################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:55 2021 # Report_file: c_0593_23.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00220.pdb # 2: usage_00319.pdb # 3: usage_00327.pdb # 4: usage_00454.pdb # 5: usage_00455.pdb # 6: usage_00456.pdb # # Length: 73 # Identity: 6/ 73 ( 8.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 73 ( 30.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 73 ( 9.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00220.pdb 1 PTLTIYSGRGQSLVEPLVKQFEAETG-IRVQVRYSTDAQILAALQEEG-S-RSPADLFWA 57 usage_00319.pdb 1 GRLVIYCSATNVMCENAAKTFEQKYD-VKTSFIRNGSGSTFAKIEAEK--NNPQADVWYG 57 usage_00327.pdb 1 QTLVVYSSLDEPLATPMIEGFQKANPDIAVHYEDMLTGEIYDRIVKETDAGKKTADFAFS 60 usage_00454.pdb 1 -TLTIYSGRGQSLVEPLVKQFEAETG-IRVQVRYSTDAQILAALQEEG--SRSPADLFWA 56 usage_00455.pdb 1 -TLTIYSGRGQSLVEPLVKQFEAETG-IRVQVRYSTDAQILAALQEEG--SRSPADLFWA 56 usage_00456.pdb 1 -TLTIYSGRGQSLVEPLVKQFEAETG-IRVQVRYSTDAQILAALQEEG--SRSPADLFWA 56 tL iYs l ep k Fe i v i a E AD usage_00220.pdb 58 NTAGALGQASAKG 70 usage_00319.pdb 58 GTLDPQSQAGELG 70 usage_00327.pdb 61 SAMDLQVKLSN-- 71 usage_00454.pdb 57 NTAGALGQASAKG 69 usage_00455.pdb 57 NTAGALGQASAKG 69 usage_00456.pdb 57 NTAGALGQASAKG 69 t qas #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################