################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:16 2021 # Report_file: c_1373_67.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00590.pdb # 2: usage_00684.pdb # 3: usage_00685.pdb # 4: usage_00686.pdb # 5: usage_00908.pdb # 6: usage_01615.pdb # 7: usage_01616.pdb # 8: usage_01730.pdb # 9: usage_01731.pdb # 10: usage_01798.pdb # # Length: 44 # Identity: 13/ 44 ( 29.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 44 ( 40.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 44 ( 15.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00590.pdb 1 ---TKKVLDIVK-DIEFGKTLTYGDIAKKLNTSPRAVGMALKRN 40 usage_00684.pdb 1 -PFRLSVFKEVM-KIPWGKVMTYKQIADSLGTSPRAVGMALSKN 42 usage_00685.pdb 1 YPFRLSVFKEVM-KIPWGKVMTYKQIADSLGTSPRAVGMALSKN 43 usage_00686.pdb 1 -PFRLSVFKEVM-KIPWGKVMTYKQIADSLGTSPRAVGMALSKN 42 usage_00908.pdb 1 -EFRIRVFKEVM-RIKWGEVRTYKQVADAVKTSPRAVGTALS-- 40 usage_01615.pdb 1 -PFRLSVFKEVM-KIPWGKVMTYKQIADSLGTSPRAVGMALS-- 40 usage_01616.pdb 1 -PFRLSVFKEVM-KIPWGKVMTYKQIADSLGTSPRAVGMAL--- 39 usage_01730.pdb 1 -PFRLSVFKEVM-KIPWGKVMTYKQIADSLGTSPRAVGMALSKN 42 usage_01731.pdb 1 -PFRLSVFKEVM-KIPWGKVMTYKQIADSLGTSPRAVGMAL--- 39 usage_01798.pdb 1 TPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRN 44 V v i G v TY A l TSPRAVG Al #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################