################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:17:57 2021 # Report_file: c_1302_98.html ################################################################################################ #==================================== # Aligned_structures: 19 # 1: usage_00047.pdb # 2: usage_00123.pdb # 3: usage_00124.pdb # 4: usage_00125.pdb # 5: usage_00126.pdb # 6: usage_00165.pdb # 7: usage_00208.pdb # 8: usage_00227.pdb # 9: usage_00275.pdb # 10: usage_01150.pdb # 11: usage_01151.pdb # 12: usage_01152.pdb # 13: usage_01153.pdb # 14: usage_01154.pdb # 15: usage_01155.pdb # 16: usage_01256.pdb # 17: usage_01257.pdb # 18: usage_01261.pdb # 19: usage_01262.pdb # # Length: 34 # Identity: 24/ 34 ( 70.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 34 ( 70.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 34 ( 14.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00047.pdb 1 DRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCG 34 usage_00123.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_00124.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_00125.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_00126.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_00165.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_00208.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_00227.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_00275.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_01150.pdb 1 -----LKSFLRFREKYGDVFTVHLGPRPVVMLCG 29 usage_01151.pdb 1 -----LKSFLRFREKYGDVFTVHLGPRPVVMLCG 29 usage_01152.pdb 1 -----LKSFLRFREKYGDVFTVHLGPRPVVMLCG 29 usage_01153.pdb 1 -----LKSFLRFREKYGDVFTVHLGPRPVVMLCG 29 usage_01154.pdb 1 -----LKSFLRFREKYGDVFTVHLGPRPVVMLCG 29 usage_01155.pdb 1 -----LKSFLRFREKYGDVFTVHLGPRPVVMLCG 29 usage_01256.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_01257.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_01261.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 usage_01262.pdb 1 ----LLRSFLRLREKYGDVFTVYLGSRPVVVLCG 30 L SFLR REKYGDVFTV LG RPVV LCG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################