################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:53:35 2021
# Report_file: c_1355_12.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00005.pdb
#   2: usage_00086.pdb
#   3: usage_00345.pdb
#   4: usage_00532.pdb
#   5: usage_00533.pdb
#   6: usage_00534.pdb
#   7: usage_00628.pdb
#   8: usage_00629.pdb
#   9: usage_00720.pdb
#  10: usage_00721.pdb
#  11: usage_00723.pdb
#  12: usage_00790.pdb
#
# Length:         32
# Identity:        0/ 32 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     14/ 32 ( 43.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            5/ 32 ( 15.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00005.pdb         1  YQSFQVIWHYLHDTLLQRYAHERNGINVVSGP   32
usage_00086.pdb         1  AFDVMLPFKQMLVDI-SHDN-DVRAVVIT---   27
usage_00345.pdb         1  YPAFKRVWTYFQRVLVKKYASERNGVNVI---   29
usage_00532.pdb         1  YPAFKRVWAYFQRVLVKKYASERNGVNVI---   29
usage_00533.pdb         1  YPAFKRVWAYFQRVLVKKYASERNGVNVI---   29
usage_00534.pdb         1  YPAFKRVWAYFQRVLVKKYASERNGVNVI---   29
usage_00628.pdb         1  YPAFKRVWTYFQRVLVKKYASERNGVNVI---   29
usage_00629.pdb         1  YPAFKRVWTYFQRVLVKKYASERNGVNVI---   29
usage_00720.pdb         1  YPAFKRVWAYFQRVLVKKYASERNGVNVI---   29
usage_00721.pdb         1  YPAFKRVWAYFQRVLVKKYASERNGVNVI---   29
usage_00723.pdb         1  YPAFKRVWTYFQRVLVKKYASERNGVNVI---   29
usage_00790.pdb         1  YPAFKRVWNYFQRVLVKKYASERNGVNVI---   29
                           y  f   w y    l   ya erngvnv    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################