################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:32 2021 # Report_file: c_1377_118.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00629.pdb # 2: usage_00630.pdb # 3: usage_00631.pdb # 4: usage_00632.pdb # 5: usage_00633.pdb # # Length: 74 # Identity: 70/ 74 ( 94.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 70/ 74 ( 94.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 74 ( 5.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00629.pdb 1 -QLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA 59 usage_00630.pdb 1 --LVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA 58 usage_00631.pdb 1 -QLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA 59 usage_00632.pdb 1 MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA 60 usage_00633.pdb 1 -QLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA 59 LVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA usage_00629.pdb 60 TGLFCLMVSFLL-- 71 usage_00630.pdb 59 TGLFCLMVSFLLL- 71 usage_00631.pdb 60 TGLFCLMVSFLLLF 73 usage_00632.pdb 61 TGLFCLMVSFLLL- 73 usage_00633.pdb 60 TGLFCLMVSFLLL- 72 TGLFCLMVSFLL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################