################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:05:40 2021 # Report_file: c_0512_84.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00144.pdb # 2: usage_00226.pdb # 3: usage_00227.pdb # 4: usage_00456.pdb # # Length: 132 # Identity: 51/132 ( 38.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 70/132 ( 53.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/132 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00144.pdb 1 NEAINIKDFNLMKWIGANSFRTSHYPYSEEIMRLADREGIVVIDETPAVGLHLNFMAT-- 58 usage_00226.pdb 1 -WPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLAL------- 52 usage_00227.pdb 1 -WPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLAL------- 52 usage_00456.pdb 1 DDAYMVHDFQLLHWMGANSFRTSHYPYAEEVMEYADRQGIVVIDETPAVGLAF-----SP 55 vkDFnLl W GAN FRTSHYPYaEEvM DR GIVVIDE P VGLal usage_00144.pdb 59 ---GFGGDAPKRDTWKEIGTKEAHERILRELVSRDKNHPCVVMWSVANEPDSDSEGAKEY 115 usage_00226.pdb 53 -P---QF-----FNN---VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYY 100 usage_00227.pdb 53 -P---QF-----FNN---VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYY 100 usage_00456.pdb 56 ATFSPDR-----INN---KTREAHAQAIRELIHRDKNHPSVVMWSIANDPASNEDGAREY 107 nn H q E v RDKNHP VVMWSvANePaS e A Y usage_00144.pdb 116 FEPLIKLTKELD 127 usage_00226.pdb 101 LKMVIAHTKSL- 111 usage_00227.pdb 101 LKMVIAHTKSL- 111 usage_00456.pdb 108 FAPLPKLARQLD 119 i tk L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################