################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:20 2021 # Report_file: c_0736_62.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00120.pdb # 2: usage_00376.pdb # 3: usage_00462.pdb # 4: usage_00463.pdb # 5: usage_00464.pdb # 6: usage_00498.pdb # 7: usage_00690.pdb # 8: usage_00691.pdb # 9: usage_00708.pdb # # Length: 61 # Identity: 19/ 61 ( 31.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 61 ( 41.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 61 ( 32.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00120.pdb 1 PSVSGTPGQKVTIFCSGSSSNVEDNSVYWYQQFPGTTPKVLIYN---------------- 44 usage_00376.pdb 1 -SASGTPGQSVTISCSGSRSNIGGNTVNWYQHLPGMAPKLLIYS---------------- 43 usage_00462.pdb 1 PSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLM------------------ 42 usage_00463.pdb 1 PSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLM------------------ 42 usage_00464.pdb 1 PSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYD---------------- 44 usage_00498.pdb 1 PSASGTPGQRVTISCSGSSSNIGENSVTWYQHLSGTAPKLLIYE---------------- 44 usage_00690.pdb 1 -SASGTPGQSVTISCSGSRSNIGGNTVNWYQHLPGMAPKLLIYS---------------- 43 usage_00691.pdb 1 -SASGTPGQSVTISCSGSRSNIGGNTVNWYQHLPGMAPKLLIYS---------------- 43 usage_00708.pdb 1 PSASGTPGQRVTISCSGSSSNIGSNTVSWYQQVPGTAPKLLIYGNNERPSGVPDRFSGSK 60 S S P Q VTIs SGS SNig N V W Q pG aP lL usage_00120.pdb - usage_00376.pdb - usage_00462.pdb - usage_00463.pdb - usage_00464.pdb - usage_00498.pdb - usage_00690.pdb - usage_00691.pdb - usage_00708.pdb 61 S 61 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################