################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:58 2021 # Report_file: c_1261_122.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_01212.pdb # 2: usage_01214.pdb # 3: usage_01216.pdb # 4: usage_02572.pdb # 5: usage_02574.pdb # 6: usage_02576.pdb # 7: usage_02578.pdb # 8: usage_02580.pdb # 9: usage_02582.pdb # 10: usage_02598.pdb # 11: usage_02600.pdb # 12: usage_02602.pdb # 13: usage_04595.pdb # # Length: 36 # Identity: 9/ 36 ( 25.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 36 ( 83.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 36 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01212.pdb 1 NSRTVLILCGDYE-DYE-VVPFQALQAFGITVHTVC 34 usage_01214.pdb 1 NSRTVLILCGDYE-DYE-VVPFQALQAFGITVHTVC 34 usage_01216.pdb 1 NSRTVLILCGDYE-DYE-VVPFQALQAFGITVHTVC 34 usage_02572.pdb 1 -SRTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 35 usage_02574.pdb 1 --RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 34 usage_02576.pdb 1 --RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 34 usage_02578.pdb 1 -SRTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 35 usage_02580.pdb 1 --RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 34 usage_02582.pdb 1 --RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 34 usage_02598.pdb 1 --RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 34 usage_02600.pdb 1 --RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 34 usage_02602.pdb 1 --RTVLILCGDYMEDYEVMVPFQALQAFGITVHTVC 34 usage_04595.pdb 1 ASMKVLFLSADGFEDLELIYPLHRIKEEGHEVYVAS 36 rtVLiLcgDy DyE vPfqalqafGitVhtvc #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################