################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:29:30 2021
# Report_file: c_1240_104.html
################################################################################################
#====================================
# Aligned_structures: 15
#   1: usage_00802.pdb
#   2: usage_00846.pdb
#   3: usage_01597.pdb
#   4: usage_01602.pdb
#   5: usage_01611.pdb
#   6: usage_01612.pdb
#   7: usage_01613.pdb
#   8: usage_01614.pdb
#   9: usage_01615.pdb
#  10: usage_01619.pdb
#  11: usage_01620.pdb
#  12: usage_01621.pdb
#  13: usage_01828.pdb
#  14: usage_02138.pdb
#  15: usage_02146.pdb
#
# Length:         36
# Identity:       34/ 36 ( 94.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     34/ 36 ( 94.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 36 (  5.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00802.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_00846.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01597.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPP   36
usage_01602.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01611.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01612.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01613.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01614.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01615.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01619.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01620.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01621.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_01828.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_02138.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
usage_02146.pdb         1  CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR--   34
                           CPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVR  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################