################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:31 2021 # Report_file: c_0772_43.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00194.pdb # 2: usage_00195.pdb # 3: usage_00266.pdb # 4: usage_00494.pdb # 5: usage_00495.pdb # 6: usage_00502.pdb # 7: usage_00638.pdb # 8: usage_00639.pdb # 9: usage_00640.pdb # # Length: 68 # Identity: 63/ 68 ( 92.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/ 68 ( 92.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 68 ( 1.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00194.pdb 1 LYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNK 60 usage_00195.pdb 1 LYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNK 60 usage_00266.pdb 1 LYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNK 60 usage_00494.pdb 1 LYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNK 60 usage_00495.pdb 1 LYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNK 60 usage_00502.pdb 1 LYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNK 60 usage_00638.pdb 1 LYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNK 60 usage_00639.pdb 1 LYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNK 60 usage_00640.pdb 1 LYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKYLDGGNK 60 LYAVDFWD TGTN NNGPVLS FVQKVLDETGAKKVDIVAHSMGGANTLYYIK LDGGNK usage_00194.pdb 61 VANVVTL- 67 usage_00195.pdb 61 VANVVTL- 67 usage_00266.pdb 61 VANVVTL- 67 usage_00494.pdb 61 VANVVTL- 67 usage_00495.pdb 61 VANVVTLG 68 usage_00502.pdb 61 VANVVTLG 68 usage_00638.pdb 61 VANVVTL- 67 usage_00639.pdb 61 VANVVTL- 67 usage_00640.pdb 61 VANVVTL- 67 VANVVTL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################