################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:06 2021 # Report_file: c_1172_63.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_02113.pdb # 2: usage_02114.pdb # 3: usage_02115.pdb # 4: usage_02116.pdb # 5: usage_02119.pdb # 6: usage_02120.pdb # 7: usage_02121.pdb # 8: usage_02122.pdb # 9: usage_02123.pdb # 10: usage_04910.pdb # 11: usage_04911.pdb # 12: usage_04912.pdb # 13: usage_04913.pdb # # Length: 56 # Identity: 47/ 56 ( 83.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 56 ( 89.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 56 ( 10.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02113.pdb 1 GLRPSVAYLQSKGKNLGVVAGRNYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 56 usage_02114.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 52 usage_02115.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 52 usage_02116.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 52 usage_02119.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 52 usage_02120.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 52 usage_02121.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 52 usage_02122.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 52 usage_02123.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKINLL 52 usage_04910.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKIN-- 50 usage_04911.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKIN-- 50 usage_04912.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKIN-- 50 usage_04913.pdb 1 GLRPSLAYLQSKGKNLGR----GYDDEDILKYVDVGATYYFNKNMSTYVDYKIN-- 50 GLRPSlAYLQSKGKNLGr gYDDEDILKYVDVGATYYFNKNMSTYVDYKIN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################