################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:04:52 2021 # Report_file: c_0305_18.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00042.pdb # 2: usage_00048.pdb # 3: usage_00063.pdb # 4: usage_00141.pdb # # Length: 148 # Identity: 33/148 ( 22.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/148 ( 31.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/148 ( 17.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 -MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDP---------KG 50 usage_00048.pdb 1 DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVD----------N 50 usage_00063.pdb 1 DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVD----------N 50 usage_00141.pdb 1 PINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDPTYLAPGE 60 R Ar Di N LPENY H a fVA usage_00042.pdb 51 RVVGYVLAKMEEEPK---------D-GIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMV 100 usage_00048.pdb 51 SVVGYIMPRIE-W--GFSNIKQLPS-LVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMK 106 usage_00063.pdb 51 SVVGYIMPRIE-W--GFSNIKQLPS-LVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMK 106 usage_00141.pdb 61 KLVGYVLVKMNDDQ-----------NEPPNGHITSLSVMRTYRRMGIAENLMRQALFALR 109 vVGY e GH S V YRr GiA L s m usage_00042.pdb 101 EVYGAKYMSLHVRKSNRAAIHLYRDTLQ 128 usage_00048.pdb 107 NDYNAEEIYLEVRVSNYPAIALYEKLN- 133 usage_00063.pdb 107 NDYNAEEIYLEVRVSNYPAIALYEKLN- 133 usage_00141.pdb 110 EVHQAEYVSLHVRQSNRAALHLYRDTLA 137 y Ae L VR SN Ai LY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################