################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:11:08 2021 # Report_file: c_0165_8.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00062.pdb # 2: usage_00111.pdb # 3: usage_00145.pdb # 4: usage_00146.pdb # 5: usage_00173.pdb # # Length: 165 # Identity: 29/165 ( 17.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 54/165 ( 32.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 45/165 ( 27.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00062.pdb 1 DVLFSNHGRVAVITLNRPERLNAWTTP-RETIIDALERFNRDPEVAAII-TGAGNRAFSA 58 usage_00111.pdb 1 MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSA 60 usage_00145.pdb 1 AAVVERRGNVALITIDRPDARNAVNGAVSTAVGDALEEAQRDPEVWAVVITGAGDKSFCA 60 usage_00146.pdb 1 AAVVERRGNVALITIDRPDARNAVNGAVSTAVGDALEEAQRDPEVWAVVITGAGDKSFCA 60 usage_00173.pdb 1 GALAERRGNVMVITINRPEARNAVNAAVSIGVGDALEEAQHDPEVRAVVLTGAGDKSFCA 60 e g V IT rP Na v DALe a DpeV Avv tGag sF A usage_00062.pdb 59 GQDLS----------------------------WVKEWQRYYTALRSLSKPLV-ALNGTA 89 usage_00111.pdb 61 GGD--EVKQLS---------------RSEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYA 103 usage_00145.pdb 61 GADLK---AISRGENLYHAEHPEWGF------------AGYVH--HFIDKPTIAAVNGTA 103 usage_00146.pdb 61 GADLK---AISRGENLYHAEHPEWGF------------AGYVH--HFIDKPTIAAVNGTA 103 usage_00173.pdb 61 GADLK---AIARRENLYHPDHPEWGF------------AGYVR--HFIDKPTIAAVNGTA 103 G D y KPti AvnGtA usage_00062.pdb 90 AGSAFQVALLGDIRVGHPGVR-GQPEINAGIASTTG-PWI-NA-- 129 usage_00111.pdb 104 IGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVG-AAILGFT- 146 usage_00145.pdb 104 LGGGSELALASDLVIACESASFGLPEVKRGLIAGAGGVFRIVEQL 148 usage_00146.pdb 104 LGGGSELALASDLVIACESASFGLPEVKRGLIAGAGGVFRIVEQ- 147 usage_00173.pdb 104 LGGGTELALASDLVVADERAQFGLPEVKRGLIAAAGGVFRIAEQ- 147 G g AL D a g PE k G G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################