################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:40:56 2021 # Report_file: c_0490_12.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00010.pdb # 2: usage_00037.pdb # 3: usage_00038.pdb # 4: usage_00095.pdb # 5: usage_00105.pdb # 6: usage_00138.pdb # 7: usage_00144.pdb # # Length: 73 # Identity: 17/ 73 ( 23.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 73 ( 68.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 73 ( 17.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 SGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDFYDLYGGEKF 60 usage_00037.pdb 1 TGVEAENLLLTRGVDGSFLARPSKSNPGDLTLSVRRNGAVTHIKIQNTGDYYDLYGGEKF 60 usage_00038.pdb 1 TGVEAENLLLTRGVDGSFLARPSKSNPGDLTLSVRRNGAVTHIKIQNTGDYYDLYGGEKF 60 usage_00095.pdb 1 TGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKF 60 usage_00105.pdb 1 TGVEAENLLLTRGVDGSFLARPS---PGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKF 57 usage_00138.pdb 1 -------LLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYY 53 usage_00144.pdb 1 TGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKF 60 LL trGv gSFLaRPS pGD LsvR n vthikIqntgd ydlyGGekf usage_00010.pdb 61 ATLTELVEYYTQQ 73 usage_00037.pdb 61 ATLAELVQYYMEH 73 usage_00038.pdb 61 ATLAELVQYYMEH 73 usage_00095.pdb 61 ATLAELVQYY--- 70 usage_00105.pdb 58 ATLAELVQYYMEH 70 usage_00138.pdb 54 NSIGDIIDHYRKE 66 usage_00144.pdb 61 ATLAELVQYYME- 72 atl elv yY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################