################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:16:46 2021
# Report_file: c_0770_93.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00491.pdb
#   2: usage_00559.pdb
#   3: usage_00611.pdb
#   4: usage_00612.pdb
#   5: usage_00933.pdb
#
# Length:         76
# Identity:        6/ 76 (  7.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     19/ 76 ( 25.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           30/ 76 ( 39.5%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00491.pdb         1  PKVAVISTGNEIVPP-GNE-LKPGQIYDINGRALCDAINELGGEGIFMGVARDDKESLKA   58
usage_00559.pdb         1  PKVGIIITGSELIEEPSEEGFKEGKIVETNSI-LQGLVEKFFGEPILYGVLPDDESIIKE   59
usage_00611.pdb         1  -KVGIIIT------------------VDTNSIMLSALVERYFGEPILYGVVPDNEDLIRS   41
usage_00612.pdb         1  PKVGIIITG------------------DTNSIMLSALVERYFGEPILYGVVPDNEDLIRS   42
usage_00933.pdb         1  PKVFITR----E-IP------------EVGIK----MLE-DEFEVEVWGDEK---EIPRE   35
                            KV ii                       n        e   gE i  Gv          

usage_00491.pdb        59  LIEKAVNVGDVVVISG   74
usage_00559.pdb        60  TLEKAKNECDIVLIT-   74
usage_00611.pdb        42  ALEKAKRECDLVLIT-   56
usage_00612.pdb        43  ALEKAKRECDLVLIT-   57
usage_00933.pdb        36  ILLKKVKEVDALVTM-   50
                            leKa  e D v i  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################