################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:40 2021 # Report_file: c_0658_15.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00902.pdb # 2: usage_01113.pdb # 3: usage_01114.pdb # 4: usage_01386.pdb # 5: usage_01387.pdb # 6: usage_01388.pdb # 7: usage_01389.pdb # 8: usage_01390.pdb # 9: usage_01391.pdb # 10: usage_01392.pdb # 11: usage_01393.pdb # 12: usage_01394.pdb # # Length: 54 # Identity: 10/ 54 ( 18.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/ 54 ( 90.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 54 ( 9.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00902.pdb 1 GCYQWKFYIVKENRGNEGTCVGVSRWPVHDFN--HRTTS-DWLYRAYSGNLYHN 51 usage_01113.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01114.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01386.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01387.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01388.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01389.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01390.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01391.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01392.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01393.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 usage_01394.pdb 1 GIYYFEVKIVSKG-RDGYMGIGLSAQGVN-MNRLPGWDKHSYGYHGDDGHSFCS 52 GiYyfevkIVskg rdgymgiGlSaqgVn mN pgwdk sygYhgddGhsfcs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################