################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:17 2021 # Report_file: c_0903_17.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00011.pdb # 2: usage_00035.pdb # 3: usage_00052.pdb # 4: usage_00060.pdb # 5: usage_00263.pdb # 6: usage_00652.pdb # 7: usage_00726.pdb # 8: usage_00727.pdb # # Length: 68 # Identity: 50/ 68 ( 73.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 68 ( 73.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 68 ( 26.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00011.pdb 1 DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSL---------NRPFLVFIREVPLNTI 51 usage_00035.pdb 1 -----DAFHKAFLEVNEEGSEAAASTAVVIAGRSL----------RPFLVFIREVPLNTI 45 usage_00052.pdb 1 -----DAFHKAFLEVNEEGSEAAASTAVVIAGRSLPNR-VTFKANRPFLVFIREVPLNTI 54 usage_00060.pdb 1 DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSL---------NRPFLVFIREVPLNTI 51 usage_00263.pdb 1 DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPN-RVTKANRPFLVFIREVPLNTI 59 usage_00652.pdb 1 DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSL------FKANRPFLVFIREVPLNTI 54 usage_00726.pdb 1 DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTI 60 usage_00727.pdb 1 DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTI 60 DAFHKAFLEVNEEGSEAAASTAVVIAGRSL RPFLVFIREVPLNTI usage_00011.pdb 52 IFMGRVAN 59 usage_00035.pdb 46 IFMGRVAN 53 usage_00052.pdb 55 IFMGRVAN 62 usage_00060.pdb 52 IFMGRVA- 58 usage_00263.pdb 60 IFMGR--- 64 usage_00652.pdb 55 IFMGR--- 59 usage_00726.pdb 61 IFMGRVAN 68 usage_00727.pdb 61 IFMGRVA- 67 IFMGR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################