################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:00:57 2021 # Report_file: c_0135_4.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00004.pdb # 2: usage_00010.pdb # 3: usage_00029.pdb # 4: usage_00030.pdb # # Length: 176 # Identity: 26/176 ( 14.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 107/176 ( 60.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 25/176 ( 14.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 ---RMCQVVDK----HQVNILYTAPTAIRALMAEGDK---AIEGTDRSSLRILGSVGEPI 50 usage_00010.pdb 1 TADAIFARLVE----HRPTVFYGVPTLYANMLVSP--NLPARAD---VAIRICTSAGEAL 51 usage_00029.pdb 1 TPDAVFKRWLGGVGGVKPTVFYGAPTGYAGMLAAP--NLPSRDQ---VALRLASSAGEAL 55 usage_00030.pdb 1 TPDAVFKRWLGGVGGVKPTVFYGAPTGYAGMLAAP--NLPSRDQ---VALRLASSAGEAL 55 a f r ptvfYgaPT ya mla p r valR SaGEal usage_00004.pdb 51 NPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVD 110 usage_00010.pdb 52 PREIGERFTAH---FGCEILDGIGSTEMLHIFLSNRAG--AVEYGTTGRPVPGYEIELRD 106 usage_00029.pdb 56 PAEIGQRFQRH---FGLDIVDGIGSTEMLHIFLSNLPD--RVRYGTTGWPVPGYQIELRG 110 usage_00030.pdb 56 PAEIGQRFQRH---FGLDIVDGIGSTEMLHIFLSNLPD--RVRYGTTGWPVPGYQIELRG 110 p Eig rf h fg ivDgigsTEmlhiflsnlp v yGttg PvpGyqieLr usage_00004.pdb 111 NEGHPQEGATEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDE 166 usage_00010.pdb 107 EAGHAVPDGEVGDLYIK--GPSAAVMYWNNREKSRA-TF--LGEWIRSGDKYCRLP 157 usage_00029.pdb 111 DGGGPVADGEPGDLYIH--GPSSATMYWGNRAKSRD-TF--QGGWTKSGDKYVRND 161 usage_00030.pdb 111 DGGGPVADGEPGDLYIH--GPSSATMYWGNRAKSRD-TF--QGGWTKSGDKYVRND 161 G pv dge GdLyI gPs A mywgnr ksr tF g w SGDky R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################