################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:19 2021 # Report_file: c_1452_6.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00003.pdb # 2: usage_00894.pdb # 3: usage_02115.pdb # 4: usage_02116.pdb # 5: usage_02117.pdb # 6: usage_02118.pdb # 7: usage_02454.pdb # 8: usage_03469.pdb # 9: usage_05160.pdb # # Length: 32 # Identity: 17/ 32 ( 53.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 32 ( 62.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 32 ( 31.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 YGAFPQTWEDPNVSHPETKAVGDNEPIDVLEI 32 usage_00894.pdb 1 YGAFPQTWEDPNVSHPETKAVGDNDPIDVLEI 32 usage_02115.pdb 1 YGAFPQTWEDPNVSH------GENDPIDVLEI 26 usage_02116.pdb 1 YGAFPQTWEDPNVSHPETKAVGDNEPIDVLEI 32 usage_02117.pdb 1 YGAFPQTWEDP----------GDNDPIEVLEI 22 usage_02118.pdb 1 YGAFPQTWEDPNVSHPETKAVGDNDPIEVLEI 32 usage_02454.pdb 1 YGAFPQTWEDPNVSHPETKAVGDNDPIDVLEI 32 usage_03469.pdb 1 YGALPQTWEDPSYVDEDTKAKGDNDPIDVCEI 32 usage_05160.pdb 1 YGAFPQTWEDPNVSHPETKAVGDNDPINVLEI 32 YGAfPQTWEDP GdN PI VlEI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################