################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:26 2021 # Report_file: c_1135_139.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00014.pdb # 2: usage_00323.pdb # 3: usage_00373.pdb # 4: usage_00467.pdb # 5: usage_01128.pdb # 6: usage_01188.pdb # 7: usage_01189.pdb # 8: usage_01190.pdb # 9: usage_01191.pdb # 10: usage_01340.pdb # # Length: 102 # Identity: 20/102 ( 19.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/102 ( 40.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/102 ( 12.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00014.pdb 1 TEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFV 60 usage_00323.pdb 1 TEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFA 60 usage_00373.pdb 1 TEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLEQLPGKLRQLSRFLGSRSWFV 60 usage_00467.pdb 1 CPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLN 60 usage_01128.pdb 1 TEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFA 60 usage_01188.pdb 1 TEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFV 60 usage_01189.pdb 1 TEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFV 60 usage_01190.pdb 1 TEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFV 60 usage_01191.pdb 1 TEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFV 60 usage_01340.pdb 1 TEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRP-FA 59 te E r d En mD cY pdFEk Kp L P s fLg r f usage_00014.pdb 61 GDKITFVDFLAYDVLDLHRIFEPNCLDAFP------------ 90 usage_00323.pdb 61 GNKITFVDFLVYDVLDLHRIFEPKCLDAFP------------ 90 usage_00373.pdb 61 GDKLTFVDFLAYDVLDQQRMFVPDCPELQG------------ 90 usage_00467.pdb 61 GDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAI 102 usage_01128.pdb 61 GDKVTYVDFLAYDILDQYHIFEPKCLDAFP------------ 90 usage_01188.pdb 61 GDKLTFVDFLAYDVLDQQRMFVPDCPELQG------------ 90 usage_01189.pdb 61 GDKLTFVDFLAYDVLDQQRMFVPDCPELQG------------ 90 usage_01190.pdb 61 GDKLTFVDFLAYDVLDQQRMFVPDCPELQG------------ 90 usage_01191.pdb 61 GDKLTFVDFLAYDVLDQQRMFVPDCPELQG------------ 90 usage_01340.pdb 60 GDKVTYVDFLAYDILDQYHIFEPKCLDAFP------------ 89 Gdk T vDFl YD LD f P C #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################