################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:16 2021 # Report_file: c_1296_84.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00026.pdb # 2: usage_00043.pdb # 3: usage_00079.pdb # 4: usage_00104.pdb # 5: usage_00769.pdb # 6: usage_00807.pdb # 7: usage_00808.pdb # 8: usage_00809.pdb # 9: usage_00810.pdb # 10: usage_01171.pdb # 11: usage_01179.pdb # 12: usage_01268.pdb # 13: usage_01286.pdb # 14: usage_01391.pdb # # Length: 30 # Identity: 4/ 30 ( 13.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 30 ( 20.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 30 ( 40.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00026.pdb 1 --------SGSNASVFFKISDPPARMTIP- 21 usage_00043.pdb 1 --------TSSNPSIFYTYGTAPARISVP- 21 usage_00079.pdb 1 --------TSSNPSIFYTYGTAPARISVP- 21 usage_00104.pdb 1 --------TSTNPSVFWTEGNAPPRMSVP- 21 usage_00769.pdb 1 --------SSSNPSIFYMYGNAPPRMSIP- 21 usage_00807.pdb 1 --------SSSNPSVFYTYGSAPPRMSIP- 21 usage_00808.pdb 1 --------SSSNPSVFYTYGSAPPRMSIP- 21 usage_00809.pdb 1 --------SSSNPSVFYTYGSAPPRMSIP- 21 usage_00810.pdb 1 --------SSSNPSVFYTYGSAPPRMSIP- 21 usage_01171.pdb 1 --------TSTNPSVFWTEGNAPPRMSIP- 21 usage_01179.pdb 1 KWDDYTWQTSSNPSIFYTYGTAPARISVP- 29 usage_01268.pdb 1 ---DYAWQSGTNASVFWQHGQPFPRFS--- 24 usage_01286.pdb 1 --------TSTNPSVFWTEGSAPPRMSVP- 21 usage_01391.pdb 1 --------SASNPSVFFKVGD-TSRFSVPY 21 N S F g R s #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################