################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:17:56 2021 # Report_file: c_1200_334.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_01263.pdb # 2: usage_01268.pdb # 3: usage_01546.pdb # 4: usage_01547.pdb # 5: usage_02458.pdb # 6: usage_02480.pdb # 7: usage_03288.pdb # 8: usage_03296.pdb # 9: usage_03486.pdb # 10: usage_03487.pdb # 11: usage_03680.pdb # 12: usage_03767.pdb # 13: usage_04141.pdb # 14: usage_04142.pdb # 15: usage_04143.pdb # 16: usage_04448.pdb # 17: usage_05144.pdb # 18: usage_05207.pdb # # Length: 33 # Identity: 29/ 33 ( 87.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 33 ( 87.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 33 ( 9.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01263.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLY--- 30 usage_01268.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLY--- 30 usage_01546.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLY--- 30 usage_01547.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLY--- 30 usage_02458.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLYK-- 31 usage_02480.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLY--- 30 usage_03288.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLY--- 30 usage_03296.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLY--- 30 usage_03486.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLY--- 30 usage_03487.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLYKP- 32 usage_03680.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLY--- 30 usage_03767.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLY--- 30 usage_04141.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 33 usage_04142.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLY--- 30 usage_04143.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLY--- 30 usage_04448.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLY--- 30 usage_05144.pdb 1 HLYALSIKDGVMVLSATHRYKKKYVTTLLY--- 30 usage_05207.pdb 1 HLYALSIKDSVMVLSATHRYKKKYVTTLLY--- 30 HLYALSIKD VMVLSATHRYKKKYVTTLLY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################