################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:41:36 2021 # Report_file: c_0590_39.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00085.pdb # 2: usage_00086.pdb # 3: usage_00102.pdb # 4: usage_00283.pdb # 5: usage_00365.pdb # 6: usage_00366.pdb # 7: usage_00367.pdb # # Length: 84 # Identity: 14/ 84 ( 16.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 84 ( 44.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 84 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00085.pdb 1 GKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELGAFV--AGHC 58 usage_00086.pdb 1 GKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELGAFV--AGHC 58 usage_00102.pdb 1 --RILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDI--VLQC 56 usage_00283.pdb 1 -KTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEAHLYQI 59 usage_00365.pdb 1 GKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDF--VLPC 58 usage_00366.pdb 1 GKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDF--VLPC 58 usage_00367.pdb 1 GKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDF--VLPC 58 r li GvAn S A GiAk GAeLaFTYq d l krv lae g c usage_00085.pdb 59 DVA----DAASIDAVFETLEK--- 75 usage_00086.pdb 59 DVA----DAASIDAVFETLEKK-- 76 usage_00102.pdb 57 DVA----EDASIDTMFAEL----- 71 usage_00283.pdb 60 DVQSDEEVINGFEQIGKD------ 77 usage_00365.pdb 59 DVE----DIATVDAVFEEIEK--- 75 usage_00366.pdb 59 DVE----DIATVDAVFEEIEK--- 75 usage_00367.pdb 59 DVE----DIATVDAVFEEIEKKWG 78 DV a d f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################