################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:14 2021 # Report_file: c_0629_8.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00044.pdb # 2: usage_00045.pdb # 3: usage_00066.pdb # 4: usage_00155.pdb # 5: usage_00156.pdb # 6: usage_00157.pdb # 7: usage_00190.pdb # 8: usage_00191.pdb # 9: usage_00236.pdb # # Length: 75 # Identity: 18/ 75 ( 24.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 75 ( 26.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 75 ( 18.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00044.pdb 1 -IPNIIHNHGKPITLSNLVSILQI--PSTKVDNVQRLMRYLAHNGFFEIITNQE--LE-N 54 usage_00045.pdb 1 NIPNIIHNHGKPITLSNLVSILQI--PSTKVDNVQRLMRYLAHNGFFEIITNQE--LE-N 55 usage_00066.pdb 1 -IPNIIQNHGKPISLSNLVSILQV--PSSKIGNVRRLMRYLAHNGFFEIITK-------- 49 usage_00155.pdb 1 GIADAIHNHGKPMTLSELASSLKL--HPSKVNILHRFLRLLTHNGFFAKTIVKGKEGDEE 58 usage_00156.pdb 1 GIADAIHNHGKPMTLSELASSLKL--HPSKVNILHRFLRLLTHNGFFAKTIVKGKEGDEE 58 usage_00157.pdb 1 GIADAIHNHGKPMTLSELASSLKL--HPSKVNILHRFLRLLTHNGFFAKTIVKGKEGDEE 58 usage_00190.pdb 1 DLANIIHNHGSPMTLSELSLHLPSQP--VNQDALYRVLRYLVHMKLFTKSSID------- 51 usage_00191.pdb 1 -LANIIHNHGSPMTLSELSLHLPSQP--VNQDALYRVLRYLVHMKLFTKSSID------- 50 usage_00236.pdb 1 GIADAIHNHGKPMTLSELASSLKL--HPSKVNILHRFLRLLTHNGFFAKTIVKGKEGDEE 58 IhNHG P tLS L L R R L H F usage_00044.pdb 55 EEEAYALTVASELLV 69 usage_00045.pdb 56 EEEAYALTVASELLV 70 usage_00066.pdb 50 EEESYALTVASELLV 64 usage_00155.pdb 59 EEIAYSLTPPSKLLI 73 usage_00156.pdb 59 EEIAYSLTPPSKLLI 73 usage_00157.pdb 59 EEIAYSLTPPSKLLI 73 usage_00190.pdb 52 GELRYGLAPPAKFL- 65 usage_00191.pdb 51 GELRYGLAPPAKFL- 64 usage_00236.pdb 59 EEIAYSLTPPSKLLI 73 E Y L L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################