################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:35 2021 # Report_file: c_1405_133.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00557.pdb # 2: usage_01407.pdb # 3: usage_01408.pdb # 4: usage_01409.pdb # 5: usage_01410.pdb # 6: usage_01411.pdb # 7: usage_01412.pdb # 8: usage_01450.pdb # 9: usage_01451.pdb # 10: usage_01452.pdb # 11: usage_01453.pdb # 12: usage_01454.pdb # # Length: 33 # Identity: 5/ 33 ( 15.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 33 ( 84.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 33 ( 15.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00557.pdb 1 -EEDGQLFHQLHKDALDKHDTALYPRFKKWCDE 32 usage_01407.pdb 1 -ESLAKKHYL-YDDIVFRHSEAVWNSLIKFI-- 29 usage_01408.pdb 1 -ESLAKKHYL-YDDIVFRHSEAVWNSLIKFI-- 29 usage_01409.pdb 1 DESLAKKHYL-YDDIVFRHSEAVWNSLIKF--- 29 usage_01410.pdb 1 DESLAKKHYL-YDDIVFRHSEAVWNSLIKFIS- 31 usage_01411.pdb 1 -ESLAKKHYL-YDDIVFRHSEAVWNSLIKFI-- 29 usage_01412.pdb 1 DESLAKKHYL-YDDIVFRHSEAVWNSLIKFIS- 31 usage_01450.pdb 1 -ESLAKKHYL-YDDIVFRHSEAVWNSLIKFIS- 30 usage_01451.pdb 1 -ESLAKKHYL-YDDIVFRHSEAVWNSLIKFIS- 30 usage_01452.pdb 1 -ESLAKKHYL-YDDIVFRHSEAVWNSLIKF--- 28 usage_01453.pdb 1 -ESLAKKHYL-YDDIVFRHSEAVWNSLIKFI-- 29 usage_01454.pdb 1 -ESLAKKHYL-YDDIVFRHSEAVWNSLIKFI-- 29 Eslakkhyl ydDivfrHseAvwnsliKf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################