################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:29 2021 # Report_file: c_0697_54.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00146.pdb # 2: usage_00157.pdb # 3: usage_00230.pdb # 4: usage_00231.pdb # 5: usage_00256.pdb # 6: usage_00290.pdb # 7: usage_00334.pdb # 8: usage_00335.pdb # 9: usage_00342.pdb # 10: usage_00433.pdb # 11: usage_00492.pdb # # Length: 35 # Identity: 33/ 35 ( 94.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 35 ( 94.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 35 ( 5.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00146.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA 35 usage_00157.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSP-- 33 usage_00230.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA 35 usage_00231.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA 35 usage_00256.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSP-- 33 usage_00290.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA 35 usage_00334.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA 35 usage_00335.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA 35 usage_00342.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSP-- 33 usage_00433.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA 35 usage_00492.pdb 1 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSP-- 33 LLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################