################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:16:08 2021
# Report_file: c_1214_54.html
################################################################################################
#====================================
# Aligned_structures: 16
#   1: usage_00049.pdb
#   2: usage_00050.pdb
#   3: usage_00186.pdb
#   4: usage_00187.pdb
#   5: usage_00188.pdb
#   6: usage_00189.pdb
#   7: usage_00191.pdb
#   8: usage_00192.pdb
#   9: usage_00193.pdb
#  10: usage_00194.pdb
#  11: usage_00317.pdb
#  12: usage_00587.pdb
#  13: usage_00604.pdb
#  14: usage_00605.pdb
#  15: usage_00679.pdb
#  16: usage_00680.pdb
#
# Length:         30
# Identity:       10/ 30 ( 33.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     25/ 30 ( 83.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            5/ 30 ( 16.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00049.pdb         1  TPLVRKEGRLVEATWEEAFLALKEGL----   26
usage_00050.pdb         1  TPLVRKEGRLVEATWEEAFLALKEGL----   26
usage_00186.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00187.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00188.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00189.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00191.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00192.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00193.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00194.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00317.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00587.pdb         1  KPLIRKNGEFVEVSYDEAIDKAAKILAES-   29
usage_00604.pdb         1  TPLVRKEGRLVEATWEEAFLALKEGLKEAR   30
usage_00605.pdb         1  TPLVRKEGRLVEATWEEAFLALKEGL----   26
usage_00679.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
usage_00680.pdb         1  -PLVRKEGRLVEATWEEAFLALKEGL----   25
                            PLvRKeGrlVEatweEAflalkegL    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################