################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:45 2021 # Report_file: c_0905_97.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00226.pdb # 2: usage_00624.pdb # 3: usage_00625.pdb # 4: usage_00883.pdb # 5: usage_00884.pdb # 6: usage_00885.pdb # 7: usage_00886.pdb # 8: usage_00887.pdb # 9: usage_00888.pdb # 10: usage_00889.pdb # # Length: 35 # Identity: 23/ 35 ( 65.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 35 ( 65.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 35 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00226.pdb 1 QYNPNATAWGQPLYWGHATSNDLVHWDEHEIAIGP 35 usage_00624.pdb 1 QYNPNATAWGQPLYWGHATSNDLVHWDEHEIAIGP 35 usage_00625.pdb 1 QYNPNATAWGQPLYWGHATSNDLVHWDEHEIAIGP 35 usage_00883.pdb 1 QYNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAP 35 usage_00884.pdb 1 QYNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAP 35 usage_00885.pdb 1 QYNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAP 35 usage_00886.pdb 1 QYNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAP 35 usage_00887.pdb 1 QYNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAP 35 usage_00888.pdb 1 QYNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAP 35 usage_00889.pdb 1 QYNPNDTVWGTPLFWGHATSDDLTNWEDQPIAIAP 35 QYNPN T WG PL WGHATS DL W IAI P #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################