################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:07 2021 # Report_file: c_0875_73.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00002.pdb # 2: usage_00417.pdb # 3: usage_00488.pdb # 4: usage_00689.pdb # 5: usage_00837.pdb # # Length: 134 # Identity: 69/134 ( 51.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 98/134 ( 73.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/134 ( 8.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00002.pdb 1 AREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNLLSVAYKNVIGARRASW 60 usage_00417.pdb 1 -KNELVQKAKLAEQAERYDDMAACMKSVTEQ-G-AELSNEERNLLSVAYKNVVGARRSSW 57 usage_00488.pdb 1 -KNELVQKAKLAEQAERYDDMAACMKSVTEQ-G-AELSNEERNLLSVAYKNVVGARRSSW 57 usage_00689.pdb 1 -KNELVQKAKLAEQAERYDDMAACMKSVTEQ-G-AELSNEERNLLSVAYKNVVGARRSSW 57 usage_00837.pdb 1 ERASLIQKAKLAEQAERYEDMAAFMKGAVEK-G-EELS-EERNLLSVAYKNVVGGQRAAW 57 elvqkAKLAEQAERY dMaa Mk v e G ELs EERNLLSVAYKNVvGarR sW usage_00002.pdb 61 RIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAASGDSKVF 120 usage_00417.pdb 58 RVVSSIEQKTE----EKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF 113 usage_00488.pdb 58 RVVSSIEQKTE--GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF 115 usage_00689.pdb 58 RVVSSIEQKTE----EKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF 113 usage_00837.pdb 58 RVLSSIEQKSN-----K--PEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVF 110 Rv SSIEQK e k REYReKiEtEL iC vL LL LIp A aeSkVF usage_00002.pdb 121 YLKMKGDYHRYLAE 134 usage_00417.pdb 114 YLKMKGDYYRYLAE 127 usage_00488.pdb 116 YLKMKGDYYRYLAE 129 usage_00689.pdb 114 YLKMKGDYYRYLAE 127 usage_00837.pdb 111 YLKMKGDYYRYLAE 124 YLKMKGDYyRYLAE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################