################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:07:55 2021
# Report_file: c_1208_17.html
################################################################################################
#====================================
# Aligned_structures: 9
#   1: usage_00725.pdb
#   2: usage_00727.pdb
#   3: usage_01932.pdb
#   4: usage_01935.pdb
#   5: usage_01937.pdb
#   6: usage_01939.pdb
#   7: usage_01941.pdb
#   8: usage_01943.pdb
#   9: usage_02430.pdb
#
# Length:         38
# Identity:        9/ 38 ( 23.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     11/ 38 ( 28.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            7/ 38 ( 18.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00725.pdb         1  -----LVSCDLTSPAKSRIKIYLLEQMVSLEAMEDLWT   33
usage_00727.pdb         1  TASPRLVSCDLTSPAKSRIKIYLLEQMVSLEAMEDLWT   38
usage_01932.pdb         1  ---DAFLCCDLVDPAHTRFKVYIADPLVTLARAEEHWT   35
usage_01935.pdb         1  ---DAFLCCDLVDPAHTRFKVYIADPLVTLARAEEHWT   35
usage_01937.pdb         1  ---DAFLCCDLVDPAHTRFKVYIADPLVTLARAEEHWT   35
usage_01939.pdb         1  ---DAFLCCDLVDPAHTRFKVYIADPLVTLARAEEHWT   35
usage_01941.pdb         1  ----AFLCCDLVDPAHTRFKVYIADPLVTLARAEEHWT   34
usage_01943.pdb         1  ----AFLCCDLVDPAHTRFKVYIADPLVTLARAEEHWT   34
usage_02430.pdb         1  ----HFLSTDLVEPGKSRVKFYASERHVNLQMVEDI--   32
                                   cDL  Pa  R K Y     V L   E    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################