################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:32 2021 # Report_file: c_1304_24.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00002.pdb # 2: usage_00130.pdb # 3: usage_00624.pdb # 4: usage_00742.pdb # 5: usage_00817.pdb # 6: usage_00825.pdb # 7: usage_00826.pdb # 8: usage_00827.pdb # 9: usage_01219.pdb # # Length: 31 # Identity: 5/ 31 ( 16.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 31 ( 38.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 31 ( 12.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00002.pdb 1 KPQEIDGIKKDFEEPGFLAPTGLFLGGEKYM 31 usage_00130.pdb 1 -PQEITGIMKDFEEPGHLAPTGLHLGGIKYM 30 usage_00624.pdb 1 --NEGQTILVVFNEGY-A-PDGVWLGGTKYQ 27 usage_00742.pdb 1 QPNEIGEIVQGFDNPAGLQSNGLHIQGQKFM 31 usage_00817.pdb 1 -PNEIDAIIKEFNEAGQLAPTGLFLGGAKYM 30 usage_00825.pdb 1 -PDEINAIIKEFSEPGALAPTGLFLAGAKYM 30 usage_00826.pdb 1 -PDEINAIIKEFSEPGALAPTGLFLAGAKYM 30 usage_00827.pdb 1 --DEINAIIKEFSEPGALAPTGLFLAGAKYM 29 usage_01219.pdb 1 --EEVAGMIKDFDEPGTLAPTGLFVGGTKYM 29 E i F e l p Gl G Kym #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################