################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:02:53 2021
# Report_file: c_0959_35.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00119.pdb
#   2: usage_00125.pdb
#   3: usage_00129.pdb
#   4: usage_00339.pdb
#   5: usage_00465.pdb
#   6: usage_00981.pdb
#   7: usage_00982.pdb
#   8: usage_00983.pdb
#   9: usage_00984.pdb
#  10: usage_01013.pdb
#  11: usage_01022.pdb
#  12: usage_01161.pdb
#  13: usage_01278.pdb
#
# Length:         45
# Identity:        8/ 45 ( 17.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     12/ 45 ( 26.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            8/ 45 ( 17.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00119.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAA   39
usage_00125.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG--   37
usage_00129.pdb         1  -----VELKDLANVLSFGEAKLGDNGQKFNFLFHTASSNVWVP--   38
usage_00339.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG--   37
usage_00465.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG--   37
usage_00981.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG--   37
usage_00982.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG--   37
usage_00983.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG--   37
usage_00984.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG--   37
usage_01013.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG--   37
usage_01022.pdb         1  ------ELDDVANLMFYGEGQIGTNKQPFMFIFDTGSANLWVP--   37
usage_01161.pdb         1  NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVP--   43
usage_01278.pdb         1  ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAA   39
                                  L        y E   G   Q      dTgSsN  V   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################