################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:08:42 2021 # Report_file: c_0617_11.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00049.pdb # 2: usage_00050.pdb # 3: usage_00073.pdb # 4: usage_00074.pdb # 5: usage_00075.pdb # 6: usage_00115.pdb # 7: usage_00194.pdb # 8: usage_00289.pdb # 9: usage_00312.pdb # # Length: 82 # Identity: 77/ 82 ( 93.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 79/ 82 ( 96.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 82 ( 3.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00049.pdb 1 GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA 60 usage_00050.pdb 1 GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA 60 usage_00073.pdb 1 GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA 60 usage_00074.pdb 1 GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA 60 usage_00075.pdb 1 GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA 60 usage_00115.pdb 1 GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA 60 usage_00194.pdb 1 -RGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA 59 usage_00289.pdb 1 -RGLARRALERD-SEGADGIIVKPSTFYLDIVRDASEICKDLPICAYHVSGEYA-LHAAA 57 usage_00312.pdb 1 GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA 60 RGLARRALERD SEGADGIIVKPSTFYLDImRDASEICKDLPICAYHVSGEYA LHAAA usage_00049.pdb 61 EKGVVDLKTIAFESHQGFLRAG 82 usage_00050.pdb 61 EKGVVDLKTIAFESHQGFLRAG 82 usage_00073.pdb 61 EKGVVDLKTIAFESHQGFLRAG 82 usage_00074.pdb 61 EKGVVDLKTIAFESHQGFLRAG 82 usage_00075.pdb 61 EKGVVDLKTIAFESHQGFLRAG 82 usage_00115.pdb 61 EKGVVDLKTIAFESHQGFLRAG 82 usage_00194.pdb 60 EKGVVDLKTIAFESHTGFLRAG 81 usage_00289.pdb 58 EKGVVDLKTIAFESHQGFLRAG 79 usage_00312.pdb 61 EKGVVDLKTIAFESHQGFLRAG 82 EKGVVDLKTIAFESHqGFLRAG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################