################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:51 2021 # Report_file: c_0582_49.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00045.pdb # 2: usage_00051.pdb # 3: usage_00164.pdb # 4: usage_00278.pdb # 5: usage_00296.pdb # 6: usage_00320.pdb # # Length: 80 # Identity: 10/ 80 ( 12.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 80 ( 21.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 80 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00045.pdb 1 ----NLYVKNLDDGIDDERLRKAFSPFG-TITSAKVMMEG-GRSKGFGFVCFSSPEEATK 54 usage_00051.pdb 1 SGSSGIFVRNLPFDFTWKMLKDKFNECG-HVLYADIKMEN-GKSKGCGVVKFESPEVAER 58 usage_00164.pdb 1 ----NIFIKNLDKSIDNKALYDTFSAFG-NILSCKVVCDE-NGSKGYGFVHFETQEAAER 54 usage_00278.pdb 1 ---GNIFIKNLDKSIDNKALYDTFSAFG-NILSCKVVCDE-NGSKGYGFVHFETQEAAER 55 usage_00296.pdb 1 GPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKR 60 usage_00320.pdb 1 ----EVIVKNLPASVNWQALKDIFKECG-NVAHADVELDGDGVSTGSGTVSFYDIKDLHR 55 nL L F g v SkG G V F r usage_00045.pdb 55 AVTEMNGRIVA-TKPLYVAL 73 usage_00051.pdb 59 ACRMMNGMKLS-GREIDVR- 76 usage_00164.pdb 55 AIEKMNGMLLN-DRKVFVGR 73 usage_00278.pdb 56 AIEKMNGMLLN-DRKVFVGR 74 usage_00296.pdb 61 ALTECQGAVGLGSKPVRLSV 80 usage_00320.pdb 56 AIEKYNGYSIE-GNVLDVKS 74 A nG v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################