################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:39 2021 # Report_file: c_1076_122.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00780.pdb # 2: usage_00828.pdb # 3: usage_01308.pdb # 4: usage_01309.pdb # 5: usage_01310.pdb # # Length: 81 # Identity: 18/ 81 ( 22.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 81 ( 35.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 34/ 81 ( 42.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00780.pdb 1 -------------------------PSIEHAGMMMVQCLLGGNKIISCGNGGSAGHAQHF 35 usage_00828.pdb 1 DMQHRIRQLFQASIETKQQALEVLPPYIEQASLVMVNALLNEGKILSCGNGGSAGDAQHF 60 usage_01308.pdb 1 --------------------EKILVEPTVQAAELMLQCLMNDGKILACGNGGSAADAQHF 40 usage_01309.pdb 1 -------------------AEKILVEPTVQAAELMLQCLMNDGKILACGNGGSAADAQHF 41 usage_01310.pdb 1 -------------------AEKILVEPTVQAAELMLQCLMNDGKILACGNGGSAADAQHF 41 qA M qcL n gKIl CGNGGSA dAQHF usage_00780.pdb 36 CAQLLNKYETERPSLPAIS-- 54 usage_00828.pdb 61 SSELLNRFERERPSLPAVALT 81 usage_01308.pdb 41 AAEMTG------MELAAVALT 55 usage_01309.pdb 42 AAEMTG-------ELAAVALT 55 usage_01310.pdb 42 AAEMTG-------ELAAVALT 55 ae L Ava #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################