################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:16:56 2021 # Report_file: c_0413_7.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00091.pdb # 2: usage_00092.pdb # 3: usage_00093.pdb # 4: usage_00094.pdb # 5: usage_00095.pdb # 6: usage_00096.pdb # 7: usage_00097.pdb # 8: usage_00098.pdb # 9: usage_00196.pdb # 10: usage_00197.pdb # # Length: 61 # Identity: 61/ 61 (100.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/ 61 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 61 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00091.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00092.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00093.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00094.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00095.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00096.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00097.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00098.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00196.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 usage_00197.pdb 1 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL 60 SVTFDNVVFGYDRDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWEGRIL usage_00091.pdb 61 I 61 usage_00092.pdb 61 I 61 usage_00093.pdb 61 I 61 usage_00094.pdb 61 I 61 usage_00095.pdb 61 I 61 usage_00096.pdb 61 I 61 usage_00097.pdb 61 I 61 usage_00098.pdb 61 I 61 usage_00196.pdb 61 I 61 usage_00197.pdb 61 I 61 I #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################