################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:12 2021 # Report_file: c_1443_17.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00035.pdb # 2: usage_00036.pdb # 3: usage_00037.pdb # 4: usage_00089.pdb # 5: usage_00191.pdb # 6: usage_00192.pdb # 7: usage_00193.pdb # 8: usage_00529.pdb # 9: usage_00530.pdb # 10: usage_00531.pdb # 11: usage_00532.pdb # 12: usage_00533.pdb # # Length: 34 # Identity: 25/ 34 ( 73.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 34 ( 73.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 34 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00035.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQA- 33 usage_00036.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAE 34 usage_00037.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAE 34 usage_00089.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAE 34 usage_00191.pdb 1 KVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAE 34 usage_00192.pdb 1 KVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAE 34 usage_00193.pdb 1 KVLLVVDEPHTDWAKCFRGKKILGDYDIKVEQAE 34 usage_00529.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAE 34 usage_00530.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAE 34 usage_00531.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQ-- 32 usage_00532.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAE 34 usage_00533.pdb 1 RVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAE 34 VLLV DEPHTDWAK F GKKI G DIKVEQ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################