################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:23:06 2021 # Report_file: c_0382_32.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00231.pdb # 2: usage_00232.pdb # 3: usage_00429.pdb # 4: usage_00430.pdb # 5: usage_00479.pdb # 6: usage_00480.pdb # 7: usage_00481.pdb # 8: usage_00482.pdb # 9: usage_00820.pdb # 10: usage_00821.pdb # # Length: 75 # Identity: 72/ 75 ( 96.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 72/ 75 ( 96.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 75 ( 4.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00231.pdb 1 APLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 60 usage_00232.pdb 1 -PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 59 usage_00429.pdb 1 APLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 60 usage_00430.pdb 1 -PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 59 usage_00479.pdb 1 -PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 59 usage_00480.pdb 1 -PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 59 usage_00481.pdb 1 -PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 59 usage_00482.pdb 1 -PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 59 usage_00820.pdb 1 -PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 59 usage_00821.pdb 1 -PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG 59 PLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAG usage_00231.pdb 61 QIVKKQANGHLLA-- 73 usage_00232.pdb 60 QIVKKQANGHLLA-- 72 usage_00429.pdb 61 QIVKKQANGHLLALD 75 usage_00430.pdb 60 QIVKKQANGHLLALD 74 usage_00479.pdb 60 QIVKKQANGHLLA-- 72 usage_00480.pdb 60 QIVKKQANGHLLA-- 72 usage_00481.pdb 60 QIVKKQANGHLLA-- 72 usage_00482.pdb 60 QIVKKQANGHLLA-- 72 usage_00820.pdb 60 QIVKKQANGHLLA-- 72 usage_00821.pdb 60 QIVKKQANGHLLA-- 72 QIVKKQANGHLLA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################