################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:18:18 2021 # Report_file: c_1242_153.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00094.pdb # 2: usage_00112.pdb # 3: usage_00148.pdb # 4: usage_00459.pdb # 5: usage_00510.pdb # 6: usage_00537.pdb # 7: usage_00538.pdb # 8: usage_00555.pdb # 9: usage_00556.pdb # 10: usage_00564.pdb # 11: usage_00881.pdb # 12: usage_02246.pdb # 13: usage_02251.pdb # 14: usage_02254.pdb # # Length: 38 # Identity: 1/ 38 ( 2.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 38 ( 71.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 38 ( 26.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00094.pdb 1 RVVMMSPQ--GATL-NHDK--VMRFAAEPGLILLCGRY 33 usage_00112.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLF---- 33 usage_00148.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLF---- 33 usage_00459.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLF---- 33 usage_00510.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLF---- 33 usage_00537.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLF---- 33 usage_00538.pdb 1 -SATVAYPEGNWFPTMYYDVIKENAERGLHTLLF---- 33 usage_00555.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLFLDIK 37 usage_00556.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLFLDIK 37 usage_00564.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLFLDIK 37 usage_00881.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLF---- 33 usage_02246.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLFLDIK 37 usage_02251.pdb 1 -SATVAYPEGNWFPMSYYDVIKENAERGLHTLLFLDIK 37 usage_02254.pdb 1 -SATVAYPEGNWFPTSYYDVIKENAERGLHTLLFLDIK 37 satvayp nwfp yyd kenaerglhtlLf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################