################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:08 2021 # Report_file: c_0611_17.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00015.pdb # 2: usage_00164.pdb # 3: usage_00362.pdb # 4: usage_00414.pdb # 5: usage_00527.pdb # 6: usage_00528.pdb # 7: usage_00529.pdb # 8: usage_00530.pdb # # Length: 81 # Identity: 10/ 81 ( 12.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 81 ( 18.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 81 ( 18.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 DRASCLPAMLLD-PPPGSHV--IDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMA 57 usage_00164.pdb 1 -EASSLPVAALFAD--GNAPQRVDVAAAPGSKTTQISAR-NNEGAILANEFSASRVKVLH 56 usage_00362.pdb 1 SISSMIPPIVLN-PREDDFI--LDMCAAPGGKTTHLAQLMKNKGTIVAVEISKTRTKALK 57 usage_00414.pdb 1 EPSAQAVGVLLD-PKPGERV--LDLAAAPGGKTTHLAARMGGKGLLLANEVDGKRVRGLL 57 usage_00527.pdb 1 DAASLLPVLALG-LQPGDIV--LDLCAAPGGKTLALLQT-GCCRNLAANDLSPSRIARLQ 56 usage_00528.pdb 1 DAASLLPVLALG-LQPGDIV--LDLCAAPGGKTLALLQT-GCCRNLAANDLSPSRIARLQ 56 usage_00529.pdb 1 DAASLLPVLALG-LQPGDIV--LDLCAAPGGKTLALLQT-GCCRNLAANDLSPSRIARLQ 56 usage_00530.pdb 1 DAASLLPVLALG-LQPGDIV--LDLCAAPGGKTLALLQT-GCCRNLAANDLSPSRIARLQ 56 s p L g D AAPG KT l A R l usage_00015.pdb 58 TLLARAG------VSCCELAE 72 usage_00164.pdb 57 ANISRCG------ISNVALTH 71 usage_00362.pdb 58 SNINRMG------VLNTIIIN 72 usage_00414.pdb 58 ENVERWG------AP-LAVTQ 71 usage_00527.pdb 57 KILHSYVPEEIRDGNQVRVT- 76 usage_00528.pdb 57 KILHSYVPEEIRDGNQVRVTS 77 usage_00529.pdb 57 KILHSYVPEEIRDGNQVRVTS 77 usage_00530.pdb 57 KILHSYVPEEIRDGNQVRVT- 76 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################