################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:33:29 2021 # Report_file: c_0806_8.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00005.pdb # 2: usage_00103.pdb # 3: usage_00106.pdb # 4: usage_00107.pdb # 5: usage_00111.pdb # 6: usage_00115.pdb # 7: usage_00116.pdb # 8: usage_00118.pdb # 9: usage_00213.pdb # 10: usage_00229.pdb # 11: usage_00297.pdb # # Length: 42 # Identity: 15/ 42 ( 35.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 42 ( 42.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 42 ( 7.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 --PKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLAN 40 usage_00103.pdb 1 SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFNVALSS- 41 usage_00106.pdb 1 SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSS 42 usage_00107.pdb 1 SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSS 42 usage_00111.pdb 1 -VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSS 41 usage_00115.pdb 1 -VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSS 41 usage_00116.pdb 1 -VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSS 41 usage_00118.pdb 1 -VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSS 41 usage_00213.pdb 1 SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSS 42 usage_00229.pdb 1 --PKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLAN 40 usage_00297.pdb 1 SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSS 42 FL GK V VKL G Y G L S DG mn l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################