################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:23 2021 # Report_file: c_1255_32.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00137.pdb # 2: usage_00138.pdb # 3: usage_00139.pdb # 4: usage_00141.pdb # 5: usage_00886.pdb # 6: usage_00887.pdb # 7: usage_00888.pdb # 8: usage_00889.pdb # 9: usage_01672.pdb # 10: usage_01673.pdb # 11: usage_01674.pdb # 12: usage_01675.pdb # # Length: 41 # Identity: 34/ 41 ( 82.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 41 ( 87.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 41 ( 12.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00137.pdb 1 NIFMRSLATR-EAGSEISQALPDVIAACKAARFDLVIVET- 39 usage_00138.pdb 1 NIFMRSLATR-EAGSEISQALPDVIAACKAARFDLVIVETS 40 usage_00139.pdb 1 NIFMRSLATREA---GISQALPDVIAACKAARFDLVIVETS 38 usage_00141.pdb 1 NIFMRSLATR-EAGSEISQALPDVIAACKAARFDLVIVETS 40 usage_00886.pdb 1 NIFMRSLATR-EA-SEISQALPDVIAACKAARFDLVIVETS 39 usage_00887.pdb 1 NIFMRSLATR-EAGSEISQALPDVIAACKAARFDLVIVETS 40 usage_00888.pdb 1 NIFMRSLATR-E--SEISQALPDVIAACKAARFDLVIVETS 38 usage_00889.pdb 1 NIFMRSLATR-EAGSEISQALPDVIAACKAARFDLVIVETS 40 usage_01672.pdb 1 NIFMRSLATR-EA-SEISQALPDVIAACKAARFDLVIVETS 39 usage_01673.pdb 1 NIFMRSLATR-EAGSEISQALPDVIAACKAARFDLVIVETS 40 usage_01674.pdb 1 NIFMRSLATR-EAGSEISQALPDVIAACKAARFDLVIVETS 40 usage_01675.pdb 1 NIFMRSLATR-EAGSEISQALPDVIAACKAARFDLVIVETS 40 NIFMRSLATR e eISQALPDVIAACKAARFDLVIVET #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################