################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:07 2021 # Report_file: c_0761_34.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00198.pdb # 2: usage_00200.pdb # 3: usage_00201.pdb # 4: usage_00202.pdb # 5: usage_00203.pdb # 6: usage_00282.pdb # 7: usage_00283.pdb # # Length: 71 # Identity: 22/ 71 ( 31.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 71 ( 63.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 71 ( 15.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00198.pdb 1 -KEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRD-GLRIAIELK-KDNT 57 usage_00200.pdb 1 GRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANA 60 usage_00201.pdb 1 GRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANA 60 usage_00202.pdb 1 GRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANA 60 usage_00203.pdb 1 GRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANA 60 usage_00282.pdb 1 -------TELPYQVNKAKLIEKIADLVRDKKIEGITDLRDESDRT-GMRIVIEIRRDANA 52 usage_00283.pdb 1 -KERIIVTELPYQVNKAKLIEKIADLVRDKKIEGITDLRDESDRT-GMRIVIEIRRDANA 58 TE P qvNKA ieKIa lvrdkKi GItdlRDE G R vI r daNa usage_00198.pdb 58 ELVLNYLFK-- 66 usage_00200.pdb 61 SVILNNLYK-- 69 usage_00201.pdb 61 SVILNNLYK-- 69 usage_00202.pdb 61 SVILNNLYK-- 69 usage_00203.pdb 61 SVILNNLYKQT 71 usage_00282.pdb 53 NVILNNLYKQ- 62 usage_00283.pdb 59 NVILNNLYKQ- 68 viLNnLyK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################