################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:22:23 2021 # Report_file: c_0351_5.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00016.pdb # 2: usage_00072.pdb # 3: usage_00073.pdb # 4: usage_00075.pdb # 5: usage_00076.pdb # 6: usage_00102.pdb # # Length: 84 # Identity: 45/ 84 ( 53.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/ 84 ( 75.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 84 ( 2.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00016.pdb 1 WFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGR 60 usage_00072.pdb 1 WFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEG-R 59 usage_00073.pdb 1 WFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEE-R 59 usage_00075.pdb 1 WFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGR 60 usage_00076.pdb 1 WFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQ 60 usage_00102.pdb 1 WFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGE 60 WFHgrISReEsqRlI QQGLVDGlFLvR SQ NP FVLslcH QK Kh IlP E usage_00016.pdb 61 LYFSMDDGQTRFTDLLQLVEFHQ- 83 usage_00072.pdb 60 LYFSMDDGQTRFTDLLQLVEFHQ- 82 usage_00073.pdb 60 LYFSMDDGQTRFTDLLQLVEFHQ- 82 usage_00075.pdb 61 LYFSMDDGQTRFTDLLQLVEFHQ- 83 usage_00076.pdb 61 TFFSLDDGNTKFSDLIQLVDFYQL 84 usage_00102.pdb 61 MFHTLDDGHTRFTDLIQLVEFYQL 84 fs DDG TrFtDL QLVeF Q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################