################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:51 2021 # Report_file: c_1195_47.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00024.pdb # 2: usage_00025.pdb # 3: usage_00167.pdb # 4: usage_00274.pdb # 5: usage_00275.pdb # 6: usage_00298.pdb # 7: usage_00362.pdb # 8: usage_00384.pdb # 9: usage_00412.pdb # 10: usage_00520.pdb # 11: usage_00634.pdb # # Length: 34 # Identity: 11/ 34 ( 32.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 34 ( 41.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 34 ( 23.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00024.pdb 1 GTYLCAIASS--S-FSKLVFGQGTSLSVVP---- 27 usage_00025.pdb 1 GTYLCAIASS--S-FSKLVFGQGTSLSVVP---- 27 usage_00167.pdb 1 ALYYCALFLA-SSSFSKLVFGQGTSLSVVP---- 29 usage_00274.pdb 1 ALYYCALFLA-SSSFSKLVFGQGTSLSVVP---- 29 usage_00275.pdb 1 ALYYCALFLA-SSSFSKLVFGQGTSLSVVP---- 29 usage_00298.pdb 1 ALYYCALFLA-SSSFSKLVFGQGTSLSVVP---- 29 usage_00362.pdb 1 ALYYCALFLA-SSSFSKLVFGQGTSLSVVP---- 29 usage_00384.pdb 1 AVYFCALSLYSGAGSYQLTFGKGTKLSVIPNIQN 34 usage_00412.pdb 1 GIYFCAGPGG-SSNTGKLIFGQGTTLQVKP---- 29 usage_00520.pdb 1 GTYFCAALRA---TNNKLTFGQGTVLSVIP---- 27 usage_00634.pdb 1 GTYLCAIASS--S-FSKLVFGQGTSLSVVP---- 27 Y CA kL FGqGT LsV P #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################