################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:06 2021 # Report_file: c_1396_259.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00015.pdb # 2: usage_00767.pdb # 3: usage_00890.pdb # 4: usage_00891.pdb # 5: usage_01329.pdb # 6: usage_01330.pdb # 7: usage_01331.pdb # 8: usage_01713.pdb # 9: usage_01753.pdb # # Length: 34 # Identity: 15/ 34 ( 44.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 34 ( 55.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 34 ( 11.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 -LPFYKRMLSKKLTIKDLESIDTEFYNSLIWIR- 32 usage_00767.pdb 1 --PFYKMMLHKPITLHDMESVDSEYYNSLRWILE 32 usage_00890.pdb 1 -RPFYKMMLHKPITLHDMESVDSEYYNSLRWILE 33 usage_00891.pdb 1 -RPFYKMMLHKPITLHDMESVDSEYYNSLRWILE 33 usage_01329.pdb 1 SLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIR- 33 usage_01330.pdb 1 -LPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRD 33 usage_01331.pdb 1 -LPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRD 33 usage_01713.pdb 1 --PFYKMMLHKPITLHDMESVDSEYYNSLRWILE 32 usage_01753.pdb 1 --PFYKQLLGKSITLDD-ELVDPDLHNSLVWIL- 30 PFYK mL K T D Es D e yNSL WI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################