################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:26 2021 # Report_file: c_1272_26.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00068.pdb # 2: usage_00070.pdb # 3: usage_00087.pdb # 4: usage_00195.pdb # 5: usage_00225.pdb # 6: usage_00320.pdb # 7: usage_00321.pdb # 8: usage_00525.pdb # 9: usage_00547.pdb # 10: usage_00604.pdb # 11: usage_00610.pdb # 12: usage_00618.pdb # # Length: 33 # Identity: 5/ 33 ( 15.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 33 ( 15.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 33 ( 9.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00068.pdb 1 NLLLDRNQGKSVEGMVEIFDMLLATSSRFRMMN 33 usage_00070.pdb 1 NLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMN 33 usage_00087.pdb 1 NLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMN 33 usage_00195.pdb 1 --IMDEDQSKLAG-LLDLNNAILQLVKKYKSMK 30 usage_00225.pdb 1 --IMDEDQSKLAG-LLDLNNAILQLVKKYKSMK 30 usage_00320.pdb 1 NLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMN 33 usage_00321.pdb 1 NLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMN 33 usage_00525.pdb 1 NLLLDRNQGKSVEGMVEIFDMLLATSSRFRMMN 33 usage_00547.pdb 1 NLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMN 33 usage_00604.pdb 1 NLLLDRNQGKSVEGMVEIFDMLLATSSRFRMMN 33 usage_00610.pdb 1 NLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMN 33 usage_00618.pdb 1 NLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMN 33 D Q K L M #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################