################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:39 2021 # Report_file: c_0721_13.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00052.pdb # 2: usage_00053.pdb # 3: usage_00054.pdb # 4: usage_00055.pdb # 5: usage_00056.pdb # # Length: 72 # Identity: 57/ 72 ( 79.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/ 72 ( 80.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 72 ( 13.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00052.pdb 1 RVVFLAINDNSNQA--A-GSHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLG 57 usage_00053.pdb 1 RVVFLAINDNSNQAAG--GSHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLG 58 usage_00054.pdb 1 RVVFLAINDNSNQAAG--GSHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLG 58 usage_00055.pdb 1 RVVFLAINDNSNQA--AGGSHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLG 58 usage_00056.pdb 1 RVVFLAINDNSNQAAG--GSHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLG 58 RVVFLAINDNSNQA GSHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLG usage_00052.pdb 58 RKGDKLAFVE-- 67 usage_00053.pdb 59 RKL----AFV-E 65 usage_00054.pdb 59 RLA----FVE-E 65 usage_00055.pdb 59 RKGDKLAFVE-E 69 usage_00056.pdb 59 RKG-DKLAFVE- 68 Rk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################