################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Sun Jan 24 08:56:58 2021 # Report_file: c_0669_9.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00408.pdb # 2: usage_00482.pdb # 3: usage_00483.pdb # 4: usage_00832.pdb # 5: usage_01042.pdb # 6: usage_01267.pdb # 7: usage_01669.pdb # # Length: 105 # Identity: 23/105 ( 21.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/105 ( 34.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 48/105 ( 45.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00408.pdb 1 GYATYRNTDFFGLVDG----LDFALQYQG---------------------KGDGYGGSLT 35 usage_00482.pdb 1 GLLTYRNSDFFGLVDGLSFGIQYQGKNQDN--------------HSINSQNGDGVGYTMA 46 usage_00483.pdb 1 GLLTYRNSDFFGLVDGLSFGIQYQGKNQDN--------------HSINSQNGDGVGYTMA 46 usage_00832.pdb 1 GFATYRNTDFFGLVDGLDFAVQYQGKNGSAH----GEGMTTNGRDDVFEQNGDGVGGSIT 56 usage_01042.pdb 1 GFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTN-NGRDALRQNGDGVGGSIT 59 usage_01267.pdb 1 GFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTN-NGRDALRQNGDGVGGSIT 59 usage_01669.pdb 1 GFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTN-NGRDALRQNGDGVGGSIT 59 G TYRN DFFGLVDG qyqgkn nGDGvG usage_00408.pdb 36 YAIGEGFSVGGAITTSK---------------ATVYTG------- 58 usage_00482.pdb 47 Y-EFDGFGVTAAYSNSKRTNDQQ-D-RDGNGDRAESRAVGAKYDA 88 usage_00483.pdb 47 Y-EFDGFGVTAAYSNSKRTNDQQ-D--RDNGDRAESRAVGAKYDA 87 usage_00832.pdb 57 Y-NYEGFGIGAAVSSSKRTWDQNNTGLIGTGDRAETYTG------ 94 usage_01042.pdb 60 Y-DYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYT------- 96 usage_01267.pdb 60 Y-DYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYT------- 96 usage_01669.pdb 60 Y-DYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYT------- 96 Y GFg A s SK rae #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################