################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:22 2021 # Report_file: c_0680_80.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00225.pdb # 2: usage_00747.pdb # 3: usage_00748.pdb # 4: usage_00749.pdb # 5: usage_01007.pdb # 6: usage_01008.pdb # 7: usage_01009.pdb # 8: usage_01123.pdb # # Length: 75 # Identity: 50/ 75 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 75 ( 66.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 75 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00225.pdb 1 -----SVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLV 55 usage_00747.pdb 1 IVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLV 60 usage_00748.pdb 1 IVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLV 60 usage_00749.pdb 1 IVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLV 60 usage_01007.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGS-----HDQELDSILV 55 usage_01008.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILV 60 usage_01009.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGS-S---HDQELDSILV 56 usage_01123.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILV 60 VLNNPAKF DPY FEITFECLE LK DLEWKLTYVGS DQ LD LV usage_00225.pdb 56 GPIPIGINKFVFEAD 70 usage_00747.pdb 61 GPIPIGINKFVFEAD 75 usage_00748.pdb 61 GPIPIGINKFVFEAD 75 usage_00749.pdb 61 GPIPIGINKFVFEAD 75 usage_01007.pdb 56 GPVPVGVNKFVFSAD 70 usage_01008.pdb 61 GPVPVGVNKFVFSAD 75 usage_01009.pdb 57 GPVPVGVNKFVFSAD 71 usage_01123.pdb 61 GPVPVGVNKFVFSAD 75 GP P G NKFVF AD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################