################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:28 2021 # Report_file: c_1492_53.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00514.pdb # 2: usage_00515.pdb # 3: usage_02093.pdb # 4: usage_02219.pdb # 5: usage_02541.pdb # 6: usage_02556.pdb # # Length: 89 # Identity: 16/ 89 ( 18.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 89 ( 30.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 46/ 89 ( 51.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00514.pdb 1 -------------------------VNVLKLTVEDLEKERDFYFGKLRNIELICQENE-- 33 usage_00515.pdb 1 ----------------------NQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEH--- 35 usage_02093.pdb 1 ----------------ALAEEWKRRYEKEKEKVEDLEKERDFYFGKLRNIELICQENE-- 42 usage_02219.pdb 1 ------------------AAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEG- 41 usage_02541.pdb 1 PLGSLVAIQAELTKSQETIGSLNEEIEQYKGTVSTLEIEREFYFNKLRDIEILVHTTQDL 60 usage_02556.pdb 1 --------------KKALIKEYTEEIERLKRDLAALEKERDFYFGKLRNIELICQENE-- 44 K v LEkERdFYF KLR IElicqe usage_00514.pdb 34 ------------PVLQRIVDILY------ 44 usage_00515.pdb 36 ------------PVISGIIGILY------ 46 usage_02093.pdb 43 ------------PVLQRIVDILY------ 53 usage_02219.pdb 42 EN---------DPVLQRIVDILY------ 55 usage_02541.pdb 61 I-NEGVYKGALLRFVKKVESILYATAEGF 88 usage_02556.pdb 45 -----------DPVLQRIVDILY------ 56 pv i ILY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################