################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:07 2021 # Report_file: c_1396_97.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00025.pdb # 2: usage_00026.pdb # 3: usage_00032.pdb # 4: usage_00547.pdb # 5: usage_00866.pdb # 6: usage_01034.pdb # 7: usage_01035.pdb # 8: usage_01299.pdb # 9: usage_01663.pdb # # Length: 45 # Identity: 16/ 45 ( 35.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 45 ( 37.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 45 ( 2.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 DSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRT 45 usage_00026.pdb 1 DSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRT 45 usage_00032.pdb 1 -SGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRT 44 usage_00547.pdb 1 DSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRS 45 usage_00866.pdb 1 DSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRT 45 usage_01034.pdb 1 -SGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLA 44 usage_01035.pdb 1 -SGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLA 44 usage_01299.pdb 1 DSGVQACFNRSREYLLNDSAAYYLNDLDRIAQPNYIPTQQDVLRT 45 usage_01663.pdb 1 DSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRS 45 SG F R E qL S Y L L R Y P QD L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################