################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:28 2021 # Report_file: c_1437_75.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00248.pdb # 2: usage_00249.pdb # 3: usage_00300.pdb # 4: usage_00715.pdb # 5: usage_00741.pdb # 6: usage_00742.pdb # 7: usage_00743.pdb # 8: usage_00744.pdb # # Length: 79 # Identity: 0/ 79 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 79 ( 3.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 54/ 79 ( 68.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00248.pdb 1 -PALATRGFGDTEFTEVADIIATALATG-------------------SSV-DVSALKDRA 39 usage_00249.pdb 1 -PALATRGFGDTEFTEVADIIATALATG-------------------SSV-DVSALKDRA 39 usage_00300.pdb 1 -----------GEESLFN-----KAYYG-------------------K------STSFFR 19 usage_00715.pdb 1 TPAMTTRGAKEKDMEFIADVLARAIKITVDLQEQYGKKLVDFKKGLP-GNAQLQQLKQEV 59 usage_00741.pdb 1 TPAATTRGFDEKAFEEVAKIISLALKNS-------------------KDEEKLQQAKERV 41 usage_00742.pdb 1 TPAATTRGFDEKAFEEVAKIISLALKNS-------------------KDEEKLQQAKERV 41 usage_00743.pdb 1 TPAATTRGFDEKAFEEVAKIISLALKNS-------------------KDEEKLQQAKERV 41 usage_00744.pdb 1 TPAATTRGFDEKAFEEVAKIISLALKNS-------------------KDEEKLQQAKERV 41 a a k usage_00248.pdb 40 TRLARAFP----------- 47 usage_00249.pdb 40 TRLARAF------------ 46 usage_00300.pdb 20 QESQKLL-QSDKKRTAELA 37 usage_00715.pdb 60 VTWAGAL------------ 66 usage_00741.pdb 42 AKLTAEY------------ 48 usage_00742.pdb 42 AKLTAEY------------ 48 usage_00743.pdb 42 AKLTAEY------------ 48 usage_00744.pdb 42 AKLTAEY------------ 48 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################