################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:50:03 2021 # Report_file: c_1132_5.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00181.pdb # 2: usage_00227.pdb # 3: usage_00299.pdb # 4: usage_00372.pdb # 5: usage_00380.pdb # 6: usage_00381.pdb # 7: usage_00544.pdb # 8: usage_00545.pdb # # Length: 86 # Identity: 3/ 86 ( 3.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 86 ( 16.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 86 ( 25.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00181.pdb 1 SADDV---ERAVASARRAFAAWSALDLDARCTIVKRFAALLVERKEALATMIGRETGKPL 57 usage_00227.pdb 1 -KEDI---DYAAQTAAEAFKTWSKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNT 56 usage_00299.pdb 1 SREDV---ERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALETLDTGKPL 57 usage_00372.pdb 1 -----DLARAFSFAREDGGAALRALTYAQRAARLADIVKLLQAKRGDYYAIATANSGTTR 55 usage_00380.pdb 1 SREDV---ERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALETLDTGKPL 57 usage_00381.pdb 1 SREDV---ERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALETLDTGKPL 57 usage_00544.pdb 1 SREDV---ERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALETLDTGKPL 57 usage_00545.pdb 1 SREDV---ERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALETLDTGKPL 57 a a w a R il L la t Gk usage_00181.pdb 58 WEARTEVASMAAK------------- 70 usage_00227.pdb 57 KEALGEVGRGIENVEFA-A------- 74 usage_00299.pdb 58 AETRSVDIVTGADVLEYYAGL----- 78 usage_00372.pdb 56 ND-SAVDIDGGIFTLSYYAKLGASLG 80 usage_00380.pdb 58 AETRSVDIVTGADVLEYYAGL----- 78 usage_00381.pdb 58 AETRSVDIVTGADVLEYYAGL----- 78 usage_00544.pdb 58 AETRSVDIVTGADVLEYYAGL----- 78 usage_00545.pdb 58 AETRSVDIVTGADVLEYYAGL----- 78 e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################