################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:14:09 2021 # Report_file: c_1393_81.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00390.pdb # 2: usage_00776.pdb # 3: usage_00777.pdb # 4: usage_00779.pdb # 5: usage_00780.pdb # 6: usage_00781.pdb # 7: usage_00848.pdb # 8: usage_01055.pdb # 9: usage_01100.pdb # 10: usage_01101.pdb # 11: usage_01110.pdb # 12: usage_01148.pdb # 13: usage_01149.pdb # 14: usage_01150.pdb # # Length: 35 # Identity: 34/ 35 ( 97.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 35 ( 97.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 35 ( 2.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00390.pdb 1 PLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 35 usage_00776.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_00777.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_00779.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_00780.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_00781.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_00848.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_01055.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_01100.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_01101.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_01110.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_01148.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_01149.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 usage_01150.pdb 1 -LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN 34 LLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################