################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:01 2021 # Report_file: c_1388_15.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00005.pdb # 2: usage_00187.pdb # 3: usage_00188.pdb # 4: usage_00189.pdb # 5: usage_00237.pdb # 6: usage_00241.pdb # 7: usage_00543.pdb # 8: usage_00557.pdb # # Length: 76 # Identity: 16/ 76 ( 21.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 76 ( 44.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 76 ( 14.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 KSAKDALLLWCQMKTAGYP-NVNIHNFTTSWRDGMAFNALIHKHRPDLID-FDKLKKSNA 58 usage_00187.pdb 1 --AKEGLLLWCQRKTAPYR-NVNIQNFHTSWKDGLGLCALIHRHRPDLID-YSKLNKDDP 56 usage_00188.pdb 1 --AKEGLLLWCQRKTAPYR-NVNIQNFHTSWKDGLGLCALIHRHRPDLID-YSKLNKDDP 56 usage_00189.pdb 1 --AKEGLLLWCQRKTAPYR-NVNIQNFHTSWKDGLGLCALIHRHRPDLID-YSKLNKDDP 56 usage_00237.pdb 1 --AKEGLLLWCQRKTANYHPEVDVQDFTRSWTNGLAFCALIHQHRPDLLD-YNKLDKKNH 57 usage_00241.pdb 1 --AKEGLLLWCQRKTAPYR-NVNVQNFHTSWKDGLALCALIHRHRPDLID-YAKLRKDDP 56 usage_00543.pdb 1 --PKQRLLGWIQNKLP-Q---LPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKP 54 usage_00557.pdb 1 --AKEGLLLWCQRKTAPYR-NVNIQNFHTSWKDGLGLCALIHRHRPDLID-YSKLNKDDP 56 aK LLlWcQ Kta y v nF sW G ALih hrPdL d kl k usage_00005.pdb 59 HYNLQNAFNLAEQHLG 74 usage_00187.pdb 57 IGNINLAMEIAEKHLD 72 usage_00188.pdb 57 IGNINLAMEIAEK--- 69 usage_00189.pdb 57 IGNINLAMEIAE---- 68 usage_00237.pdb 58 RANMQLAFDIAQKSIG 73 usage_00241.pdb 57 IGNLNTAFEVAEKYLD 72 usage_00543.pdb 55 VTNAREAMQQADDWLG 70 usage_00557.pdb 57 IGNINLAMEIAEKHLD 72 N A A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################