################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:08 2021 # Report_file: c_1336_84.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00172.pdb # 2: usage_00366.pdb # 3: usage_00446.pdb # 4: usage_00629.pdb # 5: usage_00825.pdb # 6: usage_00871.pdb # 7: usage_00889.pdb # 8: usage_00965.pdb # 9: usage_00966.pdb # 10: usage_01062.pdb # # Length: 35 # Identity: 25/ 35 ( 71.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 35 ( 82.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 35 ( 8.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00172.pdb 1 SELLNKYDLSNLVEIASGGAPLSKEVGEAVARRFN 35 usage_00366.pdb 1 STLIDKYDLSNLHEIASGG-PLSKEVGEAVAKRFH 34 usage_00446.pdb 1 STLVDKYDLSNLHEIASGGAPLAKEVGEAVAKRFK 35 usage_00629.pdb 1 STLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFH 35 usage_00825.pdb 1 STLIDKYDLSNLHEIASG---LSKEVGEAVAKRFH 32 usage_00871.pdb 1 STLVDKYDLSNLHEIASGGAPLAKEVGEAVAKRFK 35 usage_00889.pdb 1 STLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFH 35 usage_00965.pdb 1 STLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFH 35 usage_00966.pdb 1 STLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFH 35 usage_01062.pdb 1 STLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFH 35 StL dKYDLSNLhEIASG L KEVGEAVAkRF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################