################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:00 2021 # Report_file: c_0992_19.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00037.pdb # 2: usage_00102.pdb # 3: usage_00105.pdb # 4: usage_00106.pdb # 5: usage_00107.pdb # 6: usage_00108.pdb # 7: usage_00225.pdb # 8: usage_00226.pdb # 9: usage_00237.pdb # 10: usage_00240.pdb # 11: usage_00241.pdb # 12: usage_00296.pdb # 13: usage_00384.pdb # # Length: 37 # Identity: 7/ 37 ( 18.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 37 ( 45.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 37 ( 10.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00037.pdb 1 GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGM 37 usage_00102.pdb 1 -TQRHAPVIVIGSGPAGYTAAIYAARAMLKPVVIAG- 35 usage_00105.pdb 1 --TKHSKLLILGSGPAGYTAAVYAARANLQPVLITGM 35 usage_00106.pdb 1 -TTKHSKLLILGSGPAGYTAAVYAARANLQPVLITG- 35 usage_00107.pdb 1 --TKHSKLLILGSGPAGYTAAVYAARANLQPVLITGM 35 usage_00108.pdb 1 -TTKHSKLLILGSGPAGYTAAVYAARANLQPVLITG- 35 usage_00225.pdb 1 -TTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGM 36 usage_00226.pdb 1 -TTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGM 36 usage_00237.pdb 1 -TTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGM 36 usage_00240.pdb 1 -APLRTRVCIIGSGPAAHTAAIYAARAELKPVLFEG- 35 usage_00241.pdb 1 --PLRTRVCIIGSGPAAHTAAIYAARAELKPVLFEG- 34 usage_00296.pdb 1 -ETHNTRLCIVGSGPAAHTAAIYAARAELKPLLFEG- 35 usage_00384.pdb 1 ---KSTKILILGAGPAGFSAAKAALGKCDDITMINS- 33 i GsGPA tAA yAara l p g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################