################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:01 2021 # Report_file: c_0732_32.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00297.pdb # 2: usage_00299.pdb # 3: usage_00301.pdb # 4: usage_00302.pdb # 5: usage_00303.pdb # 6: usage_00304.pdb # 7: usage_00461.pdb # 8: usage_00462.pdb # 9: usage_00516.pdb # 10: usage_00753.pdb # # Length: 66 # Identity: 24/ 66 ( 36.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 66 ( 84.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 66 ( 15.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00297.pdb 1 --RALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLE-QPEEYALQVNG 57 usage_00299.pdb 1 -NRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFR----QQPEEYALQVNG 55 usage_00301.pdb 1 --RALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFR----QQPEEYALQVNG 54 usage_00302.pdb 1 --RALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFR----QQPEEYALQVNG 54 usage_00303.pdb 1 --RALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFR----QQPEEYALQVNG 54 usage_00304.pdb 1 -NRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFR----QQPEEYALQVNG 55 usage_00461.pdb 1 -NRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATV-------QPEEYALQVNG 52 usage_00462.pdb 1 SNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATV-------QPEEYALQVNG 53 usage_00516.pdb 1 ---KLVVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTI-------SPCDYVLQVSG 50 usage_00753.pdb 1 -NRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFR----QQPEEYALQVNG 55 aLlVnVkFEgSeesFtFQVStkdmPlalmacAlrKkaTv qPeeYaLQVnG usage_00297.pdb 58 RHEYLY 63 usage_00299.pdb 56 RHEYLY 61 usage_00301.pdb 55 RHEYLY 60 usage_00302.pdb 55 RHEYLY 60 usage_00303.pdb 55 RHEYLY 60 usage_00304.pdb 56 RHEYLY 61 usage_00461.pdb 53 RHEYLY 58 usage_00462.pdb 54 RHEYLY 59 usage_00516.pdb 51 RVEYVF 56 usage_00753.pdb 56 RHEYLY 61 RhEYly #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################