################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:52 2021 # Report_file: c_1023_167.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00258.pdb # 2: usage_00367.pdb # 3: usage_00751.pdb # 4: usage_00752.pdb # 5: usage_00753.pdb # 6: usage_00768.pdb # # Length: 67 # Identity: 7/ 67 ( 10.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 67 ( 22.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 67 ( 28.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00258.pdb 1 KVSLELGGKSPYIVLDD-VDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAEL 59 usage_00367.pdb 1 -----LGGKGANI-IFADA-DIDALQRGVRHCFYNSGQSCNAPTRMLVEQAIYDKAIKTA 53 usage_00751.pdb 1 ------GGKSPVIVLPD-VDLDKAAQGVANAIFFNQGQVCTAGSRAYIHSKVFDGVIERV 53 usage_00752.pdb 1 ------GGKSPVIVLPD-VDLDKAAQGVANAIFFNQGQVCTAGSRAYIHSKVFDGVIERV 53 usage_00753.pdb 1 ------GGKSPVIVLPD-VDLDKAAQGVANAIFFNQGQVCTAGSRAYIHSKVFDGVIERV 53 usage_00768.pdb 1 ---------APMVVMDD-ADLDKAAEDALWGRFANCGQVCTCVERLYVHASVYDEFMAKF 50 p i d Aa f N GQvCta R D usage_00258.pdb 60 KEQFSQV 66 usage_00367.pdb 54 KDIAEKT 60 usage_00751.pdb 54 AKIAASL 60 usage_00752.pdb 54 AKIAASL 60 usage_00753.pdb 54 AKIAAS- 59 usage_00768.pdb ------- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################