################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:18:55 2021 # Report_file: c_1396_83.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00702.pdb # 2: usage_00986.pdb # 3: usage_00987.pdb # 4: usage_00988.pdb # 5: usage_00989.pdb # # Length: 82 # Identity: 5/ 82 ( 6.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 82 ( 58.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 34/ 82 ( 41.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00702.pdb 1 RGATARIFHYSTELQATLQMLKTYTLRLAARM-NA-QD-ACYDRIEHLVNDAIRAMESHQ 57 usage_00986.pdb 1 --DPKVR-----EEARRRLLSAKGHLEGILRLEDEKVYCVDVLKQLKAVEGALDRVGEV- 52 usage_00987.pdb 1 --DPKVR-----EEARRRLLSAKGHLEGILRLEDEKVYCVDVLKQLKAVEGALDRVGEV- 52 usage_00988.pdb 1 ---PKVR-----EEARRRLLSAKGHLEGILRLEDEKVYCVDVLKQLKAVEGALDRVGEV- 51 usage_00989.pdb 1 --DPKVR-----EEARRRLLSAKGHLEGILRLEDEKVYCVDVLKQLKAVEGALDRVGEV- 52 pkvr EearrrllsakghLegilRl de vy vdvlkqlkaVegAldrvgev usage_00702.pdb ---------------------- usage_00986.pdb 53 LRAHLKDHDVEE-IVEELEALK 73 usage_00987.pdb 53 LRAHLKDHV---AIVEELEAL- 70 usage_00988.pdb 52 LRAHLKDHVEE--IVEELEALK 71 usage_00989.pdb 53 LRAHLKDHV----IVEELEALK 70 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################