################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:04:16 2021
# Report_file: c_1383_46.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00027.pdb
#   2: usage_00031.pdb
#   3: usage_00093.pdb
#   4: usage_00309.pdb
#   5: usage_00428.pdb
#   6: usage_00429.pdb
#   7: usage_00482.pdb
#   8: usage_00486.pdb
#   9: usage_00719.pdb
#  10: usage_01176.pdb
#  11: usage_01177.pdb
#  12: usage_01281.pdb
#  13: usage_01481.pdb
#
# Length:         35
# Identity:        8/ 35 ( 22.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     32/ 35 ( 91.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            3/ 35 (  8.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00027.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_00031.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_00093.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_00309.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_00428.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_00429.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_00482.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_00486.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_00719.pdb         1  TEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYAT   35
usage_01176.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_01177.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_01281.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
usage_01481.pdb         1  TLESLKPCLMDLHQTYLKAP-Q-HAQQSIREKYK-   32
                           TlESLkPclmdLhqtylkap q haqqsireKYk 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################