################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:18 2021 # Report_file: c_0771_21.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00057.pdb # 2: usage_00058.pdb # 3: usage_00059.pdb # 4: usage_00159.pdb # 5: usage_00236.pdb # 6: usage_00237.pdb # 7: usage_00424.pdb # 8: usage_00425.pdb # 9: usage_00426.pdb # 10: usage_00427.pdb # # Length: 53 # Identity: 18/ 53 ( 34.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 53 ( 39.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 53 ( 5.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00057.pdb 1 DVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDILHARGILYAP-- 51 usage_00058.pdb 1 DVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDILHARGILYA--- 50 usage_00059.pdb 1 DVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDILHARGILYA--- 50 usage_00159.pdb 1 DIFAPCALGAIINDETIPQLKAKVIAGSANNQLKETRHGDLIHEMGIVYA--- 50 usage_00236.pdb 1 DIFAPCALGAVLNDFTIPQLKAKVIAGSADNQLKDPRHGKYLHELGIVYAPDY 53 usage_00237.pdb 1 DIFAPCALGAVLNDFTIPQLKAKVIAGSADNQLKDPRHGKYLHELGIVYAP-- 51 usage_00424.pdb 1 DVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDILHARGILYAP-- 51 usage_00425.pdb 1 DVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDILHARGILYA--- 50 usage_00426.pdb 1 DVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDILHARGILYAP-- 51 usage_00427.pdb 1 DVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDILHARGILYAP-- 51 D FAPCA G v L V AG A N d lH GI YA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################