################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:40 2021 # Report_file: c_0790_44.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00512.pdb # 2: usage_00621.pdb # 3: usage_00622.pdb # 4: usage_00623.pdb # 5: usage_00624.pdb # 6: usage_00796.pdb # # Length: 75 # Identity: 26/ 75 ( 34.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/ 75 ( 56.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 75 ( 12.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00512.pdb 1 -ILHGGDYNPDQWLDRPDILQADLELMKLSHTNTFTVGVFAWSALEPEEGVYRFEWLDKV 59 usage_00621.pdb 1 GLLHGADYNPEQWLDHPDVLVRDVEMMKEARCNVMSVGIFSWSALEPEEGRYTFDWMDQV 60 usage_00622.pdb 1 -LLHGADYNPEQWLDHPDVLVRDVEMMKEARCNVMSVGIFSWSALEPEEGRYTFDWMDQV 59 usage_00623.pdb 1 -LLHGADYNPEQWLDHPDVLVRDVEMMKEARCNVMSVGIFSWSALEPEEGRYTFDWMDQV 59 usage_00624.pdb 1 -LLHGADYNPEQWLDHPDVLVRDVEMMKEARCNVMSVGIFSWSALEPEEGRYTFDWMDQV 59 usage_00796.pdb 1 -----GDYNPDQW--PEEVWDDDIRLMKKAGVNLVSVGIFSWAKIEPEEGKYDFDWLDRA 53 DYNP QW pdvl D e MK a N sVGiFsWsalEPEEG Y FdW D v usage_00512.pdb 60 FDDIYRIGGRVIL-- 72 usage_00621.pdb 61 LNRLHENGISVFLAT 75 usage_00622.pdb 60 LNRLHENGISVFLAT 74 usage_00623.pdb 60 LNRLHENGISVFLAT 74 usage_00624.pdb 60 LNRLHENGISVFLAT 74 usage_00796.pdb 54 IDKLGKAGIAVDLAS 68 l Gi V L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################