################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:52:11 2021 # Report_file: c_0958_35.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00091.pdb # 2: usage_00092.pdb # 3: usage_00569.pdb # 4: usage_00597.pdb # 5: usage_00598.pdb # 6: usage_01053.pdb # 7: usage_01224.pdb # 8: usage_01226.pdb # 9: usage_01227.pdb # 10: usage_01228.pdb # 11: usage_01388.pdb # 12: usage_01390.pdb # # Length: 57 # Identity: 22/ 57 ( 38.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 57 ( 38.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 57 ( 26.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00091.pdb 1 NLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGTVTMECSP--- 54 usage_00092.pdb 1 NLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGTVTMECSP--- 54 usage_00569.pdb 1 NLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSITEAELTGYGTVTMECSP--- 54 usage_00597.pdb 1 -LKYTVIITVHTGDQHQVGNE-T-QGVTAEITSQASTAEAILPEYGTLGLECSPRT- 53 usage_00598.pdb 1 NLKYTVIITVHTGDQHQVGNE-T-QGVTAEITSQASTAEAILPEYGTLGLECSPRT- 54 usage_01053.pdb 1 -LEYTIVITPHSGEEHA-----GKHGKEIKITPQSSITEAELTGYGTVTMECSPRT- 50 usage_01224.pdb 1 -LEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRTG 56 usage_01226.pdb 1 NLEYTIVITPHSGE-----------GKEIKITPQSSTTEAELTGYGTVTMECSPRT- 45 usage_01227.pdb 1 -LEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRT- 55 usage_01228.pdb 1 -LEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRT- 55 usage_01388.pdb 1 NLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGTVTMECSPR-- 55 usage_01390.pdb 1 NLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGTVTMECSPR-- 55 L YT IT H G G IT Q S EA L YGT ECSP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################