################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:07:12 2021
# Report_file: c_1487_225.html
################################################################################################
#====================================
# Aligned_structures: 8
#   1: usage_00404.pdb
#   2: usage_00866.pdb
#   3: usage_02535.pdb
#   4: usage_02607.pdb
#   5: usage_02714.pdb
#   6: usage_03881.pdb
#   7: usage_03882.pdb
#   8: usage_04566.pdb
#
# Length:         41
# Identity:        1/ 41 (  2.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      6/ 41 ( 14.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           18/ 41 ( 43.9%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00404.pdb         1  --PCIQKAAELFSQWMESSGKLN-IPTDVLKIVYSVGA---   35
usage_00866.pdb         1  HAPCIQKAAELFSQWMESSGKLN-IPTDVLKIVYSVGA---   37
usage_02535.pdb         1  ----------LLDIAQEQGR--ISL-TGDGLKVAKAVGE--   26
usage_02607.pdb         1  -PQCENLAKTLFDQWMSDPENNP-IHPNLRSTIYCNAIAQG   39
usage_02714.pdb         1  LGNCSTTAMKLFDDWMASNGTQS-LPTDVMTTVFKVG----   36
usage_03881.pdb         1  --PCIQKAAELFSQWMESSGKLN-IPTDVLKIVYSVGA---   35
usage_03882.pdb         1  --PCIQKAAELFSQWMESSGKLN-IPTDVLKIVYSVGA---   35
usage_04566.pdb         1  -----TTAMKLFDDWMASNGTQS-LPTDVMTTVFKVGA---   32
                                     Lf  wm          t     v        


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################