################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:52 2021 # Report_file: c_0946_62.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00647.pdb # 2: usage_00648.pdb # 3: usage_00772.pdb # 4: usage_01001.pdb # 5: usage_01002.pdb # 6: usage_01161.pdb # 7: usage_01561.pdb # 8: usage_01562.pdb # 9: usage_01563.pdb # 10: usage_01564.pdb # # Length: 52 # Identity: 11/ 52 ( 21.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 52 ( 67.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 52 ( 21.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00647.pdb 1 -----AADVTQLADGKY-YMYYNACRGDSPRSAMGVAVA--DNIEGPYKNKG 44 usage_00648.pdb 1 -----AADVTQLADGKY-YMYYNACRGDSPRSAMGVAVA--DNIEGPYKNKG 44 usage_00772.pdb 1 GNVTDAPFIYRLDDGKLILWSSFR--KTDGKYAIGQAVSASGNVLGPWVQEP 50 usage_01001.pdb 1 -----APDVTQLEDGKF-Y-YYNACRGDSPRSALGLAVA--DDIEGPYKNKG 43 usage_01002.pdb 1 -----APDVTQLEDGKF-Y-YYNACRGDSPRSALGLAVA--DDIEGPYKNKG 43 usage_01161.pdb 1 -----AADVTQLADGKY-YMYYNACRGDSPRSAMGVAVA--DNIEGPYKNKG 44 usage_01561.pdb 1 -----AADVTQLADGKY-YMYYNACRGDSPRSAMGVAVA--DNIEGPYKNKG 44 usage_01562.pdb 1 -----AADVTQLADGKY-YMYYNACRGDSPRSAMGVAVA--DNIEGPYKNKG 44 usage_01563.pdb 1 -----AADVTQLADGKY-YMYYNACRGDSPRSAMGVAVA--DNIEGPYKNKG 44 usage_01564.pdb 1 -----AADVTQLADGKY-YMYYNACRGDSPRSAMGVAVA--DNIEGPYKNKG 44 A dvtqL DGK y yyna gdsprsA G AVa d ieGPyknkg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################