################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:55 2021 # Report_file: c_0833_35.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00278.pdb # 2: usage_00305.pdb # 3: usage_00331.pdb # 4: usage_00335.pdb # 5: usage_00405.pdb # 6: usage_00406.pdb # 7: usage_00511.pdb # 8: usage_00524.pdb # # Length: 76 # Identity: 12/ 76 ( 15.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 76 ( 42.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 76 ( 11.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00278.pdb 1 TWAQFSARNRAVAARLQQV-TQPGDRVAILCPQNLDYLVAFFGALYAGRIAVPLFDP-S- 57 usage_00305.pdb 1 TYEQLDQHAKAIAATLQAEGAKPGDRVLLLFAPGLPLIQAFLGCLYAGCIAVPIYPP-AQ 59 usage_00331.pdb 1 TWAQFSARNRAVAARLQQV-TQPGDRVAILCPQNLDYLVAFFGALYAGRIAVPLFDP-S- 57 usage_00335.pdb 1 TWAQFSARNRAVAARLQQV-TQPGDRVAILCPQNLDYLVAFFGALYAGRIAVPLFDP-S- 57 usage_00405.pdb 1 TWAQFSARNRAVAARLQQV-TQPGDRVAILCPQNLDYLVAFFGALYAGRIAVPLFDP-S- 57 usage_00406.pdb 1 TWAQFSARNRAVAARLQQV-TQPGDRVAILCPQNLDYLVAFFGALYAGRIAVPLFDP-S- 57 usage_00511.pdb 1 LWSEFSARNRAVGARLQQV-TQPGDRIAILCPQNLDYLISFFGALYSGRIAVPLFDP-A- 57 usage_00524.pdb 1 EYQTLKARAEAGAKRLLSLNLKKGDRVALIAETSSEFVEAFFACQYAGLVAVPLAIPS-- 58 ar A aarLq pGDRva l l aFfg lYaG iAVPl P usage_00278.pdb 58 -EPGHVGRLHAVLDNC 72 usage_00305.pdb 60 EK--LLDKAQRIVTN- 72 usage_00331.pdb 58 -EPGHVGRLHAVLDNC 72 usage_00335.pdb 58 -E--HVGRLHAVLDN- 69 usage_00405.pdb 58 -EPGHVGRLHAVLDN- 71 usage_00406.pdb 58 -EPGHVGRLHAVLDN- 71 usage_00511.pdb 58 -E--HVGRLHAVLDDC 70 usage_00524.pdb 59 ----WSAKLQGLLASC 70 l l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################