################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:05 2021 # Report_file: c_0645_49.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00009.pdb # 2: usage_00280.pdb # 3: usage_00424.pdb # 4: usage_00437.pdb # 5: usage_00671.pdb # 6: usage_01027.pdb # # Length: 63 # Identity: 11/ 63 ( 17.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 63 ( 34.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 63 ( 9.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00009.pdb 1 NWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYD--IA 58 usage_00280.pdb 1 QWVVSAAHCY--KSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETY--NND--IM 54 usage_00424.pdb 1 NWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDV--AAGYDIA 58 usage_00437.pdb 1 NWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYD--IA 58 usage_00671.pdb 1 QWVVSAAHCY--KSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTL--NND--IM 54 usage_01027.pdb 1 FYILTAAHCLYQAKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETY--DFD--IA 56 wv AAHC V Ge N n G Eq k vHp n d I usage_00009.pdb 59 LLR 61 usage_00280.pdb 55 LIK 57 usage_00424.pdb 59 LLR 61 usage_00437.pdb 59 LLR 61 usage_00671.pdb 55 LIK 57 usage_01027.pdb 57 VLR 59 l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################