################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:12:42 2021
# Report_file: c_1483_40.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00165.pdb
#   2: usage_00197.pdb
#   3: usage_00650.pdb
#   4: usage_00651.pdb
#   5: usage_00764.pdb
#   6: usage_01184.pdb
#   7: usage_01257.pdb
#   8: usage_01365.pdb
#   9: usage_01371.pdb
#  10: usage_01377.pdb
#  11: usage_01892.pdb
#  12: usage_02625.pdb
#
# Length:         40
# Identity:        1/ 40 (  2.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      3/ 40 (  7.5%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           14/ 40 ( 35.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00165.pdb         1  -NEAIYDICRRNLDIERPTYTNLNRLIGQIVSSIT-----   34
usage_00197.pdb         1  -NEALFDLAHRKWNIESPTVDDLNLLITEALAGIT-----   34
usage_00650.pdb         1  -NEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRF   39
usage_00651.pdb         1  -NEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRF   39
usage_00764.pdb         1  -NEAIYDICRRNLDIERPTYTNLNRLISQIVSSIT-----   34
usage_01184.pdb         1  DNEAIYDICRRNLDIERPTYTNLNRLISQIVSSIT-----   35
usage_01257.pdb         1  DAYGRWLAKNKDVEEPSFAYDYVLSLD-------------   27
usage_01365.pdb         1  DNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVT-----   35
usage_01371.pdb         1  DNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVT-----   35
usage_01377.pdb         1  DNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVT-----   35
usage_01892.pdb         1  -NASLLNISGKVFRNPNIDLQHTNQLISTIISSVTN----   35
usage_02625.pdb         1  -NEAIYDICRRNLDIERPTYTNLNRLISQIVSSIT-----   34
                            n                     n L              


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################