################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:07 2021 # Report_file: c_0437_10.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00018.pdb # 2: usage_00019.pdb # 3: usage_00026.pdb # 4: usage_00043.pdb # 5: usage_00046.pdb # 6: usage_00060.pdb # # Length: 70 # Identity: 14/ 70 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 70 ( 37.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 70 ( 5.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 MVVTADEPITSPEDFDNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQE 60 usage_00019.pdb 1 MVVTADEPITSPEDFDNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQE 60 usage_00026.pdb 1 -NFTSNKPISTIADYKGQSFRVMDSKILIEQFAAIGASAIALPFGELYTALQNGVVDGEE 59 usage_00043.pdb 1 RNLTSQRPITSPADLDG-K-RVPNVPLFVDVWSALGASPTP-AFSEVFTSLQNGVIDGQE 57 usage_00046.pdb 1 -VLTTNKPVTTLEDLKGLKIRVSPNDIAIKTFRAWGIEPLP-DWAEVFPALQQRVIDGQE 58 usage_00060.pdb 1 RNLTSQRPITSPADLDG-K-RVPNVPLFVDVWSALGASPTP-AFSEVFTSLQNGVIDGQE 57 T Pit D k R A Ga p p Ev LQ g iDGqE usage_00018.pdb 61 NPIFWIESGG 70 usage_00019.pdb 61 NPIFWIESGG 70 usage_00026.pdb 60 NPLDTIQRMK 69 usage_00043.pdb 58 NPLALIRSAN 67 usage_00046.pdb 59 NPYTTAISSR 68 usage_00060.pdb 58 NPLALIRSAN 67 NP i s #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################