################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:53 2021 # Report_file: c_1076_165.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00109.pdb # 2: usage_00110.pdb # 3: usage_00832.pdb # 4: usage_00833.pdb # 5: usage_01317.pdb # 6: usage_01667.pdb # # Length: 83 # Identity: 15/ 83 ( 18.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 83 ( 31.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 39/ 83 ( 47.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00109.pdb 1 SLAEFFY-QVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKLTG---------- 49 usage_00110.pdb 1 SLAEFFY-QVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKLTG---------- 49 usage_00832.pdb 1 --------QVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKLTG---------- 42 usage_00833.pdb 1 --------QVLQAYDFYYLFQRYGCRVQLGGSDQLGNIMSGYEFINKLTG---------- 42 usage_01317.pdb 1 SFAEFTY-PLMQAWDWWMLFK-NGCQVQVGGSDQYGNILFGVGAVKTISKNT-VLQEDNN 57 usage_01667.pdb 1 SIAEFCYP-I-QGWDFWYLFQR-KVQVQVGGSDQYGNILFG-DAIKGILKANPESEWAP- 55 Qa Df yLFq gc VQ GGSDQ GNI G i usage_00109.pdb 50 ----------EDVFGITVP---- 58 usage_00110.pdb 50 ----------EDVFGITVP---- 58 usage_00832.pdb 43 ----------EDVFGITVP---- 51 usage_00833.pdb 43 ----------EDVFGITVP---- 51 usage_01317.pdb 58 PL---S-DDL-DKPIGFT----- 70 usage_01667.pdb 56 --KKDEDPDLANPYGITTPLLTT 76 d git #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################