################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:30:09 2021 # Report_file: c_0888_96.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00663.pdb # 2: usage_00665.pdb # 3: usage_00844.pdb # 4: usage_00845.pdb # 5: usage_00846.pdb # 6: usage_00872.pdb # # Length: 90 # Identity: 31/ 90 ( 34.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 90 ( 37.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 56/ 90 ( 62.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00663.pdb 1 ----------------------------------LYTMMKDQYANYVVQKMIDVAEPGQR 26 usage_00665.pdb 1 ASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPGQR 60 usage_00844.pdb 1 --------------------------------SALYTMMKDQYANYVVQKMIDVAEPGQR 28 usage_00845.pdb 1 ASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPGQR 60 usage_00846.pdb 1 --------------------------------SALYTMMKDQYANYVVQKMIDVAEPGQR 28 usage_00872.pdb 1 --------------------------------SALYTMMKDQYANYVVQKMIDMAEPAQR 28 LYTMMKDQYANYVVQKMIDvAEPgQR usage_00663.pdb 27 KIVMHKIRPHIATLRKYTYGKHILAKL--- 53 usage_00665.pdb 61 KIVMHKIRPHI------------------- 71 usage_00844.pdb 29 KIVMHKIRPHIATLRKYTYGKHILAKLE-- 56 usage_00845.pdb 61 KIVMHKIR---------------------- 68 usage_00846.pdb 29 KIVMHKIRPHIATLRKYTYGKHILAKLEKY 58 usage_00872.pdb 29 KIIMHKIRPHITTLRKYTYGKHILAKLEKY 58 KIvMHKIR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################