################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:57 2021 # Report_file: c_0863_154.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00462.pdb # 2: usage_00934.pdb # 3: usage_00935.pdb # 4: usage_01175.pdb # 5: usage_01397.pdb # 6: usage_01399.pdb # 7: usage_01417.pdb # # Length: 68 # Identity: 9/ 68 ( 13.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 68 ( 38.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 68 ( 4.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00462.pdb 1 DDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTF- 59 usage_00934.pdb 1 ESGDYITAFQQLLLPVAYEFQPQLVLVAAGFDAVIGDPKGGMQVSPECFSILTHMLKGVA 60 usage_00935.pdb 1 GDPEYMAAFHHLVMPIAREFAPELVLVSAGFDAARGDPLGGFQVTPEGYAHLTHQLMSLA 60 usage_01175.pdb 1 GDGDYIYAFQRVVMPVAYEFDPDLVIVSCGFDAAAGDHIGQFLLTPAAYAHMTQMLMGLA 60 usage_01397.pdb 1 GDPEYMAAFHHLVMPIAREFAPELVLVSAGFDAARGDPLGGFQVTPEGYAHLTHQLMSLA 60 usage_01399.pdb 1 --PEYMAAFHHLVMPIAREFAPELVLVSAGFDAARGDPLGGFQVTPEGYAHLTHQLMSLA 58 usage_01417.pdb 1 -DPEYMAAFHHLVMPIAREFAPELVLVSAGFDAARGDPLGGFQVTPEGYAHLTHQLMSLA 59 Y aF p a ef P lV v GfDa GD G f tp a t l usage_00462.pdb 60 NLPLLMLG 67 usage_00934.pdb 61 QGRLVLAL 68 usage_00935.pdb 61 AGRVLIIL 68 usage_01175.pdb 61 DGKVFISL 68 usage_01397.pdb 61 AGRVLIIL 68 usage_01399.pdb 59 AGRVLIIL 66 usage_01417.pdb 60 AGRVLIIL 67 g l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################