################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 22:59:47 2021 # Report_file: c_0828_13.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00186.pdb # 2: usage_00287.pdb # 3: usage_00288.pdb # 4: usage_00289.pdb # # Length: 72 # Identity: 31/ 72 ( 43.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 66/ 72 ( 91.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 72 ( 8.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00186.pdb 1 -VRIIDKIARKTKISREKFLTNMDKYGNTSAASIPILLDEAVENGTLILGSQQRVVLTGF 59 usage_00287.pdb 1 NIRIMESARERLGISKDKMSVSVNKYGNTSAASIPLSIDQELKNGKLKDDDT--IVLVGF 58 usage_00288.pdb 1 -IRIMESARERLGISKDKMSVSVNKYGNTSAASIPLSIDQELKNGKLKDDDT--IVLVGF 57 usage_00289.pdb 1 --RIMESARERLGISKDKMSVSVNKYGNTSAASIPLSIDQELKNGKLKDDDT--IVLVGF 56 RImesarerlgISkdKmsvsvnKYGNTSAASIPlsiDqelkNGkLkdddt iVLvGF usage_00186.pdb 60 GGGLTWGSLL-- 69 usage_00287.pdb 59 GGGLTWGAMTIK 70 usage_00288.pdb 58 GGGLTWGAMTIK 69 usage_00289.pdb 57 GGGLTWGAMTIK 68 GGGLTWGamt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################