################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:18:34 2021 # Report_file: c_1297_55.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00466.pdb # 2: usage_00467.pdb # 3: usage_00468.pdb # 4: usage_00469.pdb # 5: usage_01717.pdb # # Length: 42 # Identity: 38/ 42 ( 90.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 42 ( 95.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 42 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00466.pdb 1 -IQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANG 41 usage_00467.pdb 1 --QALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANG 40 usage_00468.pdb 1 -IQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANG 41 usage_00469.pdb 1 -IQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANG 41 usage_01717.pdb 1 NIQALLSEKVRQAMIAAGAPADCEPQVRQSAKVQFGDYQANG 42 QALLSEKVsQAlIAAGAPADCEPQVRQSAKVQFGDYQANG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################