################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:57 2021 # Report_file: c_1036_19.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00023.pdb # 2: usage_00088.pdb # 3: usage_00128.pdb # 4: usage_00129.pdb # 5: usage_00130.pdb # 6: usage_00131.pdb # 7: usage_00331.pdb # 8: usage_00332.pdb # 9: usage_00409.pdb # 10: usage_00410.pdb # 11: usage_00411.pdb # # Length: 38 # Identity: 6/ 38 ( 15.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 38 ( 47.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 38 ( 21.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 -MRVLVTGGAGFIGSHIVEDLLAR------GLEVAVLD 31 usage_00088.pdb 1 SSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVA- 37 usage_00128.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 usage_00129.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 usage_00130.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 usage_00131.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 usage_00331.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 usage_00332.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 usage_00409.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 usage_00410.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 usage_00411.pdb 1 RNVALITGITGQDGSYLAEFLLEK------GYEVHGI- 31 vaLitG tG Gs laE Ll g ev #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################