################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:44 2021 # Report_file: c_0820_74.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00147.pdb # 2: usage_00148.pdb # 3: usage_00363.pdb # 4: usage_00364.pdb # 5: usage_00365.pdb # 6: usage_00483.pdb # # Length: 76 # Identity: 11/ 76 ( 14.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 76 ( 28.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 76 ( 22.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00147.pdb 1 EGLYLLLKELYNRYG-VD-LIVTENGVSD-S-----------RDALRPAYLVSHVYSVWK 46 usage_00148.pdb 1 EGLYLLLKELYNRYG-VD-LIVTENGVSD-S-----------RDALRPAYLVSHVYSVWK 46 usage_00363.pdb 1 EGLRKLLIWLKNEYGNPQ-LLITENGYGDDG--------Q-LDDFEKISYLKNYLNATLQ 50 usage_00364.pdb 1 WGLYKLLVYTKETYH-VPVLYVTESGMVEENKTKILLSEA-RRDAERTDYHQKHLASVRD 58 usage_00365.pdb 1 EGLHHLLKRLGREVP-WP-LYVTENGAAYPDLWTGEA---VVEDPERVAYLEAHVEAALR 55 usage_00483.pdb 1 EGLHHLLKRLGREVP-WP-LYVTENGAAYPDLWTGEA---VVEDPERVAYLEAHVEAALR 55 eGL LL l L vTEnG D r Yl h usage_00147.pdb 47 AANEGIPVKGYLH-W- 60 usage_00148.pdb 47 AANEGIPVKGYLH-W- 60 usage_00363.pdb 51 AMYEDKCNVIGYTVWS 66 usage_00364.pdb 59 AIDDGVNVKGYFV--- 71 usage_00365.pdb 56 AREEGVDLRGYFV--- 68 usage_00483.pdb 56 AREEGVDLRGYFV-W- 69 A eg gy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################