################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:25 2021 # Report_file: c_1171_13.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00113.pdb # 2: usage_01714.pdb # 3: usage_02004.pdb # 4: usage_02005.pdb # 5: usage_02006.pdb # # Length: 63 # Identity: 15/ 63 ( 23.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 63 ( 55.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 63 ( 12.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00113.pdb 1 FQAIKAKKLNTPPPKFE-GSGVPDNENMKPSQQHGYWRRQARFKPGKGGRCPVPDAWYFY 59 usage_01714.pdb 1 --ALTQHG--KEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDG-KMKELSPRWY 55 usage_02004.pdb 1 --GLTQHG--KVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFY 56 usage_02005.pdb 1 --GLTQHG--KVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFY 56 usage_02006.pdb 1 --GLTQHG--KVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFY 56 ltqhg k pl Fp GqGVP N Ns P q GYwRRq R g G k wyfY usage_00113.pdb 60 Y-- 60 usage_01714.pdb 56 FYY 58 usage_02004.pdb 57 Y-- 57 usage_02005.pdb 57 Y-- 57 usage_02006.pdb 57 Y-- 57 y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################