################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:11 2021 # Report_file: c_1067_40.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00011.pdb # 2: usage_00012.pdb # 3: usage_00013.pdb # 4: usage_00070.pdb # 5: usage_00129.pdb # 6: usage_00131.pdb # 7: usage_00147.pdb # 8: usage_00149.pdb # 9: usage_00231.pdb # 10: usage_00233.pdb # 11: usage_00253.pdb # 12: usage_00255.pdb # 13: usage_00268.pdb # # Length: 43 # Identity: 1/ 43 ( 2.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 43 ( 7.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 43 ( 20.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00011.pdb 1 -ILEAIKK-DISGINQLPVVDKNNKLVGIISDGDIIRTISKI- 40 usage_00012.pdb 1 -ILEAIKK-DI--INQLPVVDKNNKLVGIISDGDIIRTISK-- 37 usage_00013.pdb 1 -LEEALKLMIDNNIQEMPVVDEKGEIVGDLNSLEILLALWKGR 42 usage_00070.pdb 1 --HVAAEKMRRHNIRHVVVVNKNGELVGVLSIRDLCFER---- 37 usage_00129.pdb 1 TVHEVALKMAKYSIEQLPVIRGEGDLIGLIRDFDLLKVLV--- 40 usage_00131.pdb 1 TLNDAKHLMEALDIRHVPIVDANKKLLGIVSQRDLLAAQESSL 43 usage_00147.pdb 1 SIMEAAKILIKHNINHLPIVDEHGKLVGIITSWDIAKALAQN- 42 usage_00149.pdb 1 SIMEAAKILIKHNINHLPIVDEHGKLVGIITSWDIAKALAQN- 42 usage_00231.pdb 1 SVDDALELLVEKKVTGLPVIDDNWTLVGVVSDYDLLALD---- 39 usage_00233.pdb 1 SVDDALELLVEKKVTGLPVIDDNWTLVGVVSDYDLLALD---- 39 usage_00253.pdb 1 --TGALAL-RQFNIRHLPVVDDKGNLKGIISIRDITRAIDDF- 39 usage_00255.pdb 1 -ITGALAL-RQFNIRHLPVVDDKGNLKGIISIRDITRAIDD-- 39 usage_00268.pdb 1 KLKKIAEIMVTNDIGALPVVDENLRIKGIITEKDVLKYFA--- 40 p G d #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################