################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:34 2021 # Report_file: c_1315_48.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00074.pdb # 2: usage_00075.pdb # 3: usage_00151.pdb # 4: usage_00152.pdb # 5: usage_00153.pdb # 6: usage_00154.pdb # 7: usage_00172.pdb # 8: usage_00573.pdb # 9: usage_00677.pdb # # Length: 43 # Identity: 20/ 43 ( 46.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 43 ( 46.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 43 ( 34.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00074.pdb 1 --------SQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFD 35 usage_00075.pdb 1 --------SQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFD 35 usage_00151.pdb 1 --------AYCPNILFPYARECITSMVSRGTFPQLNLAPVNF- 34 usage_00152.pdb 1 --------------LFPYARECITSMVSRGTFPQLNLAPVNF- 28 usage_00153.pdb 1 --------------LFPYARECITSMVSRGTFPQLNLAPVNF- 28 usage_00154.pdb 1 --------AYCPNILFPYARECITSMVSRGTFPQLNLAPVNFD 35 usage_00172.pdb 1 --------SQCPNMLFPYARELVSNLVNRGTFPALNLSPVNF- 34 usage_00573.pdb 1 --------AYCPNILFPYARECITSMVSRGTFPQLNLAPVNF- 34 usage_00677.pdb 1 TQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFD 43 LFPYARE V RGTFP LNL PVNF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################