################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:01 2021 # Report_file: c_0843_68.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00211.pdb # 2: usage_00230.pdb # 3: usage_00302.pdb # 4: usage_00311.pdb # 5: usage_00338.pdb # 6: usage_00350.pdb # 7: usage_00411.pdb # 8: usage_00575.pdb # # Length: 95 # Identity: 3/ 95 ( 3.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 95 ( 6.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/ 95 ( 33.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00211.pdb 1 --------------------VVQGLRASGCKVFAIVGSDD-D-VFMRLIKETKEEIPEME 38 usage_00230.pdb 1 --------------------VEDCLPDIQVPTMVLIGRHD-E-ATPATVKPFLDLVPDVR 38 usage_00302.pdb 1 --------------------ITDKISAIKIPTLITVGEYD-E-VTPNVARVIHEKIAGSE 38 usage_00311.pdb 1 --------------------ITDKISAIKIPTLITVGEYD-E-VTPNVARVIHEKIAGSE 38 usage_00338.pdb 1 RTFLDRMIRLTK--SAETHDVIKDLPNIKTPTLIISSEEDYL-TPPFEQKYLQEHLQNAE 57 usage_00350.pdb 1 --KHVFDAATADPNGVFAWNIKDRLSSIQAPTLVVAGEEDLV-TTVANNQLLADNIPGAE 57 usage_00411.pdb 1 --------------------VIDRLPDVTAPVLVIAGEHD-E-ATPKTWQPFVDHIPDVR 38 usage_00575.pdb 1 --------------------LRAQLARIERPTLVIAGAYD-TVTAASHGELIAASIAGAR 39 p g D usage_00211.pdb 39 LRVLQGSDHWVVIEKPKEMYDILMGFLAIVTKDV- 72 usage_00230.pdb 39 YEVLENSSHVPHLEEPERFHEVMIDYLESLV---- 69 usage_00302.pdb 39 LHVFRDCSHLTMWEDREGYNKLLSDFILKHL---- 69 usage_00311.pdb 39 LHVFRDCSHLT-WEDREGYNKLLSDFILKHL---- 68 usage_00338.pdb 58 LVSIPNCGHASMYEVPKTFTALVLGFFGQ------ 86 usage_00350.pdb 58 LRVINDVGHFYQLERPSEFNELLRGFV-------- 84 usage_00411.pdb 39 SHVFPGTSHCTHLEKPEEFRAVVAQFLHQHDLAAD 73 usage_00575.pdb 40 LVTL-PAVHLSNVEFPQAFEGAVLSFLG------- 66 H E f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################