################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:45:17 2021 # Report_file: c_1371_228.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00354.pdb # 2: usage_00374.pdb # 3: usage_01295.pdb # 4: usage_01397.pdb # 5: usage_01398.pdb # 6: usage_01577.pdb # 7: usage_01578.pdb # # Length: 66 # Identity: 11/ 66 ( 16.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 66 ( 27.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 66 ( 19.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00354.pdb 1 DKKLIKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGL-SKKEHIIKIVYEE 59 usage_00374.pdb 1 TEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESL-TPAEVILATVYEA 59 usage_01295.pdb 1 -KKLIKEVIKDIQRALIQADVNVKLVLKMSKEIERRALEEKTPKGL-SKKEHIIKIVYEE 58 usage_01397.pdb 1 -EALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGI-SKKEHIIKIVYEE 58 usage_01398.pdb 1 -EALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGI-SKKEHIIKIVYEE 58 usage_01577.pdb 1 ----IAEPMRDIRRALLEADVSLPVVRRFVQSVSDQAVGM------GKPDQQLVKIVHDE 50 usage_01578.pdb 1 ------EPMRDIRRALLEADVSLPVVRRFVQSVSDQAVGM------GKPDQQLVKIVHDE 48 e dI RAL ADV v A kiV e usage_00354.pdb 60 LVKLLG 65 usage_00374.pdb 60 LKEALG 65 usage_01295.pdb 59 LVKLLG 64 usage_01397.pdb 59 LTKFLG 64 usage_01398.pdb 59 LTKFLG 64 usage_01577.pdb 51 LVKLMG 56 usage_01578.pdb 49 LVKLMG 54 L k G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################