################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:53:15 2021
# Report_file: c_1178_16.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00070.pdb
#   2: usage_00089.pdb
#   3: usage_00094.pdb
#   4: usage_00096.pdb
#   5: usage_00097.pdb
#   6: usage_00098.pdb
#   7: usage_00142.pdb
#   8: usage_00143.pdb
#   9: usage_00145.pdb
#  10: usage_00147.pdb
#  11: usage_00148.pdb
#  12: usage_00187.pdb
#
# Length:         36
# Identity:        0/ 36 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     15/ 36 ( 41.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           13/ 36 ( 36.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00070.pdb         1  -ERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHV--   33
usage_00089.pdb         1  -ERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHV--   33
usage_00094.pdb         1  L-----INDPP--AWNTFNLVLR-DESVLEFV----   24
usage_00096.pdb         1  ------QKYCLMGVQDSYTDFHIDFGGTSVWYHV--   28
usage_00097.pdb         1  ------QKYCLMGVQDSYTDFHIDFGGTSVWYHV--   28
usage_00098.pdb         1  -PKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLW   35
usage_00142.pdb         1  ------QKYCLMSVRGCYTDFHVDFGGTSVWYHI--   28
usage_00143.pdb         1  ------QKYCLMSVRGCYTDFHVDFGGTSVWYHI--   28
usage_00145.pdb         1  -ERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHV--   33
usage_00147.pdb         1  ------TKYCLICVKDSYTDFHIDSGGASAWYHV--   28
usage_00148.pdb         1  ------TKYCLICVKDSYTDFHIDSGGASAWYHVLK   30
usage_00187.pdb         1  ------TKYCLICVKDSYTDFHIDSGGASAWYHV--   28
                                  kycl  v   ytdfh   gg s wy    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################