################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:47 2021 # Report_file: c_1088_1.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00018.pdb # 2: usage_00059.pdb # 3: usage_00075.pdb # 4: usage_00157.pdb # 5: usage_00193.pdb # 6: usage_00253.pdb # 7: usage_00277.pdb # # Length: 107 # Identity: 13/107 ( 12.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/107 ( 29.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 36/107 ( 33.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 ------------ICPLMHFVNKYTK--FGNGTYLYFFNHRASNLVWPEWM---------- 36 usage_00059.pdb 1 --------DHFFTCPTNEYAQALAE--RGASVHYYYFTHRTSTSLWGEWM---------- 40 usage_00075.pdb 1 ------------ICPLMHFVNKYTK--FGNGTYLYFFNHRASNLVWPEWM---------- 36 usage_00157.pdb 1 ------------ICPLMHFVNKYTK--FGNGTYLYFFNHRASNLVWPEWM---------- 36 usage_00193.pdb 1 ------------ICPLMHFVNKYTK--FGNGTYLYFFNHRASNLVWPEWM---------- 36 usage_00253.pdb 1 DNFMDLCSHFYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLIN-P--YRIMRSGRGV 57 usage_00277.pdb 1 -------------CPLMHFVNKYTK--FGNGTYLYFFNHRASNLVWPEWM---------- 35 cP G ylY F hr s l w e usage_00018.pdb 37 -GVIHGYEIEFVFGLPLVKE-LNYT--AEEEALSRRIMHYWATFAKT 79 usage_00059.pdb 41 -GVLHGDEIEYFFGQPLNNS-LQYR--PVERELGKRMLSAVIEFAK- 82 usage_00075.pdb 37 -GVIHGYEIEFVFGLPLVKE-LNYT--AEEEALSRRIMHYWATFAKT 79 usage_00157.pdb 37 -GVIHGYEIEFVFGLPLVKE-LNYT--AEEEALSRRIMHYWATFAKT 79 usage_00193.pdb 37 -GVIHGYEIEFVFGLPLVKE-LNYT--AEEEALSRRIMHYWATFAKT 79 usage_00253.pdb 58 KGVSHTDELTYFFWN---QLAKRMPKESREYKTIERMTGIWTQFAT- 100 usage_00277.pdb 36 -GVIHGYEIEFVFGLPLVKE-LNYT--AEEEALSRRIMHYWATFAKT 78 GV Hg Eie Fg l y E l R w FAk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################