################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:23:35 2021 # Report_file: c_0723_5.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00054.pdb # 2: usage_00055.pdb # 3: usage_00286.pdb # 4: usage_00287.pdb # 5: usage_00300.pdb # 6: usage_00301.pdb # # Length: 61 # Identity: 16/ 61 ( 26.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 61 ( 31.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 61 ( 13.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00054.pdb 1 -KITCVGHTALDYIFNVEKFPEP---NTSIQIPSARKYYGGAAANTAVGIKKLGVNSELL 56 usage_00055.pdb 1 EKITCVGHTALDYIFNVEK-FPEPNTSIQIPSA-RK-YYGGAAANTAVGIKKLGVNSELL 57 usage_00286.pdb 1 --ILCVGLVVLDVISLVDKYPKE---DSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM 55 usage_00287.pdb 1 --ILCVGLVVLDVISLVDKYPKE---DSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM 55 usage_00300.pdb 1 --ILCVGLVVLDVISLVDKYPKE---DSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM 55 usage_00301.pdb 1 --ILCVGLVVLDVISLVDKYPKE---DSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM 55 I CVG LD I V K p e I r GG A N LG usage_00054.pdb 57 S 57 usage_00055.pdb 58 S 58 usage_00286.pdb 56 G 56 usage_00287.pdb 56 G 56 usage_00300.pdb 56 G 56 usage_00301.pdb 56 G 56 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################