################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:13 2021 # Report_file: c_0820_14.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00109.pdb # 2: usage_00134.pdb # 3: usage_00272.pdb # 4: usage_00330.pdb # 5: usage_00597.pdb # 6: usage_00598.pdb # 7: usage_00599.pdb # 8: usage_00600.pdb # 9: usage_00617.pdb # 10: usage_00709.pdb # 11: usage_00738.pdb # # Length: 72 # Identity: 4/ 72 ( 5.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 72 ( 18.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 72 ( 29.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00109.pdb 1 -QWLRDRVDAALQAGTPVFVSEW---GTSD--------ASGDGGP--YLEEAEKWIEFLN 46 usage_00134.pdb 1 -ESLRNKARQALNNGIALFVTEW---GTVN--------ADGNGGV--NQTETDAWVTFMR 46 usage_00272.pdb 1 -QSLRNKASTALSKGIPLFVTEW---GSVN--------ADGGGSV--ATAETNSWVSFMK 46 usage_00330.pdb 1 GQNLRDQVDYALDQGAAIFVSEW---GTSA--------ATGDGGV--FLDEAQVWIDFMD 47 usage_00597.pdb 1 -QFLRDKANYALSKGAPIFVTEW---GTSD--------ASGNGGV--FLDQSREWLKYLD 46 usage_00598.pdb 1 -QFLRDKANYALSKGAPIFVTEW---GTSD--------ASGNGGV--FLDQSREWLKYLD 46 usage_00599.pdb 1 -QFLRDKANYALSKGAPIFVTEW---GTSD--------ASGNGGV--FLDQSREWLKYLD 46 usage_00600.pdb 1 -QFLRDKANYALSKGAPIFVTEW---GTSD--------ASGNGGV--FLDQSREWLKYLD 46 usage_00617.pdb 1 -KGYMDGWKNQAG-GTPFMVTEFYTKGEDTKLDNSSGAGFVVRDQQNRGFAYQHFTLGLL 58 usage_00709.pdb 1 --HIARNIEKALENGLTVFVTEW---GTSE--------ASGDGGP--YLNEADEWLEFLN 45 usage_00738.pdb 1 -QFLRDKANYALSKGAPIFVTEW---GTSD--------ASGNGGV--FLDQSREWLKYLD 46 al G fV Ew G a g g w usage_00109.pdb 47 ER--GISWVNWS 56 usage_00134.pdb 47 DN--NISNA--- 53 usage_00272.pdb 47 TN--NISNANWA 56 usage_00330.pdb 48 ER--NLSWANWS 57 usage_00597.pdb 47 SK--TISWVNWN 56 usage_00598.pdb 47 SK--TISWVNWN 56 usage_00599.pdb 47 SK--TISWVNWN 56 usage_00600.pdb 47 SK--TISWVNWN 56 usage_00617.pdb 59 EAKNCVGWVFFK 70 usage_00709.pdb 46 SN--NISWVNWS 55 usage_00738.pdb 47 SK--TISWVNWN 56 s #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################