################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:13 2021 # Report_file: c_0894_21.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00059.pdb # 2: usage_00217.pdb # 3: usage_00218.pdb # 4: usage_00219.pdb # 5: usage_00377.pdb # 6: usage_00378.pdb # 7: usage_00379.pdb # 8: usage_00380.pdb # # Length: 79 # Identity: 8/ 79 ( 10.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 79 ( 31.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 25/ 79 ( 31.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00059.pdb 1 SFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTY- 59 usage_00217.pdb 1 SLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAF----GGT 56 usage_00218.pdb 1 SLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAF----GGT 56 usage_00219.pdb 1 SLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAF----GGT 56 usage_00377.pdb 1 TIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHY- 59 usage_00378.pdb 1 --------ENAMKAAVPLFFKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHY- 51 usage_00379.pdb 1 TIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHETKQQTDFLTMLLGGPNHY- 59 usage_00380.pdb 1 TIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQETDFLTMLLGGPNHY- 59 a aV Fy kVlaDErv ff ntDm dF t usage_00059.pdb 60 SEQRGHP-----RLRMRHA 73 usage_00217.pdb 57 D------RFPGRSMRAAH- 68 usage_00218.pdb 57 D------RFPGRSMRAAH- 68 usage_00219.pdb 57 D------RFPGRSMRAAH- 68 usage_00377.pdb 60 K------GK---NMTEAHK 69 usage_00378.pdb 52 K------GK---NMTEAHK 61 usage_00379.pdb 60 K------GK---NMTEAHK 69 usage_00380.pdb 60 K------GK---NMTEAHK 69 m aH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################