################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:59:08 2021 # Report_file: c_1342_9.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00005.pdb # 2: usage_00006.pdb # 3: usage_00007.pdb # 4: usage_00008.pdb # 5: usage_00127.pdb # 6: usage_00147.pdb # 7: usage_00210.pdb # 8: usage_00216.pdb # 9: usage_00217.pdb # 10: usage_00218.pdb # 11: usage_00412.pdb # 12: usage_00539.pdb # 13: usage_00575.pdb # # Length: 38 # Identity: 1/ 38 ( 2.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 38 ( 7.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 38 ( 34.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG-- 34 usage_00006.pdb 1 -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG-- 34 usage_00007.pdb 1 -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG-- 34 usage_00008.pdb 1 PTKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG-- 35 usage_00127.pdb 1 PKAYAQHVFRSF-DANSDGTLDFKEYVIALHMTS---- 33 usage_00147.pdb 1 --AYAQHVFRS--F----GTLDFKEYVIALHMTS---- 26 usage_00210.pdb 1 IDDKIHFSFQLY-DLKQQGFIERQEVKQMVVATLAESG 37 usage_00216.pdb 1 -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG-- 34 usage_00217.pdb 1 -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG-- 34 usage_00218.pdb 1 --KFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG-- 33 usage_00412.pdb 1 -SKFASLVFRVF-DENNDGAIEFEEFIRALSIT----- 31 usage_00539.pdb 1 -STYAHYLFNAF-DTTQTGSVKFEDFVTALSIL----- 31 usage_00575.pdb 1 -GSYCRNLERIGYL--RKGRLEPLEAAYQASRG----- 30 f G e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################