################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:37 2021 # Report_file: c_0920_4.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00023.pdb # 2: usage_00041.pdb # 3: usage_00112.pdb # 4: usage_00125.pdb # 5: usage_00218.pdb # 6: usage_00219.pdb # 7: usage_00704.pdb # # Length: 68 # Identity: 21/ 68 ( 30.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/ 68 ( 80.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 68 ( 11.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 TYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQ----FL-SLFIPR 55 usage_00041.pdb 1 TYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQ----FL-SLFIPR 55 usage_00112.pdb 1 SYYVLPASPGHGGGLTMAPRVL-PCPLLVAQETDERRKGFPVRFTPWGGAAAPEDRTIRV 59 usage_00125.pdb 1 TYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQ----FR-SLFIPR 55 usage_00218.pdb 1 --YLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSP----YR-IRFIPR 53 usage_00219.pdb 1 TYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSR----LR-SAFIPR 55 usage_00704.pdb 1 TYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQ----FL-SLFIPR 55 YlLPhiwaHGGGietAktgn PCPLtVvrspnEvsKGePiRiss fIpr usage_00023.pdb 56 GSLVALGF 63 usage_00041.pdb 56 GSLVALGF 63 usage_00112.pdb 60 STDVRIRF 67 usage_00125.pdb 56 GSLVALGF 63 usage_00218.pdb 54 GSLVALGF 61 usage_00219.pdb 56 GSLVALGF 63 usage_00704.pdb 56 GSLVALGF 63 gslValgF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################