################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:44 2021 # Report_file: c_0813_24.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00100.pdb # 2: usage_00101.pdb # 3: usage_00165.pdb # 4: usage_00166.pdb # 5: usage_00246.pdb # 6: usage_00306.pdb # # Length: 113 # Identity: 23/113 ( 20.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/113 ( 34.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/113 ( 28.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00100.pdb 1 GIAGYVFRTGEILNIPDAYKDPRFDRDIDKRTGYRTRTILAVPLFDRKQNIIGVFQVINK 60 usage_00101.pdb 1 GIAGYVFRTGEILNIPDAYKDPRFDRDIDKRTGYRTRTILAVPLFDRKQNIIGVFQVINK 60 usage_00165.pdb 1 GIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILC-PIV-SRGSVIGVVQ-VNK 57 usage_00166.pdb 1 GIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILC-PIV-SRGSVIGVVQ-VNK 57 usage_00246.pdb 1 GIAGWVAHTKKFFNIPDVKKNNHFSDYLDKKTGYTTVNMMAIPIT-QGKEVLAVVMALNK 59 usage_00306.pdb 1 GIAGYVFRTGEILNIPDAYKDPRFDRDIDKRTGYRTRTILAVPLFDRKQNIIGVFQVINK 60 GIAG V rTge lNIPDay dprF r D TGY Tr il P igV q NK usage_00100.pdb 61 LTNSVFTEEDIELLRHISLYASSTIENAILYEKLKKAHEDVIYRLSHA----- 108 usage_00101.pdb 61 LTNSVFTEEDIELLRHISLYASSTIENAILYEKLKKAHEDVIYRLSHA----- 108 usage_00165.pdb 58 ISGSAFSKTDENNFK-FAVFCALALHCANY------------------HRIR- 90 usage_00166.pdb 58 ISGSAFSKTDENNFK-FAVFCALALHCANY----------------------H 87 usage_00246.pdb 60 LNASEFSKEDEEVFKKYLNFISLVL---------------------------- 84 usage_00306.pdb 61 LTNSVFTEEDIELLRHISLYASSTIENAILYEKLKKAHEDVIYRLSHA----- 108 S F D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################