb # 7: usage_00563.pdb # # Length: 78 # Identity: 17/ 78 ( 21.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 78 ( 24.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 78 ( 25.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00112.pdb 1 --CVLVHCLAGISRSATIAIAYIMKRMD--------------MSLDEAYRFVKEKRPTIS 44 usage_00212.pdb 1 -CGVLVHSLAGVSRSVTVTVAYLMQKLH--------------LSLNDAYDLVKRKKSNIS 45 usage_00269.pdb 1 HSKILVHCVMGRSRSATLVLAYLMIHKD--------------MTLVDAIQQVAKNRC-VL 45 usage_00344.pdb 1 -CGVLVHSLAGISRSVTVTVAYLMQKLN--------------LSMNDAYDIVKMKKSNIS 45 usage_00443.pdb 1 GGKILVHSAVGVSRSATLVLAYLMLYHH--------------LTLVEAIKKVKDHRG-II 45 usage_00479.pdb 1 --VVLVHCAMGKSRSVTAIIAYLLWKYPYRFGKSDPNISAKE-AVSRALEWVRETRPIAG 57 usage_00563.pdb 1 -CGVLVHCLAGVSRSVTVTVAYLMQKLH--------------LSLNDAYDLVKRKKSNIS 45 LVH G SRS T AYlm A V usage_00112.pdb 45 PNFNFLGQLLDYEKKI-- 60 usage_00212.pdb 46 PNFNFMGQLLDFERSLR- 62 usage_00269.pdb 46 PNRGFLKQLRELDKQLV- 62 usage_00344.pdb 46 PNFNFMGQLLDFERTL-- 61 usage_00443.pdb 46 PNRGFLRQLLALDRRLR- 62 usage_00479.pdb 58 PNDGFMRQLEMWWDMG-- 73 usage_00563.pdb 46 PNFNFMGQLLDFERSLRL 63 PN F QL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################