################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:15:48 2021 # Report_file: c_0487_31.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00033.pdb # 2: usage_00050.pdb # 3: usage_00154.pdb # 4: usage_00236.pdb # 5: usage_00260.pdb # # Length: 121 # Identity: 22/121 ( 18.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/121 ( 38.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/121 ( 22.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00033.pdb 1 PVGAYGGRAEIMKMVAPAGPT-L-----SGNPLAMTAGIKTLEILS-RPGSYEHLDRITG 53 usage_00050.pdb 1 PAAAYAGRREIMEKVAP-LGPVYQAGTLSGNPLAMAAGLATLELLEENPGYYAYLEDLGA 59 usage_00154.pdb 1 PVGAYGGKAEIMEQIAP-SGPIYQAGTLSGNPLAMTAGLETLKQLT--PDSYKNFIKKGD 57 usage_00236.pdb 1 PVGAYGGKREIMQLVAP-AGPMYQAGTLSGNPLAMTAGIKTLELLR-QPGTYEYLDQITK 58 usage_00260.pdb 1 PVGAFGGKREIMQQISP-LGPVYQA-G-TGNPLAMAAGLTTLRLIS-RPGFHDELTAYTT 56 PvgAygG EIM aP gp y sGNPLAM AG TL l Pg y l usage_00033.pdb 54 KLVQGLLDAAREFGHEVCGGHISGMFGLFFTAG-PVTNYEQAKQSDLKKFAAFHRGMLEQ 112 usage_00050.pdb 60 RLEAGLKEVLKEKGLPHTVNRVGSMITVFFTEG-PVVTFQDARRTDTELFKRFFHGLLDR 118 usage_00154.pdb 58 RLEEGISKAAEAHGIPHTFNRAGSMIGFFFTNE-PVINYETAKA---------------- 100 usage_00236.pdb 59 RLSDGLLAIAQETGHAACGGQVSGMFGFFFTEG-PVHNYEDAKKSDLQKFSRFHRGMLEQ 117 usage_00260.pdb 57 RMLDGLQQRADAAGIPFVTTQAGGMFGLYFSGADAIVTFEDVMAS--------------- 101 rl Gl a G M g fFt pv e a usage_00033.pdb 113 G 113 usage_00050.pdb 119 G 119 usage_00154.pdb - usage_00236.pdb 118 G 118 usage_00260.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################