################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:09:17 2021 # Report_file: c_0888_112.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00042.pdb # 2: usage_00384.pdb # 3: usage_00542.pdb # 4: usage_00645.pdb # # Length: 84 # Identity: 4/ 84 ( 4.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 84 ( 22.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 84 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 --------SPYLLKALNQVD-SPVSITAVGFIADISNSLE-EDFRRYSDAMMNVLAQMIS 50 usage_00384.pdb 1 TAAMIDAVLDELPPLIS-ESDMHVSQMAISFLTTLAKVYP-SSLSKISGSILNELIGLVR 58 usage_00542.pdb 1 --------SPYLLKALNQVD-SPVSITAVGFIADISNSLE-EDFRRYSDAMMNVLAQMIS 50 usage_00645.pdb 1 -----AETFESLLACLK--DDEKVAEAALQIFKNTGS-KIEEDFPHIRSALLPVLHHKSK 52 Ll l d Vs A f edf s a nvL usage_00042.pdb 51 NPNARRELKPAVLSVFGDIASNI- 73 usage_00384.pdb 59 SPLLQGGALSAMLDFFQALVVT-G 81 usage_00542.pdb 51 NPNARRELKPAVLSVFGDIASN-- 72 usage_00645.pdb 53 K--GPPRQAKYAIHCIHA------ 68 a l f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################