################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:46 2021 # Report_file: c_1113_117.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00082.pdb # 2: usage_00142.pdb # 3: usage_00400.pdb # 4: usage_00702.pdb # 5: usage_00832.pdb # 6: usage_00940.pdb # 7: usage_01032.pdb # 8: usage_01033.pdb # 9: usage_01034.pdb # # Length: 69 # Identity: 2/ 69 ( 2.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 69 ( 18.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 35/ 69 ( 50.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00082.pdb 1 ----LAEPIQTV-RRYGI--EKPYEKLKELT---RVDAE-GKQFIDG-L--ALPEEEKAR 46 usage_00142.pdb 1 NWSTLAEPIQIVMKRHNY--VDAYEELKQFTRGKVIDQKIMQEFIKTKCA-FLPQDVVDQ 57 usage_00400.pdb 1 NWAVVAEGIQTVLRREGY--PKPYEALK-D-----VTEETVHRFVQQ-L---ITEEVRQE 48 usage_00702.pdb 1 ----LAEAIQTV-RRYNE--PNAYEQLKELTRG-QIDAENLKKFIKT-L--SIPEEAKAE 49 usage_00832.pdb 1 ----VAEGIQTVLRRECY--PKPYETLKKLT----VTEEQVRNFING-L-TDISDDVRAE 48 usage_00940.pdb 1 -TLAVAEAVVTTQRDWG-NRTDRKNAK--T-----------KYTLER-----V---GVET 37 usage_01032.pdb 1 -WEVLAEPIQTVMRRYGI--EKPYEKLKELTRK-RVDAEGMKQFIDS-L--ALPEAEKTR 53 usage_01033.pdb 1 -WEVLAEPIQTVMRRYGI--EKPYEKLKELTRK-RVDAEGMKQFIDS-L--ALPEAEKTR 53 usage_01034.pdb 1 ----LAEPIQTVMRRYGI--EKPYEKLKELT---RVDAEGMKQFIDS-L--ALPEAEKTR 48 AE iqtv rr ye l f usage_00082.pdb 47 LKA------ 49 usage_00142.pdb 58 LLEL----- 61 usage_00400.pdb 49 LLA------ 51 usage_00702.pdb 50 LKL------ 52 usage_00832.pdb 49 LLAI----- 52 usage_00940.pdb 38 FKAEVERRA 46 usage_01032.pdb 54 LKA------ 56 usage_01033.pdb 54 LKA------ 56 usage_01034.pdb 49 LKAM----- 52 l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################