################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:08 2021 # Report_file: c_1078_29.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00117.pdb # 2: usage_00118.pdb # 3: usage_00235.pdb # 4: usage_00238.pdb # 5: usage_00301.pdb # 6: usage_00302.pdb # 7: usage_00335.pdb # # Length: 52 # Identity: 19/ 52 ( 36.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 52 ( 38.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 52 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00117.pdb 1 -RDEVLAAINVKNLIDVRSPDEFSGKILAP---------QRPGHIPGAINVP 42 usage_00118.pdb 1 -RDEVLAAINVKNLIDVRSPDEFSGKILAPAHLP-----QRPGHIPGAINVP 46 usage_00235.pdb 1 -RDEVLAAINVKNLIDVRSPDEFSGKILAPHLP-Q-EQSQRPGHIPGAINVP 49 usage_00238.pdb 1 -RDEVLAAINVKNLIDVRSPDEFSGKILAPAHL-PQEQSQRPGHIPGAINVP 50 usage_00301.pdb 1 -KDDVLRVLGKEPLIDVRSPQEYTGERT----P--EEGALRGGHIPTAVSVP 45 usage_00302.pdb 1 -KDDVLRVLGKEPLIDVRSPQEYTGER--------EEGALRGGHIPTAVSVP 43 usage_00335.pdb 1 FRDDVLAILGAQPLIDVRSPEEYTGKRTHMPDY-PEEGALRAGHIPTAVHIP 51 D VL LIDVRSP E G R GHIP A vP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################