################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:04 2021 # Report_file: c_0738_22.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00118.pdb # 2: usage_00119.pdb # 3: usage_00150.pdb # 4: usage_00279.pdb # 5: usage_00338.pdb # 6: usage_00395.pdb # 7: usage_00436.pdb # # Length: 75 # Identity: 13/ 75 ( 17.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 75 ( 25.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/ 75 ( 34.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00118.pdb 1 KICTVTG----------WGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYP------ 44 usage_00119.pdb 1 KICTVTG----------WGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYP------ 44 usage_00150.pdb 1 --IWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLL--PQQITPRMMCVG-FLSGGVD 55 usage_00279.pdb 1 --ATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAY--GEYTPDAMVCAG-VPEGGVD 55 usage_00338.pdb 1 --CTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAG-YPEGGID 57 usage_00395.pdb 1 --CTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAG-YPEGGID 57 usage_00436.pdb 1 --IWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLL--PQQITPRMMCVG-FLSGGVD 55 vtG LQ i C qi p M C G usage_00118.pdb 45 ---GDSGGPFVCEDS 56 usage_00119.pdb 45 ---GDSGGPFVCEDS 56 usage_00150.pdb 56 SCQGDSGGPLSSVEA 70 usage_00279.pdb 56 TCQGDSGGPMVVN-- 68 usage_00338.pdb 58 ACQGDSGGPFVCEDS 72 usage_00395.pdb 58 ACQGDSGGPFVCEDS 72 usage_00436.pdb 56 SCQGDSGGPLSSVE- 69 GDSGGP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################