################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:22 2021 # Report_file: c_1237_19.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00483.pdb # 2: usage_00521.pdb # 3: usage_00522.pdb # 4: usage_00574.pdb # 5: usage_00615.pdb # 6: usage_00616.pdb # 7: usage_00727.pdb # 8: usage_00728.pdb # 9: usage_00805.pdb # # Length: 47 # Identity: 2/ 47 ( 4.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 47 ( 17.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 47 ( 51.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00483.pdb 1 -KVFRDPVH-NYIHVQHQVILDLIN---------------------- 23 usage_00521.pdb 1 -SVRYDPYTQRVEVLDNTQQLKILADSINSEVGILC----------- 35 usage_00522.pdb 1 -SVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCNA--------- 37 usage_00574.pdb 1 -SVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCNAL-------- 38 usage_00615.pdb 1 -SVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCNAL-------- 38 usage_00616.pdb 1 -SVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCNA--------- 37 usage_00727.pdb 1 -SVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG 46 usage_00728.pdb 1 -SVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQY-- 44 usage_00805.pdb 1 FSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKI----- 42 sV Pyt e l t #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################