################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:34 2021 # Report_file: c_0673_82.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00163.pdb # 2: usage_00695.pdb # 3: usage_01151.pdb # 4: usage_01300.pdb # 5: usage_01555.pdb # 6: usage_01556.pdb # # Length: 77 # Identity: 11/ 77 ( 14.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 77 ( 42.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 77 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00163.pdb 1 TVSWGLED------DEDMTLTRWTGMILGPPRTIYENRIYSLKIECGPKYPEAPPFVRFV 54 usage_00695.pdb 1 GFSAKYSPMSDGKGL-D--IMKWICKIPGKKGGLWEGGEYPLTMEFTEDYPSKPPKCKFT 57 usage_01151.pdb 1 -CRAGPVG------D-D--LFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT 50 usage_01300.pdb 1 -CRAGPVG------D-D--LFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT 50 usage_01555.pdb 1 -CRAGPVG------D-D--MFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT 50 usage_01556.pdb 1 -CSAGPVG------D-D--MFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT 50 ag d D W I Gp y gg Lt f dYP kPPk Ft usage_00163.pdb 55 TKINMNGVNSSNGVVDP 71 usage_00695.pdb 58 TVLFHPNIYPSGTVCL- 73 usage_01151.pdb 51 TKIYHPNINSNGSIKL- 66 usage_01300.pdb 51 TKIYHPNINSNGSIKL- 66 usage_01555.pdb 51 TRIYHPNINSNGSIKL- 66 usage_01556.pdb 51 TRIYHPNINSNGSIKL- 66 T i hpnins g l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################