################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:40:54 2021
# Report_file: c_1477_45.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00107.pdb
#   2: usage_00108.pdb
#   3: usage_00194.pdb
#   4: usage_00195.pdb
#   5: usage_00297.pdb
#   6: usage_00586.pdb
#   7: usage_00587.pdb
#   8: usage_00588.pdb
#   9: usage_00589.pdb
#  10: usage_01122.pdb
#  11: usage_01325.pdb
#
# Length:         41
# Identity:       10/ 41 ( 24.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     10/ 41 ( 24.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           13/ 41 ( 31.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00107.pdb         1  PSKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEWEVGN   41
usage_00108.pdb         1  -SKLLEKFDQIIEEIGYENRSEAIRDLIRDFIIRHEW----   36
usage_00194.pdb         1  QQNLLDELDNRIIKNGYSSRSELVRDMIREKLV--------   33
usage_00195.pdb         1  -QNLLDELDNRIIKNGYSSRSELVRDMIRE-----------   29
usage_00297.pdb         1  DDDLLETLDSLSQRR-YNNRSEAIRDILRSALA--------   32
usage_00586.pdb         1  -QNLLDELDNRIIKNGYSSRSELVRDMIREKLVE-------   33
usage_00587.pdb         1  -QNLLDELDNRIIKNGYSSRSELVRDMIREKLVE-------   33
usage_00588.pdb         1  QQNLLDELDNRIIKNGYSSRSELVRDMIREKLV--------   33
usage_00589.pdb         1  -QNLLDELDNRIIKNGYSSRSELVRDMIREKLV--------   32
usage_01122.pdb         1  -DDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEAT----   36
usage_01325.pdb         1  QQNLLDELDNRIIKNGYSSRSELVRDMIREKLVE-------   34
                              LL   D       Y  RSE  RD  R            


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################