################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:20:08 2021 # Report_file: c_1428_138.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00202.pdb # 2: usage_00371.pdb # 3: usage_00990.pdb # 4: usage_01434.pdb # 5: usage_02001.pdb # # Length: 68 # Identity: 8/ 68 ( 11.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 68 ( 22.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 68 ( 33.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00202.pdb 1 PPDHTRLRRLVGKAFTARRVEEMRPRVRSLVDSLLDDMVAHGS---PADLVEFLAVPFPV 57 usage_00371.pdb 1 ---------------TPEAVKNLQPYIQRTVDDLLEQMKQKGCANGPVDLVKEFALPVPS 45 usage_00990.pdb 1 ---------------TMRRVEALRPRIQEITDGLLDEMLPR-G---RADLVDSFAYPLPI 41 usage_01434.pdb 1 ---------------TPRRITAVQPFVRSTVEQLIDKL--PQG---DFDFVQHFPHPLPA 40 usage_02001.pdb 1 ---------------TPRRITAVQPFVRSTVEQLIDKL--PQG---DFDFVQHFPHPLPA 40 T rr P v L d D V f P P usage_00202.pdb 58 AVICELLG 65 usage_00371.pdb 46 YIIYTLLG 53 usage_00990.pdb 42 TVICELL- 48 usage_01434.pdb 41 LVMCQL-- 46 usage_02001.pdb 41 LVMCQLL- 47 v c L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################