################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:06:48 2021 # Report_file: c_0800_15.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00027.pdb # 2: usage_00157.pdb # 3: usage_00158.pdb # 4: usage_00178.pdb # # Length: 102 # Identity: 16/102 ( 15.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/102 ( 37.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 33/102 ( 32.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00027.pdb 1 AVLEFRVSEEVLLERLKG--R------------------------GRADDTDDVILNRMK 34 usage_00157.pdb 1 --IHIDVRQEELMERLTG--RRITYHL---VFN-----PPKTP-YQRADDNEETVAKRLE 47 usage_00158.pdb 1 --IHIDVRQEELMERLTG--RRITYHL---VFN-----PPKTPLYQRADDNEETVAKRLE 48 usage_00178.pdb 1 --INIEVNPDSLLERLSGRIIHRVTGETFHPVDYKEED-----YYQREDDKPETVKRRLD 53 i i V e L ERL G r qRaDD etv Rl usage_00027.pdb 35 VYRDETAPLLEYYR--DQLKTVDAVGTMDEVFARALRALG-- 72 usage_00157.pdb 48 VNMKQMKPLLAFYDSKEVLRNVNGEQDMEKVFKDLRELL--- 86 usage_00158.pdb 49 VNMKQMKPLLAFYDSKEVLRNVNGEQDMEKVFKDLRELLQG- 89 usage_00178.pdb 54 VNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNL 95 Vn q Plla Y l v g qdm VF d L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################