################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:59 2021 # Report_file: c_1297_316.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01195.pdb # 2: usage_01718.pdb # 3: usage_01961.pdb # 4: usage_02177.pdb # 5: usage_02613.pdb # 6: usage_02614.pdb # 7: usage_03082.pdb # 8: usage_03083.pdb # 9: usage_03326.pdb # # Length: 39 # Identity: 7/ 39 ( 17.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 39 ( 20.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 39 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01195.pdb 1 SGVLDSARFRCNLSRALGVKPSDVSAIVVGGHGDEMIPL 39 usage_01718.pdb 1 --ILDTARFRFLLGEYFSVAPQNVHAYIIGEHGDTELPV 37 usage_01961.pdb 1 ---LDSSRFRYFLAEKLNVSPNDVQAMVIGGHGDTMVPL 36 usage_02177.pdb 1 GGRLDSARFRYVLSQRFDVPVKNVDATILGEHGDAQVPV 39 usage_02613.pdb 1 --TLDSARFRFMLSEYFGAAPQNVHAHIIGEHGDTELPV 37 usage_02614.pdb 1 -TTLDSARFRFMLSEYFGAAPQNVHAHIIGEHGDTELPV 38 usage_03082.pdb 1 --TTLDSARFRYLGEYFDIGPHNIHAYIIGEHGDTELPV 37 usage_03083.pdb 1 --TTLDSARFRYLGEYFDIGPHNIHAYIIGEHGDTELPV 37 usage_03326.pdb 1 --TLDSARFRFMLSEYFGAAPQNVCAHIIGEHGDTELPV 37 L p A G HGD P #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################