################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:26 2021 # Report_file: c_1489_6.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_03260.pdb # 2: usage_04260.pdb # 3: usage_04261.pdb # 4: usage_04262.pdb # 5: usage_04263.pdb # 6: usage_04264.pdb # # Length: 66 # Identity: 12/ 66 ( 18.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 66 ( 71.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 66 ( 28.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_03260.pdb 1 QAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGEN 60 usage_04260.pdb 1 ------------LVNKISENCFEKCLTSP-YA----TRNDACIDQCLAKYMRSWNVISKA 43 usage_04261.pdb 1 ----------TELVNKISENCFEKCLTSP-YA----TRNDACIDQCLAKYMRSWNVISKA 45 usage_04262.pdb 1 -----------ELVNKISENCFEKCLTSP-YA----TRNDACIDQCLAKYMRSWNVISKA 44 usage_04263.pdb 1 -----------ELVNKISENCFEKCLTSP-YA----TRNDACIDQCLAKYMRSWNVISKA 44 usage_04264.pdb 1 ------------LVNKISENCFEKCLTSP-YA----TRNDACIDQCLAKYMRSWNVISKA 43 lvNKiseNCfeKCltsp ya trndaCiDqClAKYmrswnviska usage_03260.pdb 61 MQKM-- 64 usage_04260.pdb 44 YISRIQ 49 usage_04261.pdb 46 YISRI- 50 usage_04262.pdb 45 YISRIQ 50 usage_04263.pdb 45 YISRI- 49 usage_04264.pdb 44 YISRI- 48 yisr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################