################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:14:52 2021 # Report_file: c_0314_66.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00124.pdb # 2: usage_00135.pdb # 3: usage_00330.pdb # 4: usage_00349.pdb # 5: usage_00350.pdb # # Length: 131 # Identity: 7/131 ( 5.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/131 ( 15.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 36/131 ( 27.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00124.pdb 1 ------HYEDILEDVVNKS-F---GNVLEFGVGTGNLTNKLLL-AGRTVYGIEPSREMRM 49 usage_00135.pdb 1 AQD---LEASDRADILSSLPHLTNKDVVDIGAGIGRFTTVLAE-TARWVLSTDFIESFIE 56 usage_00330.pdb 1 -TRVQHIQAKMTLRALELLNLQPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLA 59 usage_00349.pdb 1 ------------EDLLQLLNPQPGEFILDLGCGTGQLTEKIAQ-SGAEVLGTDNAAT-IE 46 usage_00350.pdb 1 ------------EDLLQLLNPQPGEFILDLGCGTGQLTEKIAQ-SGAEVLGTDNAAT-IE 46 d l l ld G G G t v g d usage_00124.pdb 50 IAKEKLPK--EFSITEGDFLSFEVPT--SIDTIVSTYAFH-HLT--DDEKNVAIAKYSQL 102 usage_00135.pdb 57 KNQERN-AHGNISYQIGDAVHLQ--DEKSVDLVFTNWL-YL----SDREVIEFLLNA-RW 107 usage_00330.pdb 60 TGLSRE-L--EGDLMLQDMGTGIPFRAGSFDAAISISA-I-QWLDPKQRLMRFFNTLYAA 114 usage_00349.pdb 47 KARQNY-P--HLHFDVADARNFRVDK--PLDAVFSNAL-H-WVK----EPEAAIASIHQA 95 usage_00350.pdb 47 KARQNY-P--HLHFDVADARNFRVDK--PLDAVFSNAL-H-WVK----EPEAAIASIHQA 95 D D s e usage_00124.pdb 103 LNKGGKIVFAD 113 usage_00135.pdb 108 LRADGYIHLRE 118 usage_00330.pdb 115 LKKGGKFVAQ- 124 usage_00349.pdb 96 LKSGGRFVAE- 105 usage_00350.pdb 96 LKSGGRFVAE- 105 L gG v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################