################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:41:41 2021 # Report_file: c_0611_54.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00189.pdb # 2: usage_00265.pdb # 3: usage_00307.pdb # 4: usage_00319.pdb # 5: usage_00360.pdb # 6: usage_00361.pdb # 7: usage_00629.pdb # # Length: 84 # Identity: 3/ 84 ( 3.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 84 ( 20.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 84 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00189.pdb 1 --PYIVAKMTELLA--LTPETKVLEIGTGSGYQTAVLAKLV---NHVFTVERIKTLQWDA 53 usage_00265.pdb 1 -APHMVAIMLEIAN--LKPGMNILEVGTGSGWNAALISEIVK--TDVYTIERIPELVEFA 55 usage_00307.pdb 1 ---HMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDS 57 usage_00319.pdb 1 -AIHMVGMMCELLD--LKPGMKVLEIGTGCGYHAAVTAEIVGEDGLVVSIERIPELAEKA 57 usage_00360.pdb 1 -QPYMVARMTELLE--LTPQSRVLEIGTGSGYQTAILAHLV---QHVCSVERIKGLQWQA 54 usage_00361.pdb 1 -QPYMVARMTELLE--LTPQSRVLEIGTGSGYQTAILAHLV---QHVCSVERIKGLQWQA 54 usage_00629.pdb 1 YERRKRALTLAALP--RERYRAIFEPGCANGELSADLAERC----DLVCCDTSTQAVELA 54 a e l l le G g G A a v v i l a usage_00189.pdb 54 KRRLKQLDIYNV-----ST-KH-- 69 usage_00265.pdb 56 KRNLERAGVKNV-----HV-IL-- 71 usage_00307.pdb 58 VNNVRKDDPTLLSSGRVQLV---- 77 usage_00319.pdb 58 ERTLRKLGYDNV-----IV-IV-- 73 usage_00360.pdb 55 RRRLKNLDLHNV-----ST-RH-- 70 usage_00361.pdb 55 RRRLKNLDLHNV-----ST-RH-- 70 usage_00629.pdb 55 RQRLA--DVPHA-----RV-VQAR 70 l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################