################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:41 2021 # Report_file: c_0685_185.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00318.pdb # 2: usage_00366.pdb # 3: usage_00404.pdb # 4: usage_00503.pdb # 5: usage_00572.pdb # 6: usage_00845.pdb # 7: usage_01020.pdb # 8: usage_01281.pdb # # Length: 61 # Identity: 16/ 61 ( 26.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 61 ( 42.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 61 ( 4.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00318.pdb 1 QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQGPGQGLEWIGEIDPSDSYPNY 60 usage_00366.pdb 1 --QLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY 58 usage_00404.pdb 1 -VQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPDKRLEWVATISSGGNYIYY 59 usage_00503.pdb 1 DVQLQASGGGLVQPGGSLRVSCAASGFTFSSYHMAWVRQAPGKGLEWVSTINPGDGSTYY 60 usage_00572.pdb 1 -VQLQESGGGSVQAGGSLRLSCAASGYTDSRYCMAWFRQAPGKEREWVARINSGRDITYY 59 usage_00845.pdb 1 --QLLESGGGLVQPGGSLRLSCAASGFTFPWYRVHWVRQAPGKGLEWVSSIRSSGGFPYY 58 usage_01020.pdb 1 -VQLVESGGGLVQPGGSLRLSCAASGFTFRNSAMHWVRQAPGKGLEWVSSIWYSGSNTYY 59 usage_01281.pdb 1 -VQLVESGGGSVQAGGSLRLSCTASGFTFDDSDMGWYHQAPGNECELVSAIFSDGSTYYA 59 QL sGg V GgSl lSC ASG t W Q Pg Ewv I y usage_00318.pdb 61 N 61 usage_00366.pdb 59 A 59 usage_00404.pdb 60 P 60 usage_00503.pdb 61 A 61 usage_00572.pdb 60 A 60 usage_00845.pdb 59 N 59 usage_01020.pdb 60 A 60 usage_01281.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################