################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:15:56 2021 # Report_file: c_0947_55.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00007.pdb # 2: usage_00028.pdb # 3: usage_00085.pdb # 4: usage_00089.pdb # 5: usage_00090.pdb # 6: usage_00093.pdb # 7: usage_00166.pdb # 8: usage_00195.pdb # 9: usage_00196.pdb # 10: usage_00290.pdb # 11: usage_00291.pdb # 12: usage_00403.pdb # 13: usage_00451.pdb # 14: usage_00454.pdb # # Length: 41 # Identity: 9/ 41 ( 22.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 41 ( 51.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 41 ( 24.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00007.pdb 1 RRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRW-- 39 usage_00028.pdb 1 RRVYPEVTVYPA--------NLLVCSVNGFYPGSIEVRW-- 31 usage_00085.pdb 1 RRVEPTVTISPS-------HNLLVCSVTDFYPAQIKVRW-- 32 usage_00089.pdb 1 RRVEPTVTVYPTKTQPLQHHNLLVCSVSDFYPGNIEVRW-- 39 usage_00090.pdb 1 RRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRW-- 39 usage_00093.pdb 1 RRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRW-- 39 usage_00166.pdb 1 RRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFR 41 usage_00195.pdb 1 RRVEPKVTVYPSKTQ---HHNLLVCSVSGFYPGSIEVRW-- 36 usage_00196.pdb 1 RRVEPKVTVYPSKTQ---HHNLLVCSVSGFYPGSIEVRW-- 36 usage_00290.pdb 1 RRVEPTVTISPS-------HNLLVCSVTDFYPAQIKVRW-- 32 usage_00291.pdb 1 RRVEPTVTISPS-------HNLLVCSVTDFYPAQIKVRW-- 32 usage_00403.pdb 1 RRVEPTVTISPS--------NLLICSVTDFYPSQIKVRW-- 31 usage_00451.pdb 1 KQEKPVAWLSSVP-SSAHGHRQLVCHVSGFYPKPVWVMW-- 38 usage_00454.pdb 1 RRVEPTVTISPS--------NLLVCSVTDFYPAQIKVRW-- 31 rrv P vt p nlLvCsV FYP i VrW #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################