################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:46 2021 # Report_file: c_0770_80.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00010.pdb # 2: usage_00069.pdb # 3: usage_00070.pdb # 4: usage_00218.pdb # 5: usage_00640.pdb # # Length: 91 # Identity: 7/ 91 ( 7.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 91 ( 23.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 91 ( 26.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 RTMIIGTSSAFRANVLREHFGDRFRNFVLLPPDIDEKAYRA------ADPFELTESIARA 54 usage_00069.pdb 1 -PLILASQSPRRKELLDL-LQ--L-PYSIIVSEV------N----RNFSPEENVQWLAKQ 45 usage_00070.pdb 1 -RVVLASASPRRQEILSN-AG--L-RFEVVPSKFKE--KLDKASF--ATPYGYAMETAKQ 51 usage_00218.pdb 1 -PLILASQSPRRKELLDL-LQ--L-PYSIIVSEVEE--KLN----RNFSPEENVQWLAKQ 49 usage_00640.pdb 1 -SLYLASGSPRRQELLAQ-LG--V-TFERIVTGIEA--QRQ----PQESAQQYVVRLARE 49 las SprR e L p A usage_00010.pdb 55 KMKAVLEKAR-QH----PAIALTFDQVVVKG 80 usage_00069.pdb 46 KAKAVADLHP-------HAIVIGADTMVCLD 69 usage_00070.pdb 52 KALEVANRLY-QKDLRAPDVVIGADTIVTVG 81 usage_00218.pdb 50 KAKAVADLHP-------HAIVIGADTMVCLD 73 usage_00640.pdb 50 KARAGVAQTAK------DLPVLGADTIVILN 74 Ka av v gaDt V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################