################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:56 2021 # Report_file: c_1228_62.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00042.pdb # 2: usage_00051.pdb # 3: usage_00052.pdb # 4: usage_00111.pdb # 5: usage_00309.pdb # 6: usage_00687.pdb # 7: usage_00688.pdb # 8: usage_00770.pdb # 9: usage_00813.pdb # 10: usage_00850.pdb # 11: usage_00853.pdb # # Length: 35 # Identity: 13/ 35 ( 37.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 35 ( 57.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 35 ( 11.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 -TLLCDIGESSPNPTVEAGRTLRVLNLVENWL--- 31 usage_00051.pdb 1 -TLLCDIGESSPNPTVEAGRTLRVLNLVENWL--- 31 usage_00052.pdb 1 -TLLCDIGESSPNPTVEAGRTLRVLNLVENWL--- 31 usage_00111.pdb 1 -TLLCDIGESSPSAEIEEQRTLRILEMVSDWLS-- 32 usage_00309.pdb 1 DTVLCDIGESNPTAAVEASRTLTVLNVISRWLEYN 35 usage_00687.pdb 1 -TLLCDIGESSPSPTVEESRTIRVLKMVEPWL--- 31 usage_00688.pdb 1 DTLLCDIGESSPSPTVEESRTIRVLKMVEPWL--- 32 usage_00770.pdb 1 -TLFCDIGESSPSPEVEEQRTLRVLEMTSDWLHRG 34 usage_00813.pdb 1 -TLLCDIGESSPNPTVEAGRTLRVLNLVENWL--- 31 usage_00850.pdb 1 -TLLCDIGESSPSPTVEESRTIRVLKMVEPWL--- 31 usage_00853.pdb 1 -TLLCDIGESSSSPEVEEARTLRVLSMVGDWLE-- 32 TllCDIGESsp vE RT rvL WL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################