################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:18 2021 # Report_file: c_1192_116.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00057.pdb # 2: usage_00299.pdb # 3: usage_01003.pdb # 4: usage_01008.pdb # 5: usage_01019.pdb # 6: usage_01198.pdb # 7: usage_01199.pdb # 8: usage_01541.pdb # 9: usage_01543.pdb # 10: usage_01545.pdb # 11: usage_01814.pdb # 12: usage_01998.pdb # # Length: 34 # Identity: 11/ 34 ( 32.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 34 ( 32.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 34 ( 8.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00057.pdb 1 -YVIRDSGDRIDLRYSKRAGD-IQLQYGWKVER- 31 usage_00299.pdb 1 KYVIRDSGDRIDLRYSKRAGD-IQLQYGWKVERH 33 usage_01003.pdb 1 -YVIRDSGDRIDLRYSKRAGD-IQLQYGWKVERH 32 usage_01008.pdb 1 KYVIRDSGDRIDLRYSKRAGD-IQLQYGWKVERH 33 usage_01019.pdb 1 -YVIRDSGDRIDLRYSKRAGD-IQLQYGWKVERH 32 usage_01198.pdb 1 -YVIDPEGRRIRLMESNRELIAEKLDIGWTVERH 33 usage_01199.pdb 1 -YVIDPEGRRIRLMESNRELIAEKLDIGWTVERH 33 usage_01541.pdb 1 KYIIRDNGDRIDLRFHPKPSD-LHLQTGYKVERH 33 usage_01543.pdb 1 -YIIRDNGDRIDLRFHPKPSD-LHLQTGYKVERH 32 usage_01545.pdb 1 -YIIRDNGDRIDLRFHPKPSD-LHLQTGYKVERH 32 usage_01814.pdb 1 -YVIRDSGDRIDLRYSKRAGD-IQLQYGWKVER- 31 usage_01998.pdb 1 KYIIRDNGDRIDLRFHPKPSD-LHLQTGYKVERH 33 Y I G RI L L G VER #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################