################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:18:34 2021 # Report_file: c_1297_25.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_02150.pdb # 2: usage_02151.pdb # 3: usage_02152.pdb # 4: usage_02153.pdb # 5: usage_02154.pdb # # Length: 65 # Identity: 57/ 65 ( 87.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 57/ 65 ( 87.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 65 ( 12.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02150.pdb 1 -CQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNE--NRYEGLEVISPTEFEVVL 57 usage_02151.pdb 1 -CQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVL 59 usage_02152.pdb 1 KCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVL 60 usage_02153.pdb 1 KCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVL 60 usage_02154.pdb 1 KCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNE---RYEGLEVISPTEFEVVL 57 CQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNE RYEGLEVISPTEFEVVL usage_02150.pdb 58 YLN-- 60 usage_02151.pdb 60 YLNQM 64 usage_02152.pdb 61 YLN-- 63 usage_02153.pdb 61 Y---- 61 usage_02154.pdb 58 YLN-- 60 Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################