################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:00:51 2021 # Report_file: c_0380_15.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00021.pdb # 2: usage_00048.pdb # 3: usage_00050.pdb # 4: usage_00052.pdb # 5: usage_00155.pdb # 6: usage_00159.pdb # 7: usage_00160.pdb # 8: usage_00162.pdb # 9: usage_00164.pdb # 10: usage_00166.pdb # 11: usage_00168.pdb # 12: usage_00170.pdb # 13: usage_00172.pdb # # Length: 51 # Identity: 18/ 51 ( 35.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 51 ( 35.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 51 ( 21.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00021.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00048.pdb 1 FEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 51 usage_00050.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00052.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00155.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00159.pdb 1 -----------RAFLGVGARVIPGVTIGADTIVGAGGVVVRDLPDSVLAIG 40 usage_00160.pdb 1 -----------RAFLGVGARVIPGVTIGADTIVGAGGVVVRDLPDSVLAIG 40 usage_00162.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00164.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00166.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00168.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00170.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 usage_00172.pdb 1 -----------NTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVG 40 G V PGVTIG GAG VV D P LA G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################