################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:31 2021 # Report_file: c_0834_156.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00222.pdb # 2: usage_00224.pdb # 3: usage_00768.pdb # 4: usage_00769.pdb # 5: usage_00949.pdb # # Length: 81 # Identity: 37/ 81 ( 45.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 81 ( 55.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 81 ( 8.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00222.pdb 1 PDVFLEFVDI-ILYLANRGVEVFRLDAIAFIWKRLGTDCQNQPEVHHLTRALRAAARIVA 59 usage_00224.pdb 1 PDVFLEFVDI-ILYLANRGVEVFRLDAIAFIWKRLGTDCQNQPEVHHLTRALRAAARIVA 59 usage_00768.pdb 1 PAVFGDA---LALRLANLGVEAFRLDSTAYLWKRIGTDC-NQSEAHTLLVALRAVTDIVA 56 usage_00769.pdb 1 PAVFGDMALA-MLRLANLGVEAFRLDSTAYLWKRIGTDCMNQSEAHTLLVALRAVTDIVA 59 usage_00949.pdb 1 PAVFGEMALA-MLELANLGVEAFRLDSTAYLWKRPGTNCMNQPEAHTILVALRAVADIVA 59 P VF L LAN GVE FRLD A WKR GTdC NQ E H l ALRA IVA usage_00222.pdb 60 PAVAFKAEAIVAPADLIHYLG 80 usage_00224.pdb 60 PAVAFKAEAIVAPADLIHYLG 80 usage_00768.pdb 57 PAVVKAEAIVP--TQLPPYFG 75 usage_00769.pdb 60 PAVVMKAQAIVPMTQLPPYFG 80 usage_00949.pdb 60 PSVVMKAEAIVPMAELPPYFG 80 PaV ka aiv L Y G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################