################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:07:08 2021 # Report_file: c_0888_82.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00040.pdb # 2: usage_00096.pdb # 3: usage_00738.pdb # 4: usage_00746.pdb # # Length: 98 # Identity: 15/ 98 ( 15.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 98 ( 40.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 98 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00040.pdb 1 -FLQFAGLSSQVLIDENTKLEGRILAALTLKNELVSKDSVKTQQFAQRWITQVSPEAKNQ 59 usage_00096.pdb 1 NFSQYLLTLVQALANESSEGHIRAAAGIALKNAFSAREFARQAALQAKWLNQTDQETRTR 60 usage_00738.pdb 1 -LPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRWLA-IDANARRE 58 usage_00746.pdb 1 -LPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRWLA-IDANARRE 58 fl ls vLan R aAgl KN l skd aq qqrWl d ar usage_00040.pdb 60 IKTNALTALVS-IE--PRIANAAAQLIAAIADIE---- 90 usage_00096.pdb 61 VKQLALETLAS-PN--SKAGQAAAQVIAAIAAIELPRN 95 usage_00738.pdb 59 VKNYVLQTLGTETYRP----SSASQCVAGIACAE---- 88 usage_00746.pdb 59 VKNYVLHTLGTETYRP----SSASQCVAGIACAE---- 88 vK L tL A Q A IA E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################