################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:19 2021 # Report_file: c_1110_34.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00002.pdb # 2: usage_00003.pdb # 3: usage_00021.pdb # 4: usage_00064.pdb # 5: usage_00092.pdb # 6: usage_00197.pdb # 7: usage_00204.pdb # 8: usage_00205.pdb # 9: usage_00209.pdb # 10: usage_00371.pdb # # Length: 48 # Identity: 37/ 48 ( 77.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 48 ( 83.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 48 ( 2.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00002.pdb 1 SEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLK 48 usage_00003.pdb 1 SEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLK 48 usage_00021.pdb 1 SEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLK 48 usage_00064.pdb 1 SDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLK 48 usage_00092.pdb 1 -EGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLK 47 usage_00197.pdb 1 SDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLK 48 usage_00204.pdb 1 SDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDSFKHLK 48 usage_00205.pdb 1 SDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLK 48 usage_00209.pdb 1 SDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLK 48 usage_00371.pdb 1 -DGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLK 47 GEWQlVL VW KVEADvAGHGQ LIRLFk HPETLEKFD FKHLK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################