################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:32 2021 # Report_file: c_0850_90.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00032.pdb # 2: usage_00351.pdb # 3: usage_00352.pdb # 4: usage_00467.pdb # 5: usage_00483.pdb # 6: usage_00484.pdb # 7: usage_00496.pdb # 8: usage_00497.pdb # 9: usage_00612.pdb # 10: usage_00669.pdb # # Length: 50 # Identity: 16/ 50 ( 32.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 50 ( 32.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 50 ( 2.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00032.pdb 1 VPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGE 50 usage_00351.pdb 1 PAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALESGLKVIACIGE 50 usage_00352.pdb 1 PAMIKDVGADWVILGHSERRQIFGESDELIAEKVCHALESGLKVIACIGE 50 usage_00467.pdb 1 VPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGE 50 usage_00483.pdb 1 VEQLKDLGCKWVILGHSERRHVIGEKDEFIGKKAAYALSEGLGVIACIGE 50 usage_00484.pdb 1 VEQLKDLGCKWVILGHSERRHVIGEKDEFIGKKAAYALSEGLGVIACIGE 50 usage_00496.pdb 1 -GMLVDCQVPYVILGHSERRQIFHESNEQVAEKVKVAIDAGLKVIACIGE 49 usage_00497.pdb 1 -GMLVDCQVPYVILGHSERRQIFHESNEQVAEKVKVAIDAGLKVIACIGE 49 usage_00612.pdb 1 PGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGE 50 usage_00669.pdb 1 PGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGE 50 LGHSERR E E K A G I C GE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################