################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:12:21 2021
# Report_file: c_1222_25.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00578.pdb
#   2: usage_00579.pdb
#   3: usage_00580.pdb
#   4: usage_00581.pdb
#   5: usage_00582.pdb
#   6: usage_00583.pdb
#   7: usage_00584.pdb
#   8: usage_00585.pdb
#   9: usage_00734.pdb
#  10: usage_01079.pdb
#  11: usage_01958.pdb
#  12: usage_01959.pdb
#
# Length:         30
# Identity:       29/ 30 ( 96.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     29/ 30 ( 96.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            1/ 30 (  3.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00578.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_00579.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHVQ   30
usage_00580.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_00581.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_00582.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_00583.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_00584.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_00585.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHVQ   30
usage_00734.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_01079.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_01958.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
usage_01959.pdb         1  VGMFRMVDEHGGDDKVLCVPAGDPRWDHV-   29
                           VGMFRMVDEHGGDDKVLCVPAGDPRWDHV 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################