################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:07:40 2021 # Report_file: c_0405_21.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00079.pdb # 2: usage_00469.pdb # 3: usage_00470.pdb # 4: usage_00478.pdb # 5: usage_00483.pdb # 6: usage_00541.pdb # 7: usage_00565.pdb # 8: usage_00568.pdb # 9: usage_00569.pdb # # Length: 77 # Identity: 60/ 77 ( 77.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 71/ 77 ( 92.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 77 ( 7.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00079.pdb 1 ---LNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSC 57 usage_00469.pdb 1 PNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSC 60 usage_00470.pdb 1 PNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSC 60 usage_00478.pdb 1 ---LNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSC 57 usage_00483.pdb 1 ---LNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSC 57 usage_00541.pdb 1 PNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSC 60 usage_00565.pdb 1 ---LNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSC 57 usage_00568.pdb 1 ---LNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSC 57 usage_00569.pdb 1 ---LNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSC 57 LNCYVyGFHPPQIEIDLLKNGEKiksEQSDLSFSKDWSFYLLsHaEFTPNskDQYSC usage_00079.pdb 58 RVKHVTLEQPRIVKWDR 74 usage_00469.pdb 61 RVKHVTLEQPRIVK--- 74 usage_00470.pdb 61 RVKHVTLEQPRIVK--- 74 usage_00478.pdb 58 RVKHVTLEQPRIVK--- 71 usage_00483.pdb 58 RVKHVTLDKPKIVK--- 71 usage_00541.pdb 61 RVKHVTLEQPRIVK--- 74 usage_00565.pdb 58 RVKHVTLEQPRIVK--- 71 usage_00568.pdb 58 RVKHVTLEQPRIVK--- 71 usage_00569.pdb 58 RVKHVTLEQPRIVK--- 71 RVKHVTLeqPrIVK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################