################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:27 2021 # Report_file: c_1288_71.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00105.pdb # 2: usage_00220.pdb # 3: usage_00351.pdb # 4: usage_00756.pdb # 5: usage_00758.pdb # 6: usage_00759.pdb # 7: usage_01030.pdb # 8: usage_01058.pdb # 9: usage_01059.pdb # 10: usage_01094.pdb # 11: usage_01099.pdb # 12: usage_01188.pdb # # Length: 43 # Identity: 0/ 43 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 43 ( 7.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 43 ( 41.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00105.pdb 1 -HVNVSGVGVVKTAP--NREGAVKFIEFLVSEPAQAFLAQNNY 40 usage_00220.pdb 1 -YLQVEVAARTAASK--QPELAQKFLQF-VSPAFQNAI----- 34 usage_00351.pdb 1 HSPITYPVSVIKASK--NVDAAKKFEEFLLSESGQKIFEEFG- 40 usage_00756.pdb 1 ------GWAITATNK--NPVETIKLFDFYFGPKGRELSN---- 31 usage_00758.pdb 1 -HINISGIAMTKSSK--NQDAAKKFMEFMLSPEIQKILTDSNY 40 usage_00759.pdb 1 -HINISGIAMTKSSK--NQDAAKKFMEFMLSPEIQKILTDSNY 40 usage_01030.pdb 1 -HINISGIAMTKSSK--NQDAAKKFMEFMLSPEIQKILTDSNY 40 usage_01058.pdb 1 TYLNFNTININKNSK--NKDLAYEFINYALSKEVQEKTAKALN 41 usage_01059.pdb 1 TYLNFNTININKNSK--NKDLAYEFINYALSKEVQEKTAKALN 41 usage_01094.pdb 1 -NLWFDNMVIPKTVK--NQDSAYAFINFMLKPENALQNAEY-- 38 usage_01099.pdb 1 -LWSYEHMYTLG---QPN-ELAAEFLNFVLSDETQEGIVKGLK 38 usage_01188.pdb 1 -HVNVSGVGVVKTAP--NREGAVKFIEFLVSEPAQAFLAQNNY 40 n a f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################