################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:49 2021 # Report_file: c_1201_72.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00151.pdb # 2: usage_00153.pdb # 3: usage_00161.pdb # 4: usage_00171.pdb # 5: usage_00469.pdb # 6: usage_00540.pdb # 7: usage_00602.pdb # 8: usage_00691.pdb # 9: usage_01379.pdb # 10: usage_01383.pdb # 11: usage_01393.pdb # 12: usage_01521.pdb # 13: usage_01640.pdb # # Length: 30 # Identity: 1/ 30 ( 3.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 30 ( 16.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 30 ( 33.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00151.pdb 1 ---IGEGTYGVVYKARNKLTGEVVALKKIR 27 usage_00153.pdb 1 IMELGRGAYGVVEKMRHVPSGQIMAVKRIR 30 usage_00161.pdb 1 ----GEGTYGVVYKARNKLTGEVVALKKIR 26 usage_00171.pdb 1 ----GRGSFGEVHRMEDKQTGFQCAVKKVR 26 usage_00469.pdb 1 ---LGAGNGGVVFKVSHKPSGLVMARKLIH 27 usage_00540.pdb 1 ----GEGTYGVVYKARNKLTGEVVALKIR- 25 usage_00602.pdb 1 ----GEGTYGVVYKARNKLTGEVVALKKI- 25 usage_00691.pdb 1 ----GEGTYGVVYKARNKLTGEVVALKKIR 26 usage_01379.pdb 1 ---IGEGTYGVVYKARNKLTGEVVALKKIR 27 usage_01383.pdb 1 ----GEGTYGVVYKARNKLTGEVVALKKIR 26 usage_01393.pdb 1 ---ILYGG-RNKAIATPVQG-VWDMR---- 21 usage_01521.pdb 1 ----GLGINGKVLQIFNKRTQEKFALKLQ- 25 usage_01640.pdb 1 ----GNGTYGQVYKGRHVKTGQLAAIKVMD 26 g G g v a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################