################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:15 2021 # Report_file: c_0753_7.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00084.pdb # 2: usage_00447.pdb # 3: usage_00570.pdb # 4: usage_00571.pdb # 5: usage_00572.pdb # 6: usage_00867.pdb # 7: usage_00868.pdb # # Length: 97 # Identity: 66/ 97 ( 68.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 67/ 97 ( 69.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 30/ 97 ( 30.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00084.pdb 1 DVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTF-EKFK-QPSRKV-ALDH 57 usage_00447.pdb 1 DVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTF-E---Q-PSRKVDALDH 55 usage_00570.pdb 1 DVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFV------------ALDH 48 usage_00571.pdb 1 DVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDIL--------------------- 39 usage_00572.pdb 1 DVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILES-----------------DH 43 usage_00867.pdb 1 DVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTF-EKFK--------ALDH 51 usage_00868.pdb 1 DVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTF-EKFK----------DH 49 DVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDIL usage_00084.pdb 58 FQKCFLILKLDHGRVHSEK-S-GKGWKAIRVDLVMCP 92 usage_00447.pdb 56 FQKCFLILKLDHGRVHSEKS-EGKGWKAIRVDLVMCP 91 usage_00570.pdb 49 FQKCFLILKLDHGRVHS-----GKGWKAIRVDLVM-- 78 usage_00571.pdb 40 -QKCFLILKLDHGRVH------GKGWKAIRVDLVMCP 69 usage_00572.pdb 44 AQKCFLILKLDHGRVH------GKGWKAIRVDLVM-- 72 usage_00867.pdb 52 FQKCFLILKLDHGRVHS----EGKGWKAIRVDLVMCP 84 usage_00868.pdb 50 FQKCALILKLDHGRVHS-----GKGWKAIRVDLVMCP 81 QKCfLILKLDHGRVH GKGWKAIRVDLVM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################