################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:54 2021 # Report_file: c_1481_34.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00522.pdb # 2: usage_00523.pdb # 3: usage_00524.pdb # 4: usage_00615.pdb # 5: usage_00616.pdb # 6: usage_01131.pdb # 7: usage_01132.pdb # 8: usage_01147.pdb # 9: usage_01433.pdb # 10: usage_02305.pdb # 11: usage_03148.pdb # # Length: 44 # Identity: 3/ 44 ( 6.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 44 ( 47.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 44 ( 40.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00522.pdb 1 GYKDFKYCWENFVYNDDEPFKP-WD-GLDYNFLDLDSKLQEIL- 41 usage_00523.pdb 1 GYKDFKYCWENFVYNDDEPFKP-WD-GLDYNFLDLDSKLQEILE 42 usage_00524.pdb 1 GYKDFKYCWENFVYNDDEPFKP-WD-GLDYNFLDLDSKLQEILE 42 usage_00615.pdb 1 -YKDFKYCWENFVYNDDEPFKP-WK-GLKYNFLFLDSKLQEILE 41 usage_00616.pdb 1 -YKDFKYCWENFVYNDDEPFKP-WK-GLKYNFLFLDSKLQEI-- 39 usage_01131.pdb 1 DYEDFKYCWENFVYNDNEPFKP-WK-GLKTNFRLLKRRLRESLQ 42 usage_01132.pdb 1 ---DFKYCWENFVYNDNEPFKP-WK-GLKTNFRLLKRRLRESL- 38 usage_01147.pdb 1 -YEDFKYCWENFVYNDNEPFKP-WK-GLKTNFRLLKRRLRESL- 40 usage_01433.pdb 1 GYKDFKYCWENFVYNDDEPFKP-WK-GLKYNFLFLDSKLQEI-- 40 usage_02305.pdb 1 --HGVQEPFNRHTNLEAE--YPDTKNKLYDVNA----------- 29 usage_03148.pdb 1 GYKDFKYCWENFVYNDDEPFKP-WD-GLDYNFLDLDSKLQEIL- 41 dfkycwenfvynd E kP w gL nf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################