################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:38:08 2021 # Report_file: c_1221_7.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00067.pdb # 2: usage_00068.pdb # 3: usage_00395.pdb # 4: usage_00396.pdb # 5: usage_00397.pdb # 6: usage_00398.pdb # 7: usage_02274.pdb # # Length: 66 # Identity: 48/ 66 ( 72.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 66 ( 72.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 66 ( 27.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00067.pdb 1 KNTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSHPERTADHGMDDLKSSFPFLDLCAMLV 60 usage_00068.pdb 1 -NTYAYIELQLYEVMPGCFMLDVKSNGYKDIY-----------DDLKSSFPFLDLCAMLV 48 usage_00395.pdb 1 -NTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSH----------DLKSSFPFLDLCAMLV 49 usage_00396.pdb 1 -NTYAYIELQLYEVMPGCFMLDVKSNGYKDI---------------KSSFPFLDLCAMLV 44 usage_00397.pdb 1 -NTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSH----------DLKSSFPFLDLCAMLV 49 usage_00398.pdb 1 -NTYAYIELQLYEVMPGCFMLDVKSNGYKDI---------------KSSFPFLDLCAMLV 44 usage_02274.pdb 1 --TYAYIELQLYEVMPGCFMLDVKSNGYKDIYS-------------KSSFPFLDLCAMLV 45 TYAYIELQLYEVMPGCFMLDVKSNGYKDI KSSFPFLDLCAMLV usage_00067.pdb 61 CKLFS- 65 usage_00068.pdb 49 CKLFS- 53 usage_00395.pdb 50 CKLFSA 55 usage_00396.pdb 45 CKLFSA 50 usage_00397.pdb 50 CKLFSA 55 usage_00398.pdb 45 CKLFSA 50 usage_02274.pdb 46 CKLFSA 51 CKLFS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################