################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:02:11 2021 # Report_file: c_0787_80.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00029.pdb # 2: usage_00037.pdb # 3: usage_00438.pdb # 4: usage_00439.pdb # 5: usage_00620.pdb # 6: usage_00683.pdb # 7: usage_00934.pdb # 8: usage_00935.pdb # 9: usage_00936.pdb # 10: usage_01022.pdb # 11: usage_01023.pdb # 12: usage_01024.pdb # 13: usage_01049.pdb # # Length: 55 # Identity: 48/ 55 ( 87.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 55 ( 90.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 55 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00029.pdb 1 RARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYA 55 usage_00037.pdb 1 RARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYA 55 usage_00438.pdb 1 RARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYA 55 usage_00439.pdb 1 RARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYA 55 usage_00620.pdb 1 RARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYA 55 usage_00683.pdb 1 RARTAQTPGGTGALRVAADFLAKNTSVRRVWVSNPGWPTHKSVFNSAGLEVREYA 55 usage_00934.pdb 1 RARTAQTPGGSGALRVGADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYA 55 usage_00935.pdb 1 RARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYA 55 usage_00936.pdb 1 RARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYA 55 usage_01022.pdb 1 RARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYA 55 usage_01023.pdb 1 RARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYA 55 usage_01024.pdb 1 RARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYA 55 usage_01049.pdb 1 RARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYA 55 RARTAQTPGG GALRVaADFLAKNTSVkRVWVSNP WP HK FNSAGLEVREYA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################