################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:04:55 2021
# Report_file: c_0974_1.html
################################################################################################
#====================================
# Aligned_structures: 9
#   1: usage_00089.pdb
#   2: usage_00300.pdb
#   3: usage_00358.pdb
#   4: usage_00680.pdb
#   5: usage_00731.pdb
#   6: usage_00818.pdb
#   7: usage_00819.pdb
#   8: usage_00820.pdb
#   9: usage_01095.pdb
#
# Length:         75
# Identity:        4/ 75 (  5.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      8/ 75 ( 10.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           24/ 75 ( 32.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00089.pdb         1  TPFAVLEQAD-KVIGFANFIEL----------------EKGKSELAAFYLLPEVTQRGLG   43
usage_00300.pdb         1  TLSLVAEEDG-QVLGHIAFSPVL---IGGA--------EKGWYGLGPVSVLPARQGEGIG   48
usage_00358.pdb         1  DELYTYQKDN-RIIGTIALVYKRIKE--KGIWWVPEELNEKVGLIEFFVVDPEFQGKGIG   57
usage_00680.pdb         1  VIALAIRSPQGEAVGCGAIVLS----------------EEGFGEMKRVYIDPQHRGQQLG   44
usage_00731.pdb         1  --FSILEHDG-NLYGCAALKTFA---------------EADCGEIACLAVSPQAQDGGYG   42
usage_00818.pdb         1  --FSILEHDG-NLYGCAALKTFA---------------EADCGEIACLAVSPQAQDGGYG   42
usage_00819.pdb         1  --FSILEHDG-NLYGCAALKTFA---------------EADCGEIACLAVSPQAQDGGYG   42
usage_00820.pdb         1  --FSILEHDG-NLYGCAALKTFA---------------EADCGEIACLAVSPQAQDGGYG   42
usage_01095.pdb         1  -EFSILEHDG-NLYGCAALKTFA---------------EADCGEIACLAVSPQAQDGGYG   43
                                         G  a                    e            P     g G

usage_00089.pdb        44  TELLEVGTLF-----   53
usage_00300.pdb        49  GKLIREGLAQLRGAG   63
usage_00358.pdb        58  STLLEFAVKRLRSLG   72
usage_00680.pdb        45  EKLLAALEAKARQRD   59
usage_00731.pdb        43  ERLLAHIIDKARGIG   57
usage_00818.pdb        43  ERLLAHIIDKARGIG   57
usage_00819.pdb        43  ERLLAHIIDKARGI-   56
usage_00820.pdb        43  ERLLAHIIDKARGIG   57
usage_01095.pdb        44  ERLLAHIIDKARGIG   58
                             Ll           


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################