################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:07 2021 # Report_file: c_1433_47.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00146.pdb # 2: usage_00147.pdb # 3: usage_00148.pdb # 4: usage_00150.pdb # 5: usage_00406.pdb # 6: usage_00785.pdb # 7: usage_00878.pdb # 8: usage_00879.pdb # 9: usage_00880.pdb # 10: usage_00882.pdb # 11: usage_00975.pdb # 12: usage_01160.pdb # # Length: 59 # Identity: 55/ 59 ( 93.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/ 59 ( 93.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 59 ( 5.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00146.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKL- 57 usage_00147.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKL- 57 usage_00148.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKL- 57 usage_00150.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKL- 57 usage_00406.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKL- 57 usage_00785.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKL- 57 usage_00878.pdb 1 SAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLEHLEPLVKFQVGLKKL- 58 usage_00879.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLEHLEPLVKFQVGLKKL- 57 usage_00880.pdb 1 --IEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLEHLEPLVKFQVGLKKL- 56 usage_00882.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKL- 57 usage_00975.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKL- 57 usage_01160.pdb 1 -AIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLK 58 IEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLE LEPLVKFQVGLKKL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################