################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:14 2021 # Report_file: c_1115_11.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00329.pdb # 2: usage_00330.pdb # 3: usage_00490.pdb # 4: usage_00579.pdb # 5: usage_00580.pdb # 6: usage_00581.pdb # 7: usage_00582.pdb # 8: usage_00583.pdb # 9: usage_01573.pdb # 10: usage_01574.pdb # 11: usage_01600.pdb # # Length: 85 # Identity: 6/ 85 ( 7.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 85 ( 25.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 85 ( 22.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00329.pdb 1 --AHIDDLITAHLRGW-T--LDRLPAVDRAILRVSVWELLHAADVPEPVVVDEAVQLAKE 55 usage_00330.pdb 1 --AHIDDLITAHLRGW-T--LDRLPAVDRAILRVSVWELLHAADVPEPVVVDEAVQLAKE 55 usage_00490.pdb 1 TLSQLDWLINKLMARPMTGK----QRTVHYLIMVGLYQLLY-TRIPPHAALAETVEGAIA 55 usage_00579.pdb 1 -LSMIDDLISRYLEKW-S--LNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKR 56 usage_00580.pdb 1 -LSMIDDLISRYLEKW-S--LNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKR 56 usage_00581.pdb 1 -LSMIDDLISRYLEKW-S--LNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKR 56 usage_00582.pdb 1 -LSMIDDLISRYLEKW-S--LNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKR 56 usage_00583.pdb 1 ----IDDLISRYLEKW-S--LNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKR 53 usage_01573.pdb 1 NLSMIDDLISRYLEKW-S--LNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKR 57 usage_01574.pdb 1 NLSMIDDLISRYLEKW-S--LNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKR 57 usage_01600.pdb 1 HIEEIDSIIEKHLKGW-S--IDRLGYVERNALRLGVAELIFLKSKEPGRVFIDIVDLVKK 57 iD lI l w v r lr eLl p e ak usage_00329.pdb 56 LSTDDSPGFVNGVLGQVM------- 73 usage_00330.pdb 56 LSTDDSPGFVNGVLGQVM------- 73 usage_00490.pdb 56 IKRPQLKGLINGVLRQFQR------ 74 usage_00579.pdb 57 YGTENSGKFVNGILDRIAKE----- 76 usage_00580.pdb 57 YGTENSGKFVNGILDRIAKE----- 76 usage_00581.pdb 57 YGTENSGKFVNGILDRIAKE----- 76 usage_00582.pdb 57 YGTENSGKFVNGILDRIAKE----- 76 usage_00583.pdb 54 YGTENSGKFVNGILDRIAKEHA--- 75 usage_01573.pdb 58 YGTENSGKFVNGILDRIAKE----- 77 usage_01574.pdb 58 YGTENSGKFVNGILDRIAKE----- 77 usage_01600.pdb 58 YADEKAGKFVNGVLSAIYKAYITSS 82 fvNG L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################