################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:27 2021 # Report_file: c_1491_161.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00088.pdb # 2: usage_00597.pdb # 3: usage_01032.pdb # 4: usage_01033.pdb # 5: usage_01034.pdb # 6: usage_03120.pdb # 7: usage_03208.pdb # 8: usage_03209.pdb # 9: usage_03210.pdb # # Length: 37 # Identity: 29/ 37 ( 78.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 37 ( 86.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 37 ( 13.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00088.pdb 1 --LLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYI 35 usage_00597.pdb 1 --LLALEQMHRNPKTRRGENEWVDKIWELLDAID--- 32 usage_01032.pdb 1 --LLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYI 35 usage_01033.pdb 1 SALLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYI 37 usage_01034.pdb 1 --LLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYI 35 usage_03120.pdb 1 -ALLALEEMHKNPKTKRGENEWVDKIWELLDAIDE-- 34 usage_03208.pdb 1 --LLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYI 35 usage_03209.pdb 1 --LLALEQMHRNPKTRRGENEWVDKIWELLDAIDE-- 33 usage_03210.pdb 1 --LLALEQMHRNPKTRRGENEWVDKIWELLDAIDE-- 33 LLALEqMHrNPKTrRGENEWVDKIWELLDAID #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################