################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:15:14 2021 # Report_file: c_0844_14.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00091.pdb # 2: usage_00092.pdb # 3: usage_00202.pdb # 4: usage_00203.pdb # 5: usage_00204.pdb # 6: usage_00205.pdb # 7: usage_00206.pdb # 8: usage_00207.pdb # 9: usage_00208.pdb # 10: usage_00209.pdb # 11: usage_00398.pdb # 12: usage_00399.pdb # 13: usage_00400.pdb # 14: usage_00401.pdb # # Length: 64 # Identity: 24/ 64 ( 37.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 64 ( 37.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 64 ( 20.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00091.pdb 1 SRAHLARAALEGVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQADLLGVPVA 60 usage_00092.pdb 1 -----------GVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQADLLGVPVA 49 usage_00202.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00203.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00204.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00205.pdb 1 TRAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 60 usage_00206.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00207.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00208.pdb 1 TRAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 60 usage_00209.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00398.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00399.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00400.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 usage_00401.pdb 1 -RAHVIRAALQAIALQLNDVVGSMKRDAGLNLSSLRVDGGLSKNGLLMEIQASLLGVDIL 59 A Q DVV M AG L L DGG N L IQA LLGV usage_00091.pdb 61 VP-- 62 usage_00092.pdb 50 VP-- 51 usage_00202.pdb 60 VP-- 61 usage_00203.pdb 60 VP-- 61 usage_00204.pdb 60 VPSM 63 usage_00205.pdb 61 VP-- 62 usage_00206.pdb 60 VPSM 63 usage_00207.pdb 60 VP-- 61 usage_00208.pdb 61 VP-- 62 usage_00209.pdb 60 VP-- 61 usage_00398.pdb 60 VPSM 63 usage_00399.pdb 60 VP-- 61 usage_00400.pdb 60 VPSM 63 usage_00401.pdb 60 VPSM 63 VP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################