################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:09:56 2021
# Report_file: c_1395_126.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00037.pdb
#   2: usage_00041.pdb
#   3: usage_00042.pdb
#   4: usage_00063.pdb
#   5: usage_00323.pdb
#   6: usage_00387.pdb
#   7: usage_01201.pdb
#   8: usage_01202.pdb
#   9: usage_01483.pdb
#  10: usage_01484.pdb
#
# Length:         36
# Identity:        7/ 36 ( 19.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     10/ 36 ( 27.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           11/ 36 ( 30.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00037.pdb         1  ------LAQKRIFGLMEKDSYPRFLRSDLYLDLI--   28
usage_00041.pdb         1  -----DEAQKKIFNLMEKDSYRRFLKSRFYLDLT--   29
usage_00042.pdb         1  -----DEAQKKIFNLMEKDSYRRFLKSRFYL-----   26
usage_00063.pdb         1  ----FDAAQSRVYQLMEQDSYTRFLKSDIYLDLM--   30
usage_00323.pdb         1  DPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYT--   34
usage_00387.pdb         1  TSGCFTTAQKRVYSLMENDSYPRFLKSEFYQDLC--   34
usage_01201.pdb         1  ----FTTAQKRVYSLMENNSYPRFLESEFYQDLCK-   31
usage_01202.pdb         1  ----FTTAQKRVYSLMENNSYPRFLESEFYQDLCK-   31
usage_01483.pdb         1  GRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQA   36
usage_01484.pdb         1  GRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQ-   35
                                  AQ     lM   sY rF  S  Y      


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################