################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:15:11 2021 # Report_file: c_1192_7.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00155.pdb # 2: usage_00156.pdb # 3: usage_00157.pdb # 4: usage_00671.pdb # 5: usage_00672.pdb # 6: usage_00673.pdb # 7: usage_01041.pdb # 8: usage_01055.pdb # 9: usage_01495.pdb # 10: usage_01496.pdb # 11: usage_01497.pdb # 12: usage_01658.pdb # 13: usage_01883.pdb # 14: usage_01990.pdb # 15: usage_01991.pdb # # Length: 41 # Identity: 41/ 41 (100.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 41 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 41 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00155.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_00156.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_00157.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_00671.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_00672.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_00673.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01041.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01055.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01495.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01496.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01497.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01658.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01883.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01990.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 usage_01991.pdb 1 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL 41 TGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################