################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:05:03 2021 # Report_file: c_1089_8.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00171.pdb # 2: usage_00172.pdb # 3: usage_00291.pdb # 4: usage_00292.pdb # 5: usage_00293.pdb # 6: usage_00363.pdb # 7: usage_00903.pdb # 8: usage_00910.pdb # 9: usage_00911.pdb # # Length: 67 # Identity: 8/ 67 ( 11.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 67 ( 23.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 67 ( 20.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00171.pdb 1 -PYQGRELAFKLGLEGKL-VQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDG 58 usage_00172.pdb 1 -PYQGRELAFKLGLEGKL-VQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDG 58 usage_00291.pdb 1 KDSQAQRMAENLGFLGPL-QNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVC--- 56 usage_00292.pdb 1 -PYQGRELAFKLGLEGKL-VQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLIC--- 55 usage_00293.pdb 1 -PYQGRELAFKLGLEGKL-VQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDG 58 usage_00363.pdb 1 -PFEAREMVKRAGLE--GNLNKLAQVLVALYRAYEGVDASIAEINPLVVTTDGGIVA--- 54 usage_00903.pdb 1 KDSQAQRMAENLGFLGPL-QNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDA 59 usage_00910.pdb 1 -PYQGRELAFKLGLEGKL-VQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDG 58 usage_00911.pdb 1 -PYQGRELAFKLGLEGKL-VQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDG 58 q a lG l q L fl D E NP T G c usage_00171.pdb 59 KLGAD-- 63 usage_00172.pdb 59 KLGAD-- 63 usage_00291.pdb ------- usage_00292.pdb ------- usage_00293.pdb 59 KLGADGN 65 usage_00363.pdb ------- usage_00903.pdb 60 KINF--- 63 usage_00910.pdb 59 KLGAD-- 63 usage_00911.pdb 59 KLGAD-- 63 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################