################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:17:39 2021
# Report_file: c_1062_44.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00438.pdb
#   2: usage_00439.pdb
#   3: usage_00440.pdb
#   4: usage_00441.pdb
#   5: usage_00514.pdb
#
# Length:         67
# Identity:        9/ 67 ( 13.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     27/ 67 ( 40.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           40/ 67 ( 59.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00438.pdb         1  ------------------FDYVSDHLDAIYRELT--GNASLT------------KYHATP   28
usage_00439.pdb         1  --------------------------DAIYRELT--GNASLTIEDEDEPFNAGIKYHATP   32
usage_00440.pdb         1  --------------------------DAIYRELT--GNASLTIEDEDEPFNAGIKYHATP   32
usage_00441.pdb         1  LNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELT--GNASLTIEDEDEPFNAGIKYHATP   58
usage_00514.pdb         1  ----------KKNVFMRTFEAISRNFSEIFAKLSPGGSARLILENP---FSGGLEIEAKP   47
                                                     daIyreLt  GnAsLt            kyhAtP

usage_00438.pdb        29  PLKRFKD   35
usage_00439.pdb        33  PLKRFKD   39
usage_00440.pdb        33  PLKRFKD   39
usage_00441.pdb        59  PLKRFKD   65
usage_00514.pdb        48  AGKDVKR   54
                           plKrfKd


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################