################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:03 2021 # Report_file: c_1300_63.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00007.pdb # 2: usage_00014.pdb # 3: usage_00222.pdb # 4: usage_00232.pdb # 5: usage_00233.pdb # 6: usage_00234.pdb # 7: usage_00235.pdb # 8: usage_00380.pdb # 9: usage_00486.pdb # 10: usage_00487.pdb # # Length: 45 # Identity: 19/ 45 ( 42.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 45 ( 44.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 45 ( 35.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00007.pdb 1 INKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKI-- 43 usage_00014.pdb 1 -PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKV-- 42 usage_00222.pdb 1 --------------MAFIEQRNYIHRDLRAANILVSASLVCKI-- 29 usage_00232.pdb 1 LPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIAD 45 usage_00233.pdb 1 LPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIAD 45 usage_00234.pdb 1 LPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIAD 45 usage_00235.pdb 1 LPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIAD 45 usage_00380.pdb 1 LPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKV-- 43 usage_00486.pdb 1 LPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKV-- 43 usage_00487.pdb 1 LPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKV-- 43 MA E NY HRDLRAANILV LvCK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################