################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:42:57 2021 # Report_file: c_1201_124.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00060.pdb # 2: usage_00202.pdb # 3: usage_00210.pdb # 4: usage_00223.pdb # 5: usage_00224.pdb # 6: usage_00225.pdb # 7: usage_00475.pdb # 8: usage_00566.pdb # 9: usage_00842.pdb # 10: usage_01022.pdb # 11: usage_01139.pdb # 12: usage_01144.pdb # 13: usage_01145.pdb # 14: usage_01146.pdb # 15: usage_01147.pdb # 16: usage_01502.pdb # # Length: 31 # Identity: 11/ 31 ( 35.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 31 ( 35.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 31 ( 12.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00060.pdb 1 VGYGIQKGNKHWIIKNSWGENWGNKGYILMA 31 usage_00202.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 usage_00210.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 usage_00223.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 usage_00224.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 usage_00225.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 usage_00475.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 usage_00566.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 usage_00842.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 usage_01022.pdb 1 VGYGIQKGNKHWIIKNSWGENWGNKGYILMA 31 usage_01139.pdb 1 --VGYGP--NYILIRNSWGTGWGENGYIRIK 27 usage_01144.pdb 1 --VGYGP--NYILIRNSWGTGWGENGYIRIK 27 usage_01145.pdb 1 --VGYGP--NYILIRNSWGTGWGENGYIRIK 27 usage_01146.pdb 1 --VGYGP--NYILIRNSWGTGWGENGYIRIK 27 usage_01147.pdb 1 --VGYGP--NYILIRNSWGTGWGENGYIRIK 27 usage_01502.pdb 1 --VGYGP--NYILIKNSWGTGWGENGYIRIK 27 G I NSWG WG GYI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################