################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:10 2021 # Report_file: c_1408_14.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00023.pdb # 2: usage_00782.pdb # 3: usage_00783.pdb # 4: usage_00846.pdb # 5: usage_00868.pdb # 6: usage_01277.pdb # # Length: 76 # Identity: 7/ 76 ( 9.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 76 ( 42.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 76 ( 15.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 -----EAYFIAKEILATERTYLKDLEVITVWFRSVLIKEEA-PA-ALALLFSNIDPVYEF 53 usage_00782.pdb 1 TPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMIFVNWKELIMC 60 usage_00783.pdb 1 TPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMIFVNWKELIMC 60 usage_00846.pdb 1 TPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLTESELLTEKEVAMIFVNWKELIMC 60 usage_00868.pdb 1 -AKEIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPL-KLSI-TEQELNQIFGTLDSLIPL 57 usage_01277.pdb 1 TPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMIFVNWKELIMC 60 krq i El tEe y DL l t f pL e te e a iF n li usage_00023.pdb 54 HRGFLHEVEQRLALW- 68 usage_00782.pdb 61 NIKLLKALRVRKKMS- 75 usage_00783.pdb 61 NIKLLKALRVRKKMS- 75 usage_00846.pdb 61 NIKLLKALRVRKKMSG 76 usage_00868.pdb 58 HEELLSQLRDVR---- 69 usage_01277.pdb 61 NIKLLKALRVRKKMSG 76 lL lr r #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################