################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:58 2021 # Report_file: c_1248_19.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00106.pdb # 2: usage_00114.pdb # 3: usage_00115.pdb # 4: usage_00116.pdb # 5: usage_00331.pdb # 6: usage_00361.pdb # 7: usage_00390.pdb # 8: usage_00391.pdb # 9: usage_00554.pdb # 10: usage_00616.pdb # 11: usage_00617.pdb # # Length: 30 # Identity: 2/ 30 ( 6.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 30 ( 23.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 30 ( 26.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00106.pdb 1 GMWMYHC---H-VQNHSDMGMAGMFLVRN- 25 usage_00114.pdb 1 GAWMYHC---H-VQSHSDMGMVGLFLVKKP 26 usage_00115.pdb 1 --WMYHC---H-VQSHSDMGMVGLFLVKK- 23 usage_00116.pdb 1 --WMYHC---H-VQSHSDMGMVGLFLVKK- 23 usage_00331.pdb 1 GAWMYHC---H-VQSHSDMGMVGLFLVKKT 26 usage_00361.pdb 1 ACIPWAYYSTVDQVKDLYSGLIGPLIVCRR 30 usage_00390.pdb 1 GAWMYHC---H-VQSHSDMGMVGLFLVKK- 25 usage_00391.pdb 1 GAWMYHC---H-VQSHSDMGMVGLFLVK-- 24 usage_00554.pdb 1 GLWILGC---H-NSDFRNRGMTALLKVS-- 24 usage_00616.pdb 1 GAWMYHC---H-VQSHSDMGMVGLFLVKKT 26 usage_00617.pdb 1 GAWMYHC---H-VQSHSDMGMVGLFLVKKT 26 w c h Gm g V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################