################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:18 2021 # Report_file: c_0780_4.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00151.pdb # 2: usage_00558.pdb # 3: usage_00671.pdb # 4: usage_00718.pdb # 5: usage_00803.pdb # 6: usage_00804.pdb # 7: usage_00831.pdb # # Length: 84 # Identity: 2/ 84 ( 2.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 84 ( 17.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 38/ 84 ( 45.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00151.pdb 1 -NVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLP-PLS--KAYLAGKATAES 56 usage_00558.pdb 1 DNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLP-PLS--KAYLAGKATAES 57 usage_00671.pdb 1 LKIVIIGASFAGISAAIASRKKYPQAEISLIDKQATVGYLSG------------------ 42 usage_00718.pdb 1 THVAIIGNGVGGFTTAQALRAEGFEGRISLIGDEPHLPYDRP-SLS--KAVLDGSLER-- 55 usage_00803.pdb 1 DNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLP-PLS--KAYLAGKATAES 57 usage_00804.pdb 1 DNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDATVIPHHLP-PLS--KAYLAGKATAES 57 usage_00831.pdb 1 RNFVVASV---SGETALRLSE--VEGNIVSVTH-------H-AG--FREK----G----- 36 vi g g A lr eg I l usage_00151.pdb 57 -LYLR----TPDAYAAQNIQLLGG 75 usage_00558.pdb 58 -LYLR----TPDAYAAQNIQLLGG 76 usage_00671.pdb 43 -ARYI----TEEELRRQKIQLLLN 61 usage_00718.pdb 56 PPILA----EADWYGEARIDMLTG 75 usage_00803.pdb 58 -LYLR----TPDAYAAQNIQLLGG 76 usage_00804.pdb 58 -LYLR----TPDAYAAQNIQLLGG 76 usage_00831.pdb 37 -QLE-LEDEARDALLERGVNVYAG 58 d i l g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################