################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:51 2021 # Report_file: c_0787_94.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00143.pdb # 2: usage_00467.pdb # 3: usage_00628.pdb # 4: usage_00629.pdb # 5: usage_01124.pdb # # Length: 84 # Identity: 15/ 84 ( 17.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 84 ( 46.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 84 ( 11.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00143.pdb 1 NVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDE 60 usage_00467.pdb 1 SIVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEG 60 usage_00628.pdb 1 ------PVRTPIGRYGGMFRSLTAVDLGVTALKGLLERTGIAADQVEDVILGHCYPNSEA 54 usage_00629.pdb 1 ----------PIGRYGGMFRSLTAVDLGVTALKGLLERTGIAADQVEDVILGHCYPNSEA 50 usage_01124.pdb 1 DAVICEPVRTPIGRYGGMFRSLTAVDLGVTALKGLLERTGIAADQVEDVILGHCYPNSEA 60 piG gG f tav Lgvt l leR G aa V VILGhc p e usage_00143.pdb 61 ANTARTAALAAGFPDTVTGYTIQR 84 usage_00467.pdb 61 QNPARQAAMKAGVPQEATAWGMNQ 84 usage_00628.pdb 55 PAIGRVVALDAGLPITVPGMQVDR 78 usage_00629.pdb 51 PAIGRVVALDAGLPITVPGMQVDR 74 usage_01124.pdb 61 PAIGRVVALDAGLPITVPGMQVDR 84 R Al AG P tv g r #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################