################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:25 2021 # Report_file: c_0677_46.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00148.pdb # 2: usage_00149.pdb # 3: usage_00150.pdb # 4: usage_00239.pdb # 5: usage_00428.pdb # 6: usage_00745.pdb # 7: usage_00949.pdb # 8: usage_00963.pdb # 9: usage_00964.pdb # 10: usage_01347.pdb # 11: usage_01560.pdb # # Length: 58 # Identity: 40/ 58 ( 69.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 58 ( 69.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 58 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00148.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSE 58 usage_00149.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSE 58 usage_00150.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSE 58 usage_00239.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIAVMRFDEHGRIQTMQAY--- 55 usage_00428.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQA---- 54 usage_00745.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAY--- 55 usage_00949.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSE 58 usage_00963.pdb 1 KFRVSLTGPVRASHNGSGAMPLRKEW---GQPSALDVILVMRFDEHGRIQTEQRYW-- 53 usage_00964.pdb 1 KFRVSLTGPVRASHNGSGAMPLRKEWVWNGQPSALDVILVMRFDEHGRIQTEQRYW-- 56 usage_01347.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAY--- 55 usage_01560.pdb 1 KVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSE 58 K R LTGPVRASHNG GAMP R E GQP ALDVI VMRFDEHGRIQT Q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################