################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:03 2021 # Report_file: c_0780_26.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00052.pdb # 2: usage_00053.pdb # 3: usage_00184.pdb # 4: usage_00185.pdb # 5: usage_00186.pdb # 6: usage_00187.pdb # 7: usage_00238.pdb # 8: usage_00239.pdb # 9: usage_00778.pdb # 10: usage_00814.pdb # 11: usage_00881.pdb # # Length: 49 # Identity: 15/ 49 ( 30.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 49 ( 95.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 49 ( 4.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00052.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00053.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00184.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00185.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00186.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00187.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00238.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00239.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00778.pdb 1 FILVADELSATTLAELPQDRLVGVVVRDGAANSQAAIMVRALGIPTVMG 49 usage_00814.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVG 49 usage_00881.pdb 1 VILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAI-- 47 vILVAadLtpsetAqLnlkkvlGfitdaGgrtShtsIMaRsLelPai #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################