################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:55 2021 # Report_file: c_0571_60.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00218.pdb # 2: usage_00219.pdb # 3: usage_00325.pdb # 4: usage_00326.pdb # 5: usage_00417.pdb # 6: usage_00418.pdb # 7: usage_00443.pdb # 8: usage_00741.pdb # # Length: 84 # Identity: 15/ 84 ( 17.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 84 ( 20.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 84 ( 9.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00218.pdb 1 VERKEGQFSTTDHQVTLVDLPGTYSLTT----TSLDEQIACHYILSGDADLLINVVDASN 56 usage_00219.pdb 1 VERKEGQFSTTDHQVTLVDLPGTYSLTQ----TSLDEQIACHYILSGDADLLINVVDASN 56 usage_00325.pdb 1 VELLSGKILLGADMVEIIDLPGIYDLHG----FSDDEQVVRHFLHDNVPDLALVILNATQ 56 usage_00326.pdb 1 VELLSGKILLGADMVEIIDLPGIYDLHG----FSDDEQVVRHFLHDNVPDLALVILNATQ 56 usage_00417.pdb 1 VEKKEGIMEYREKEFLVVDLPGIYSLTA----HSIDELIARNFILDGNADVIVDIVDSTC 56 usage_00418.pdb 1 VEKKEGIMEYREKEFLVVDLPGIYSLTA----HSIDELIARNFILDGNADVIVDIVDSTC 56 usage_00443.pdb 1 VEKKEGVFTYKGYTINLIDLPGTYSLGY----SSIDEKIARDYLLKGDADLVILVADSVN 56 usage_00741.pdb 1 VERKEGQFSTTDHQVTLVDLPGTYSLTTISSQTSLDEQIACHYILSGDADLLINVVDASN 60 VE G DLPG Y L S DE D usage_00218.pdb 57 LERNLYLTLQLLELGIPCIVAL-- 78 usage_00219.pdb 57 LERNLYLTLQLLELGIPCIVAL-- 78 usage_00325.pdb 57 IERQMSLLLQLKQLNMNIVVLLNM 80 usage_00326.pdb 57 IERQMSLLLQLKQLNMNIVVLL-- 78 usage_00417.pdb 57 LMRNLFLTLELFEMEVKNIILVL- 79 usage_00418.pdb 57 LMRNLFLTLELFEMEVKNIILVL- 79 usage_00443.pdb 57 PEQSLYLLLEILEEK-KVILA--- 76 usage_00741.pdb 61 LERNLYLTLQLLELGIPCIVAL-- 82 r L L l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################