################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:52 2021 # Report_file: c_1174_54.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00030.pdb # 2: usage_00299.pdb # 3: usage_00484.pdb # 4: usage_00492.pdb # 5: usage_00493.pdb # 6: usage_00515.pdb # 7: usage_00523.pdb # 8: usage_00590.pdb # 9: usage_00631.pdb # # Length: 30 # Identity: 11/ 30 ( 36.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 30 ( 46.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 30 ( 6.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00030.pdb 1 -VLHMHYTGKLEDGTEFDSSLPQNQPFVF- 28 usage_00299.pdb 1 QTVSVHYTGWLTDGQKFDSSKDRNDPFAFV 30 usage_00484.pdb 1 -LVTIHYTGTLENGQKFDSSVDRGSPFQC- 28 usage_00492.pdb 1 -TVSVHYTGWLTDGQKFDSSKDRNDPFAF- 28 usage_00493.pdb 1 -TVSVHYTGWLTDGQKFDSSKDRNDPFAF- 28 usage_00515.pdb 1 -TVSVHYTGWLTDGQKFGSSKDRNDPFAFV 29 usage_00523.pdb 1 -TVSVHYTGWLTDGQKFGSSKDRNDPFAF- 28 usage_00590.pdb 1 -VLHMHYTGKLEDGTEFDSSLPQNQPFVF- 28 usage_00631.pdb 1 -TVSVHYTGWLTDGQKFDSSKDRNDPFAF- 28 HYTG L dG F SS n PF f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################