################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:16 2021 # Report_file: c_0763_6.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00184.pdb # 2: usage_00185.pdb # 3: usage_00208.pdb # 4: usage_00209.pdb # 5: usage_00473.pdb # 6: usage_00474.pdb # 7: usage_00486.pdb # # Length: 70 # Identity: 12/ 70 ( 17.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 52/ 70 ( 74.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 70 ( 25.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00184.pdb 1 QVTLDFFQF-KAEAADWFKQAAQEFEKENPDIRININN---LRTRFVKDRVPDVITFNGD 56 usage_00185.pdb 1 QVTLDFFQF-KAEAADWFKQAAQEFEKENPDIRININNS--LRTRFVKDRVPDVITFNGD 57 usage_00208.pdb 1 -VTLDFFQF-KAEAADWFKQAAQEFEKENPDIRININ------------RVPDVITFNGD 46 usage_00209.pdb 1 -VTLDFFQF-KAEAADWFKQAAQEFEKENPDIRININ--------FVKDRVPDVITFNGD 50 usage_00473.pdb 1 QVTLDFFQF-KAEAADWFKQAAQEFEKENPDIRININ---DLRTRFVKDRVPDVITFNGD 56 usage_00474.pdb 1 QVTLDFFQF-KAEAADWFKQAAQEFEKENPDIRININ----LRTRFVKDRVPDVITFNGD 55 usage_00486.pdb 1 --KLVIWING-DKGYNGLAEVGKKFEKDTGI-KVTVEHPDKLEEKF-PQVGPDIIFWAH- 54 tLdffqf aeaadwfkqaaqeFEKenpd rinin rvPDvItfng usage_00184.pdb 57 YSFGTFAASG 66 usage_00185.pdb 58 YSFGTFAASG 67 usage_00208.pdb 47 YSFGTFAASG 56 usage_00209.pdb 51 YSFGTFAASG 60 usage_00473.pdb 57 YSFGTFAASG 66 usage_00474.pdb 56 YSFGTFAASG 65 usage_00486.pdb 55 DRFGGYAQSG 64 ysFGtfAaSG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################