################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:24:59 2021 # Report_file: c_0722_62.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00022.pdb # 2: usage_00066.pdb # 3: usage_00083.pdb # 4: usage_00123.pdb # 5: usage_00198.pdb # 6: usage_00408.pdb # 7: usage_00409.pdb # 8: usage_00410.pdb # 9: usage_00415.pdb # 10: usage_00598.pdb # # Length: 42 # Identity: 16/ 42 ( 38.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 42 ( 76.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 42 ( 23.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 -KIRIDDEGVVFRSPIDGSKVFLNPEISMEVQIALGSDICMV 41 usage_00066.pdb 1 --TKQSEEGVTFKS-----RHMLSPERSIEIQHLLGSDIVMA 35 usage_00083.pdb 1 --TKQSEEGVTF--------HMLSPERSIEIQHLLGSDIVMA 32 usage_00123.pdb 1 --TKQSEEGVTFKSH----RHMLSPERSIEIQHLLGSDIVMA 36 usage_00198.pdb 1 --TKQSEEGVTFK-------HMLSPERSIEIQHLLGSDIVMA 33 usage_00408.pdb 1 SLTKQSEEGVTFKS------HMLSPERSIEIQHLLGSDIVMA 36 usage_00409.pdb 1 --TKQSEEGVTFK-------HMLSPERSIEIQHLLGSDIVMA 33 usage_00410.pdb 1 --TKQSEEGVTFK-------HMLSPERSIEIQHLLGSDIVMA 33 usage_00415.pdb 1 --TKQSEEGVTFKSH---SRHMLSPERSIEIQHLLGSDIVMA 37 usage_00598.pdb 1 SLTKQSEEGVTFKS-----RHMLSPERSIEIQHLLGSDIVMA 37 tkqseEGVtF hmLsPErSiEiQhlLGSDIvMa #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################