################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:02 2021 # Report_file: c_0721_15.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00046.pdb # 2: usage_00061.pdb # 3: usage_00301.pdb # 4: usage_00546.pdb # 5: usage_00547.pdb # 6: usage_00548.pdb # 7: usage_00549.pdb # # Length: 81 # Identity: 5/ 81 ( 6.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 81 ( 13.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 25/ 81 ( 30.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 YHCLVAEI--CVVGYGIYYFI---------YSTW-KGRTIYLEDI-YVPEYRGQGIGSKI 47 usage_00061.pdb 1 HVTFLAEVDGKVVGEASLHK------------------DGEFS-LVVHRNYRTLGIGTLL 41 usage_00301.pdb 1 DELYTYQKDNRIIGTIALVYKRIKEKGIWWVPEELNEKVGLIEFFVVDPEFQGKGIGSTL 60 usage_00546.pdb 1 FPILVAEADGRVLGYAYASYFR--------VRPA-YRWLAEDS-IYIAPDAKGQGIGKLL 50 usage_00547.pdb 1 FPILVAEADGRVLGYAYASYFR--------VRPA-YRWLAEDS-IYIAPDAKGQGIGKLL 50 usage_00548.pdb 1 FPILVAEADGRVLGYAYASYFR--------VRPA-YRWLAEDS-IYIAPDAKGQGIGKLL 50 usage_00549.pdb 1 FPILVAEADGRVLGYAYASYFR--------VRPA-YRWLAEDS-IYIAPDAKGQGIGKLL 50 ae v G p g GIG l usage_00046.pdb 48 IKKVAEVALDKGCSQFRLAVL 68 usage_00061.pdb 42 VKTLIEEAKKSGLSTVKFYT- 61 usage_00301.pdb 61 LEFAVKRLRSLGKDPYVV--- 78 usage_00546.pdb 51 LRELIARISALGFRQLLAVIG 71 usage_00547.pdb 51 LRELIARISALGFRQLLAVIG 71 usage_00548.pdb 51 LRELIARISALGFRQLLAVIG 71 usage_00549.pdb 51 LRELIARISALGFRQLLAVIG 71 G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################