################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:59 2021 # Report_file: c_1409_47.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_01037.pdb # 2: usage_01655.pdb # 3: usage_01656.pdb # 4: usage_01657.pdb # 5: usage_01658.pdb # 6: usage_01659.pdb # 7: usage_01660.pdb # 8: usage_01661.pdb # # Length: 48 # Identity: 15/ 48 ( 31.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 48 ( 77.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 48 ( 22.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01037.pdb 1 -RDLLMYAVGIGES-----DLQFTYEFDEKFSAFPLYPVCLPFK---- 38 usage_01655.pdb 1 -LEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQ----- 42 usage_01656.pdb 1 -LEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQ----- 42 usage_01657.pdb 1 -LEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMM- 46 usage_01658.pdb 1 -LEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQ----- 42 usage_01659.pdb 1 -LEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMG 47 usage_01660.pdb 1 ELEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQ----- 43 usage_01661.pdb 1 -LEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQK---- 43 leaiMYAlGvGaS DLkFiYEgssdFSclPtfgViigq #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################