################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:38:16 2021 # Report_file: c_1380_5.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00574.pdb # 2: usage_00575.pdb # 3: usage_00785.pdb # 4: usage_00786.pdb # 5: usage_00836.pdb # 6: usage_00837.pdb # 7: usage_00931.pdb # # Length: 69 # Identity: 7/ 69 ( 10.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 69 ( 68.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 69 ( 27.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00574.pdb 1 -PALIYSAKFALVFPLSYHTWNGIRHLVWDMG-KGFKLSQVEQSGVVVLILTLLSSAGIA 58 usage_00575.pdb 1 -PALIYSAKFALVFPLSYHTWNGIRHLVWDMG-KGFKLSQVEQSGVVVLILTLLSSAGIA 58 usage_00785.pdb 1 -PALIYSAKFALVFPLSYHTWNGIRHLVWDMG-KGFKLSQVEQSGVVVLILTLLSSAAIA 58 usage_00786.pdb 1 SPALIYSAKFALVFPLSYHTWNGIRHLVWDMG-KGFKLSQVEQSGVVVLILTLLSSAAIA 59 usage_00836.pdb 1 -PALIYSAKFALVFPLSYHTWNGIRHLVWDMG-KGFKLSQVEQSGVVVLILTLLSSAGIA 58 usage_00837.pdb 1 -PALIYSAKFALVFPLSYHTWNGIRHLVWDMG-KGFKLSQVEQSGVVVLILTLLSSAGIA 58 usage_00931.pdb 1 -PWHGFSIGFAYGCGLLFAAHGATILAVAR-FGGD----REIEQITDR-----GTAVERA 49 PaliySakFAlvfpLsyhtwngirhlVwd g kg qveqsgvvv lssa iA usage_00574.pdb 59 AI------- 60 usage_00575.pdb 59 AI------- 60 usage_00785.pdb 59 SE------- 60 usage_00786.pdb 60 SE------- 61 usage_00836.pdb 59 AI------- 60 usage_00837.pdb 59 AI------- 60 usage_00931.pdb 50 ALFWRWTIG 58 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################