################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:02:39 2021
# Report_file: c_0735_21.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00068.pdb
#   2: usage_00125.pdb
#   3: usage_00191.pdb
#   4: usage_00194.pdb
#   5: usage_00206.pdb
#   6: usage_00207.pdb
#
# Length:        103
# Identity:       45/103 ( 43.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     45/103 ( 43.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           57/103 ( 55.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00068.pdb         1  ----------------------STL-IISFGKIYVTKPMVNESDGVTHALYPQEARLRNL   37
usage_00125.pdb         1  ----------------------STLIEISFGKIYVTKPMVNESDGVTHALYPQEARLRNL   38
usage_00191.pdb         1  ----------------------STLIEISFGKIYVTKPMVNESDGVTHALYPQEARLRNL   38
usage_00194.pdb         1  STLILEQLAQHTTESDNISRKY----EISFGKIYVTKPMVNESDGVTHALYPQEARLRNL   56
usage_00206.pdb         1  ----------------------STLIEISFGKIYVTKPMVNESDGVTHALYPQEARLRNL   38
usage_00207.pdb         1  ----------------------STL-IISFGKIYVTKPMVNESDGVTHALYPQEARLRNL   37
                                                      ISFGKIYVTKPMVNESDGVTHALYPQEARLRNL

usage_00068.pdb        38  TYSSGLFVDVKK--------------------------KVFIG   54
usage_00125.pdb        39  TYSSGLFVDVKKRTYEKVFIG----------------------   59
usage_00191.pdb        39  TYSSGLFVDVKKRTY-KV---FIGRLP------IM--------   63
usage_00194.pdb        57  TYSSGLFVDVKKRTY------EAIDV-PGRELKY-ELI-----   86
usage_00206.pdb        39  TYSSGLFVDVKKRTYEKVFIG--RLPI------M---------   64
usage_00207.pdb        38  TYSSGLFVDVKK--------------------------KVFIG   54
                           TYSSGLFVDVKK                               


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################