################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:30 2021 # Report_file: c_0398_74.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00206.pdb # 2: usage_00208.pdb # 3: usage_00309.pdb # 4: usage_00562.pdb # 5: usage_00564.pdb # 6: usage_00866.pdb # 7: usage_00868.pdb # # Length: 73 # Identity: 8/ 73 ( 11.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 73 ( 68.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 73 ( 31.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00206.pdb 1 -D---------VKHTMPDQRVIYYYAEAQTTHITYPDGMEVLQFPNNQTEKHFPD-G-RK 48 usage_00208.pdb 1 -----------RLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYA-EAQTT 48 usage_00309.pdb 1 -----------RLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYA-EAQTT 48 usage_00562.pdb 1 -----------RLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYA-EAQTT 48 usage_00564.pdb 1 -G---------RLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYA-EAQTT 49 usage_00866.pdb 1 -KIEKMLPDGGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYA-EAQTT 58 usage_00868.pdb 1 SKIEKMLPDGGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYA-EAQTT 59 rlvvfPngtrkelsAdgQTvkvmffnGdvkhtmPdqrviyyya a tt usage_00206.pdb 49 EITFPDQTVKTLH 61 usage_00208.pdb 49 HITYPDGMEVLQF 61 usage_00309.pdb 49 HITYPDGMEVLQF 61 usage_00562.pdb 49 HITYPDGMEVLQF 61 usage_00564.pdb 50 HITYPDGMEVLQF 62 usage_00866.pdb 59 HITYP-------- 63 usage_00868.pdb 60 HITY--------- 63 hITy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################