################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:03 2021 # Report_file: c_0592_24.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00051.pdb # 2: usage_00052.pdb # 3: usage_00323.pdb # 4: usage_00324.pdb # 5: usage_00342.pdb # 6: usage_00343.pdb # 7: usage_00344.pdb # 8: usage_00696.pdb # # Length: 69 # Identity: 61/ 69 ( 88.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/ 69 ( 91.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 69 ( 7.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00051.pdb 1 -RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGI 59 usage_00052.pdb 1 RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGI 60 usage_00323.pdb 1 RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGI 60 usage_00324.pdb 1 RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGI 60 usage_00342.pdb 1 RRILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLEWMLPGGSGI 60 usage_00343.pdb 1 -RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGI 59 usage_00344.pdb 1 RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGI 60 usage_00696.pdb 1 RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLN--WPDLILLDWMLPGGSGI 58 RILVVEdEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLN WPDLILL WMLPGGSGI usage_00051.pdb 60 QFIKHLKRE 68 usage_00052.pdb 61 QFIKHLKR- 68 usage_00323.pdb 61 QFIKHLKR- 68 usage_00324.pdb 61 QFIKHLKR- 68 usage_00342.pdb 61 QFIKHLKRE 69 usage_00343.pdb 60 QFIKHLRR- 67 usage_00344.pdb 61 QFIKHLK-- 67 usage_00696.pdb 59 QFIKHLKRE 67 QFIKHLk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################