################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:11:43 2021 # Report_file: c_0366_6.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00028.pdb # 2: usage_00047.pdb # 3: usage_00177.pdb # 4: usage_00202.pdb # 5: usage_00212.pdb # # Length: 123 # Identity: 36/123 ( 29.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 54/123 ( 43.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/123 ( 4.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00028.pdb 1 DMYALVRDGKYAHVPVIIGDQNDEGTLFGLSSLNVTTDAQARAYFKQ-SFIHASDAEIDT 59 usage_00047.pdb 1 -MYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQ-SFVHASDAEIDT 58 usage_00177.pdb 1 -PEEIVKNKQYAAVPMIIGDQEDEGTLFAVLPNNITSTAKIVQYFQDLYFYNATKEQLTA 59 usage_00202.pdb 1 -PEEIVKNKQYAAVPMIIGDQEDEGTLFAVLPNNITSTAKIVQYFQDLYFYNATKEQLTA 59 usage_00212.pdb 1 AAYELFRSGRYAKVPYISGNQEDEGTAFAPVALNATTTPHVKKWLQY-IFYDASEASIDR 59 v YA vP IiGdQ DEGT F N T a yf F A usage_00028.pdb 60 LMAAYTSDITQGSPFDTGIFNAITPQFKRISALLGDLAFTLARRYFLNYY---Q-GGTKY 115 usage_00047.pdb 59 LMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHY---T-GGTKY 114 usage_00177.pdb 60 FVNTYPTDITAGSPFNTGIFNELYPGFKRLAAILGDMTFTLARRAFLQLCSEVNPDVPSW 119 usage_00202.pdb 60 FVNTYPTDITAGSPFNTGIFNELYPGFKRLAAILGDMTFTLARRAFLQLCSEVNPDVPSW 119 usage_00212.pdb 60 VLSLYPQTLSVGSPFRTGILNALTPQFKRVAAILSDMLFQSPRRVMLSAT---K-DVNRW 115 Yp dit GSPF TGI N l P FKR A LgD FtlaRR fL usage_00028.pdb 116 SFL 118 usage_00047.pdb 115 SFL 117 usage_00177.pdb 120 SYL 122 usage_00202.pdb 120 SYL 122 usage_00212.pdb 116 TYL 118 s L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################