################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:36 2021 # Report_file: c_0760_30.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00134.pdb # 2: usage_00320.pdb # 3: usage_00321.pdb # 4: usage_00322.pdb # 5: usage_00323.pdb # 6: usage_00324.pdb # 7: usage_00325.pdb # 8: usage_00533.pdb # # Length: 75 # Identity: 21/ 75 ( 28.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 72/ 75 ( 96.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 75 ( 4.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00134.pdb 1 RLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGA 60 usage_00320.pdb 1 RLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGA 60 usage_00321.pdb 1 RLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGA 60 usage_00322.pdb 1 -LVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGA 59 usage_00323.pdb 1 -LVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGA 59 usage_00324.pdb 1 RLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGA 60 usage_00325.pdb 1 -LVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGA 59 usage_00533.pdb 1 -LIFDLDPP-DNNFETVRSAAKTIREALDAEGYPVYLMTTGSRGLHVVVPLDRSADFDTV 58 LvFDLDPg gvmmaqlaevAravRdlLadiGlvtfpvTsGSkGLHlytPLDepvssrga usage_00134.pdb 61 TVLAKRVAQRLEQAM 75 usage_00320.pdb 61 TVLAKRVAQRLEQAM 75 usage_00321.pdb 61 TVLAKRVAQRLEQAM 75 usage_00322.pdb 60 TVLAKRVAQRLEQA- 73 usage_00323.pdb 60 TVLAKRVAQRLEQA- 73 usage_00324.pdb 61 TVLAKRVAQRLEQA- 74 usage_00325.pdb 60 TVLAKRVAQRLEQAM 74 usage_00533.pdb 59 RAFARGFGEKLTKKY 73 tvlAkrvaqrLeqa #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################