################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:16 2021 # Report_file: c_1198_64.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00100.pdb # 2: usage_00243.pdb # 3: usage_00339.pdb # 4: usage_00340.pdb # 5: usage_00653.pdb # 6: usage_00727.pdb # 7: usage_01218.pdb # 8: usage_02022.pdb # 9: usage_02023.pdb # 10: usage_02304.pdb # 11: usage_02345.pdb # 12: usage_02355.pdb # # Length: 32 # Identity: 10/ 32 ( 31.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 32 ( 59.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 32 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00100.pdb 1 KKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYP 32 usage_00243.pdb 1 -RQVKPEAWLSHGPSPGPGHLQLVCHVSGFYP 31 usage_00339.pdb 1 -RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP 31 usage_00340.pdb 1 QRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP 32 usage_00653.pdb 1 -KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYP 31 usage_00727.pdb 1 QRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP 32 usage_01218.pdb 1 ERQVPPMAVVFARTA----QLLLVCRVTSFYP 28 usage_02022.pdb 1 -RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP 31 usage_02023.pdb 1 QRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP 32 usage_02304.pdb 1 ----KPEAWLSSGPSPGPGRLQLVCHVSGFYP 28 usage_02345.pdb 1 -RQVKPEAWLSSGPTPGPGRLLLVCHVSGFYP 31 usage_02355.pdb 1 -KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYP 31 kP Awls gp L LVChVsgFYP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################