################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:33 2021 # Report_file: c_0780_2.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00010.pdb # 2: usage_00380.pdb # 3: usage_00480.pdb # 4: usage_00481.pdb # 5: usage_00482.pdb # 6: usage_00483.pdb # 7: usage_00579.pdb # 8: usage_00864.pdb # # Length: 81 # Identity: 23/ 81 ( 28.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 81 ( 28.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 81 ( 19.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 NTNFIFIATGTGISPYISFLKKLFA------------SNYTGYITIYYGVYNEDSILYLN 48 usage_00380.pdb 1 -ATHIMIATGTGVAPFRGYLRRMFMEDVPN-------YRFGGLAWLFLGVANSDSLLYDE 52 usage_00480.pdb 1 NTNFIFIATGTGISPYISFLKKLFA--YDKNNLYNRNSNYTGYITIYYGVYNEDSILYLN 58 usage_00481.pdb 1 NTNFIFIATGTGISPYISFLKKLFA--YDKNNLYNRNSNYTGYITIYYGVYNEDSILYLN 58 usage_00482.pdb 1 NTNFIFIATGTGISPYISFLKKLFA--YDKNNLYNRNSNYTGYITIYYGVYNEDSILYLN 58 usage_00483.pdb 1 --NFIFIATGTGISPYISFLKKLFA--YDKNNLYNRNSNYTGYITIYYGVYNEDSILYLN 56 usage_00579.pdb 1 -ATHIMIATGTGVAPFRGYLRRMFMEDVPN-------YRFGGLAWLFLGVANSDSLLYDE 52 usage_00864.pdb 1 NTNFIFIATGTGISPYISFLKKLFA--YDKNNL--RNSNYTGYITIYYGVYNEDSILYLN 56 I IATGTG P L F G GV N DS LY usage_00010.pdb 49 ELEYFQKMYPNNINIHYVFSY 69 usage_00380.pdb 53 EFTSYLKQYPDNFRYDKAL-- 71 usage_00480.pdb 59 ELEYFQKMYPNNINIHYVF-- 77 usage_00481.pdb 59 ELEYFQKMYPNNINIHYVF-- 77 usage_00482.pdb 59 ELEYFQKMYPNNINIHYVFS- 78 usage_00483.pdb 57 ELEYFQKMYPNNINIHYVFSY 77 usage_00579.pdb 53 EFTSYLKQYPDNFRYDKAL-- 71 usage_00864.pdb 57 ELEYFQKMYPNNINIHYVF-- 75 E K YP N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################