################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:20:08 2021 # Report_file: c_1428_287.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00852.pdb # 2: usage_00995.pdb # 3: usage_00996.pdb # 4: usage_01103.pdb # 5: usage_01663.pdb # # Length: 90 # Identity: 1/ 90 ( 1.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 2/ 90 ( 2.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 65/ 90 ( 72.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00852.pdb 1 ----------------------------------------------SEEELSDLFRMFDK 14 usage_00995.pdb 1 ------------------------------------AFDDF-IQGCIVLQRLTDIFRRYD 23 usage_00996.pdb 1 DKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDF-IQGCIVLQRLTDIFRRYD 59 usage_01103.pdb 1 -----------------------------------------VFDLPQIESEVDAILGAAD 19 usage_01663.pdb 1 ------------------------------------------QRSAFLAAQSAEL-TRMG 17 usage_00852.pdb 15 ---NADGYIDL------DEL-KIMLQAT-- 32 usage_00995.pdb 24 T--DQDGWIQVSYEQYLSMV-F-------- 42 usage_00996.pdb 60 T--DQDGWIQVSYEQYLSMVFS-------- 79 usage_01103.pdb 20 F--DRNGYIDY------SEF-VTVAM---- 36 usage_01663.pdb 18 -VVNSAGAVDP------RVA-QWITT--VC 37 G i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################