################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:08 2021 # Report_file: c_1366_75.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00071.pdb # 2: usage_00172.pdb # 3: usage_00173.pdb # 4: usage_00174.pdb # 5: usage_00438.pdb # 6: usage_00509.pdb # 7: usage_00510.pdb # 8: usage_00983.pdb # 9: usage_00984.pdb # 10: usage_01002.pdb # 11: usage_01035.pdb # 12: usage_01092.pdb # 13: usage_01101.pdb # # Length: 41 # Identity: 10/ 41 ( 24.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 41 ( 24.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 41 ( 2.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00071.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 usage_00172.pdb 1 -GRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 40 usage_00173.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 usage_00174.pdb 1 -GRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 40 usage_00438.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 usage_00509.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 usage_00510.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 usage_00983.pdb 1 -GRAEITQALKLISQDVLDAKINPGDITEELIGNYLFTQHL 40 usage_00984.pdb 1 -GRAEITQALKLISQDVLDAKINPGDITEELIGNYLFTQHL 40 usage_01002.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 usage_01035.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 usage_01092.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 usage_01101.pdb 1 GGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHEL 41 GR I Q V P I EE L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################