################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:14:11 2021 # Report_file: c_0644_15.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00072.pdb # 2: usage_00073.pdb # 3: usage_00074.pdb # 4: usage_00117.pdb # 5: usage_00118.pdb # 6: usage_00129.pdb # 7: usage_00160.pdb # 8: usage_00161.pdb # 9: usage_00163.pdb # 10: usage_00186.pdb # 11: usage_00190.pdb # 12: usage_00192.pdb # 13: usage_00208.pdb # 14: usage_00236.pdb # # Length: 53 # Identity: 5/ 53 ( 9.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 53 ( 18.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 53 ( 11.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00072.pdb 1 DRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTIT 53 usage_00073.pdb 1 -RLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTIT 52 usage_00074.pdb 1 DRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTIT 53 usage_00117.pdb 1 DRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTIT 53 usage_00118.pdb 1 DRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTIT 53 usage_00129.pdb 1 -CAYIIVTGTITLFHEGDEGRVTIR-PVGPGAILGE-ALIAQTTRLTGAVA-- 48 usage_00160.pdb 1 DRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATT-- 51 usage_00161.pdb 1 DRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATT-- 51 usage_00163.pdb 1 -RLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVT 52 usage_00186.pdb 1 -ALYLVASGKVRLFRTHLGGQERTLALLGPGELFGEMSLLDEGERSASAVA-- 50 usage_00190.pdb 1 DRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVT 53 usage_00192.pdb 1 DLLYVIDQGEVEIYKTKENNKKEVLTVLKSKDVFGELALLYNSKRAATATALT 53 usage_00208.pdb 1 DRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTIT 53 usage_00236.pdb 1 -CLYIVQSGELNCSKLIDG-EERVVKVVGPGDAFGELALLYNAPRAATVTSVS 51 lY G gp fGE R a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################