################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:24 2021 # Report_file: c_1337_81.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00041.pdb # 2: usage_00081.pdb # 3: usage_00738.pdb # 4: usage_00941.pdb # 5: usage_00942.pdb # 6: usage_00943.pdb # 7: usage_01309.pdb # 8: usage_01324.pdb # 9: usage_01325.pdb # 10: usage_01326.pdb # 11: usage_01327.pdb # 12: usage_01341.pdb # 13: usage_01356.pdb # 14: usage_01357.pdb # # Length: 31 # Identity: 16/ 31 ( 51.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 31 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 31 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00041.pdb 1 SCGECIQAGPNCGWCTNSTFLQEGMPTSARC 31 usage_00081.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_00738.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_00941.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_00942.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_00943.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_01309.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_01324.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_01325.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_01326.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_01327.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_01341.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_01356.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 usage_01357.pdb 1 SCRECIESGPGCTWCQKLNFTGPGDPDSIRC 31 SCrECIesGPgCtWCqklnFtgpGdPdSiRC #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################