################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:02 2021 # Report_file: c_1411_25.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00431.pdb # 2: usage_00518.pdb # 3: usage_01082.pdb # 4: usage_01119.pdb # 5: usage_01203.pdb # # Length: 75 # Identity: 14/ 75 ( 18.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 75 ( 38.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 75 ( 21.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00431.pdb 1 NAHTALVEEFAKLIQTIWTS-SPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLD 59 usage_00518.pdb 1 -----LTEAFADVIGALWHP-DSCEAVNPTRFRAVFQKYVPSFSGYSQQDAQEFLKLLME 54 usage_01082.pdb 1 ----SLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLN 56 usage_01119.pdb 1 ----ELTEAFADVIGALWHP-DSCEAVNPTRFRAVFQKYVPSFSGYSQQDAQEFLKLLME 55 usage_01203.pdb 1 -----LTEAFADVIGALWHP-DSCEAVNPTRFRAVFQKYVPSFSGYSQQDAQEFLKLLME 54 L e fAd i w v P F qky p F gY QQDAqEFL L usage_00431.pdb 60 GLHNEV--------- 65 usage_00518.pdb 55 RLHLE---------- 59 usage_01082.pdb 57 TIADILQEERKQEKQ 71 usage_01119.pdb 56 RLHLEI--------- 61 usage_01203.pdb 55 RLHLEI--------- 60 lh e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################