################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:05:00 2021 # Report_file: c_1306_135.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_01077.pdb # 2: usage_01078.pdb # 3: usage_01079.pdb # 4: usage_01080.pdb # 5: usage_01081.pdb # 6: usage_01085.pdb # 7: usage_01086.pdb # 8: usage_01087.pdb # 9: usage_01647.pdb # 10: usage_01648.pdb # 11: usage_01649.pdb # 12: usage_01650.pdb # 13: usage_01651.pdb # # Length: 33 # Identity: 24/ 33 ( 72.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 33 ( 72.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 33 ( 27.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01077.pdb 1 TEEFVEKMLEDLED-EFK-LPKEYSWPEKKLKV 31 usage_01078.pdb 1 TEEFVEKMLEDLEDEEFK-LPKEYSWPEKKLKV 32 usage_01079.pdb 1 -EEFVEKMLEDLE----K-LPKEYSWPEKKLKV 27 usage_01080.pdb 1 TEEFVEKMLEDLED--L--LPKEYSWPEKKLKV 29 usage_01081.pdb 1 -EEFVEKMLEDLE-----DLPKEYSWPEKKLKV 27 usage_01085.pdb 1 -EEFVEKMLEDLED--AA-LPKEYSWPEKKLKV 29 usage_01086.pdb 1 TEEFVEKMLEDLED---A-LPKEYSWPEKKLKV 29 usage_01087.pdb 1 TEEFVEKMLED------A-LPKEYSWPEKKLKV 26 usage_01647.pdb 1 TEEFVEKMLEDLE------LPKEYSWPEKKLKV 27 usage_01648.pdb 1 TEEFVEKMLEDLED--AA-LPKEYSWPEKKLKV 30 usage_01649.pdb 1 TEEFVEKMLEDLED---A-LPKEYSWPEKKLKV 29 usage_01650.pdb 1 TEEFVEKMLED------A-LPKEYSWPEKKLKV 26 usage_01651.pdb 1 TEEFVEKMLEDLED--LA-LPKEYSWPEKKLKV 30 EEFVEKMLED LPKEYSWPEKKLKV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################