################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:02 2021 # Report_file: c_1272_11.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00079.pdb # 2: usage_00080.pdb # 3: usage_00109.pdb # 4: usage_00115.pdb # 5: usage_00150.pdb # 6: usage_00348.pdb # 7: usage_00349.pdb # 8: usage_00350.pdb # 9: usage_00351.pdb # 10: usage_00433.pdb # 11: usage_00545.pdb # # Length: 51 # Identity: 17/ 51 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 51 ( 37.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 51 ( 23.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00079.pdb 1 KVIEFHVVGNSL-NQK-PNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD 49 usage_00080.pdb 1 KVIEFHVVGNSL-NQK-PNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD 49 usage_00109.pdb 1 --LDFDILTND------GTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFD 43 usage_00115.pdb 1 -----DILTND------GTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFD 40 usage_00150.pdb 1 --LDFDILTND------GTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFD 43 usage_00348.pdb 1 KVIEFHVVGNS------PNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD 45 usage_00349.pdb 1 ------VVGNS------PNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD 39 usage_00350.pdb 1 KVIEFHVVGNS------PNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD 45 usage_00351.pdb 1 KVIEFHVVGNS------PNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD 45 usage_00433.pdb 1 -KIEFRVVNND------NTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYD 44 usage_00545.pdb 1 -IIEFHVIGNSLT--PKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFD 48 N L L N Fs QLP MPKEYI LVfD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################