################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:23:14 2021 # Report_file: c_0582_5.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00179.pdb # 2: usage_00180.pdb # 3: usage_00210.pdb # 4: usage_00211.pdb # 5: usage_00218.pdb # 6: usage_00316.pdb # # Length: 83 # Identity: 5/ 83 ( 6.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 83 ( 27.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 83 ( 24.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00179.pdb 1 --LFIGGVPLNMKEWDLANVLKPF-AEVQSVILNN--------SRKHAFVKVYSRHEAEN 49 usage_00180.pdb 1 RTLFVSGLPVDIKPRELYLLFRPF-KGYEGSLIKLTA------RQPVGFVIFDSRAGAEA 53 usage_00210.pdb 1 RTLFVSGLPLDIKPRELYLLFRPF-KGYEGSLIKLTS------KQPVGFVSFDSRSEAEA 53 usage_00211.pdb 1 RTLFVSGLPLDIKPRELYLLFRPF-KGYEGSLIKLTS------KQPVGFVSFDSRSEAEA 53 usage_00218.pdb 1 RTLFVSGLPLDIKPRELYLLFRPF-KGYEGSLIKLTS------KQPVGFVSFDSRSEAEA 53 usage_00316.pdb 1 KTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDT-DPELKYPK-GAGRVAFSNQQSYIA 58 lFv G P k eL pf g i gfV f sr aea usage_00179.pdb 50 VLQNF--NKDGAL---PLRTRWG 67 usage_00180.pdb 54 AKNALNGIRFDPENP-QTLRL-- 73 usage_00210.pdb 54 AKNANGIRFDPEIP--QTLRLEF 74 usage_00211.pdb 54 AKNANGIRFDPEIP--QTLRLEF 74 usage_00218.pdb 54 AKNALNGIRFDPEIP-QTLRLEF 75 usage_00316.pdb 59 AISARFVQLQ-HGE-IDKRVEVK 79 a a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################