################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:10 2021 # Report_file: c_0901_11.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00130.pdb # 2: usage_00131.pdb # 3: usage_00132.pdb # 4: usage_00133.pdb # 5: usage_00224.pdb # 6: usage_00668.pdb # 7: usage_00669.pdb # 8: usage_00688.pdb # 9: usage_00689.pdb # # Length: 34 # Identity: 4/ 34 ( 11.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 34 ( 55.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 34 ( 23.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00130.pdb 1 HASVEKIIFSNAPGLTATGVIYRDSNGTPHQAF- 33 usage_00131.pdb 1 HASVEKIIFSNAPGLTATGVIYRDSNGTPHQAF- 33 usage_00132.pdb 1 HASVEKIIFSNAPGLTATGVIYRDSNGTPHQAF- 33 usage_00133.pdb 1 HASVEKIIFSNAPGLTATGVIYRDSNGTPHQAF- 33 usage_00224.pdb 1 --GIYSIIFISNEDSCGEGILIKN--GNITGGDI 30 usage_00668.pdb 1 HASVEKIIFSNAPGLTATGVIYRDSNGTPHQAF- 33 usage_00669.pdb 1 HASVEKIIFSNAPGLTATGVIYRDSNGTPHQAF- 33 usage_00688.pdb 1 QASVEKILFS---NLSAIGVIYTDSDGNSHQAF- 30 usage_00689.pdb 1 QASVEKILFS---NLSAIGVIYTDSDGNSHQAF- 30 svekI Fs l a Gviy d G hqaf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################