################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:40 2021 # Report_file: c_1074_31.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00034.pdb # 2: usage_00045.pdb # 3: usage_00139.pdb # 4: usage_00140.pdb # 5: usage_00236.pdb # # Length: 66 # Identity: 24/ 66 ( 36.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 66 ( 59.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 66 ( 22.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00034.pdb 1 --PKILENLRLQKRGTGGVDTAA--VADVYDISNLDRMGRSEVELVQIVIDGVNYLVDCE 56 usage_00045.pdb 1 -FEEILTRLRLQKRGT-----------SVFDISNADRLGSSEVEQVQLVVDGVKLMVEME 48 usage_00139.pdb 1 KFEEILTRLRLQKRGT-----------SVFDVSNADRLGSSEVEQVQLVVDGVKLMVEME 49 usage_00140.pdb 1 KFEEILTRLRLQKRGT-----------SVFDVSNADRLGSSEVEQVQLVVDGVKLMVEME 49 usage_00236.pdb 1 -FEDIVVALQLQKRGTG--GEHTAAVDDVYDISNAARLKKSEREFVQLLIDGVKKLIDME 57 e Il LrLQKRGT V D SNadRlg SEvE VQlv DGVk v mE usage_00034.pdb 57 KKLEKG 62 usage_00045.pdb 49 KKLE-- 52 usage_00139.pdb 50 KKLE-- 53 usage_00140.pdb 50 KKLE-- 53 usage_00236.pdb 58 QALEAG 63 kkLE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################