################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:05:00 2021 # Report_file: c_1306_121.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00397.pdb # 2: usage_00398.pdb # 3: usage_00624.pdb # 4: usage_00626.pdb # 5: usage_00627.pdb # 6: usage_00628.pdb # 7: usage_00629.pdb # 8: usage_00923.pdb # 9: usage_00990.pdb # 10: usage_01049.pdb # 11: usage_01212.pdb # 12: usage_01282.pdb # 13: usage_01283.pdb # # Length: 33 # Identity: 5/ 33 ( 15.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 33 ( 57.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 33 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00397.pdb 1 PLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQW 33 usage_00398.pdb 1 -LDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQW 32 usage_00624.pdb 1 -LEVLKLGEQMTQEAREHLYLVLFFDNKRTWQW 32 usage_00626.pdb 1 PLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQW 33 usage_00627.pdb 1 -LEVLKLGEQMTQEAREHLYLVLFFDNKRTWQW 32 usage_00628.pdb 1 -LEVLKLGEQMTQEAREHLYLVLFFDNKRTWQW 32 usage_00629.pdb 1 -LEVLKLGEQMTQEAREHLYLVLFFDNKRTWQW 32 usage_00923.pdb 1 -LEVLKLGEQMTQEAREHLYLVLFFDNKRTWQW 32 usage_00990.pdb 1 -LDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQW 32 usage_01049.pdb 1 PLEVLKLGEQMTQEAREHLYLVLFFDNKRTWQW 33 usage_01212.pdb 1 YEAETIFFEVLRKVSPC-F-LAMDF-NSKRYGW 30 usage_01282.pdb 1 -LDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQW 32 usage_01283.pdb 1 -LDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQW 32 l vlk gE e l LvlfF Nkr wqW #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################