################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:10 2021 # Report_file: c_1057_19.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00014.pdb # 2: usage_00015.pdb # 3: usage_00047.pdb # 4: usage_00066.pdb # 5: usage_00099.pdb # 6: usage_00106.pdb # 7: usage_00141.pdb # 8: usage_00188.pdb # 9: usage_00240.pdb # 10: usage_00384.pdb # 11: usage_00385.pdb # 12: usage_00389.pdb # 13: usage_00440.pdb # # Length: 50 # Identity: 31/ 50 ( 62.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 50 ( 96.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 50 ( 4.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00014.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00015.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVT- 49 usage_00047.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00066.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00099.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVV-- 48 usage_00106.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00141.pdb 1 TKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLALLLSPFSYTTTAVVSS 50 usage_00188.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00240.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00384.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00385.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00389.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 usage_00440.pdb 1 TKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTN 50 TKsYWkalGisPFHEhAEVVFtAndsGpRrYTiAaLLSPySYsTTAVV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################