################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:04 2021 # Report_file: c_1267_128.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00245.pdb # 2: usage_00429.pdb # 3: usage_00584.pdb # 4: usage_00770.pdb # 5: usage_00771.pdb # 6: usage_00973.pdb # 7: usage_01172.pdb # 8: usage_01221.pdb # 9: usage_01237.pdb # 10: usage_01282.pdb # 11: usage_01693.pdb # # Length: 33 # Identity: 19/ 33 ( 57.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 33 ( 78.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 33 ( 21.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00245.pdb 1 -DAAPTVSIFPPSSEQLTSGGASVVCFLNNFYP 32 usage_00429.pdb 1 -DAAPTVSIFPPSSEQLTSGGASVVCFLNNFYP 32 usage_00584.pdb 1 ADAAPTVSIFPPSSEQLTSGGASVVCFLN---- 29 usage_00770.pdb 1 ADAAPTVSIFPPSSEQLTSGGASVVCFLN---- 29 usage_00771.pdb 1 ADAAPTVSIFPPSSEQLTSGGASVVCFLN---- 29 usage_00973.pdb 1 --AKPTVSIFPPSSEQLGTGSATLVCFVNNFYP 31 usage_01172.pdb 1 -DAAPTVSIFPPSSEQLTSGGASVVCFLN---- 28 usage_01221.pdb 1 --AAPTVSIFPPSSEQLTSGGASVVCFLN---- 27 usage_01237.pdb 1 -DAAPTVSIFPPSSEQLTSGGASVVCFLNNFYP 32 usage_01282.pdb 1 ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYP 33 usage_01693.pdb 1 ADAAPTVSIFPPSSEQLTSGGASVVCFL----- 28 AaPTVSIFPPSSEQLtsGgAsvVCFl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################