################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:56 2021 # Report_file: c_1214_1.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00362.pdb # 2: usage_00363.pdb # 3: usage_00420.pdb # 4: usage_00421.pdb # 5: usage_00471.pdb # 6: usage_00502.pdb # # Length: 64 # Identity: 19/ 64 ( 29.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 64 ( 29.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 64 ( 9.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00362.pdb 1 -INYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRV 59 usage_00363.pdb 1 -INYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRV 59 usage_00420.pdb 1 -INYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRV 59 usage_00421.pdb 1 -INYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRV 59 usage_00471.pdb 1 QVSFGIN-VALHHGQPKI-NLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVA 58 usage_00502.pdb 1 -VSFGINMVALHHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVA 59 N VA P I HRREV R F KA R HI E L usage_00362.pdb 60 ISIL 63 usage_00363.pdb 60 ISIL 63 usage_00420.pdb 60 I--- 60 usage_00421.pdb 60 I--- 60 usage_00471.pdb 59 LANI 62 usage_00502.pdb 60 LAN- 62 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################