################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:24:13 2021 # Report_file: c_1082_9.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00143.pdb # 2: usage_00144.pdb # 3: usage_00302.pdb # 4: usage_00561.pdb # 5: usage_00562.pdb # 6: usage_00704.pdb # # Length: 72 # Identity: 14/ 72 ( 19.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/ 72 ( 80.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 72 ( 18.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00143.pdb 1 -GLEETRYVFLGGNQLEARFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFRE-AHPQAQ 58 usage_00144.pdb 1 -GLEETRYVFLGGNQLEARFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFRE-AHPQAQ 58 usage_00302.pdb 1 -AIRESLYKFVRPSRILEKA--KERKVIRILDVGFGLGYNLAVALKHLWEVNPK------ 51 usage_00561.pdb 1 --LEETRYVFLGGNQLEVRFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFRE-AHPQAQ 57 usage_00562.pdb 1 --LEETRYVFLGGNQLEVRFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFRE-AHPQAQ 57 usage_00704.pdb 1 NGLEETRYVFLGGNQLEVRFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFRE-AHPQAQ 59 leEtrYvFlggnqle rf hphplfvvaesGFGtGlNfltlwqafdqfre usage_00143.pdb 59 LQRLHFISFEK- 69 usage_00144.pdb 59 LQRLHFISFEK- 69 usage_00302.pdb 52 -LRVEIISFEK- 61 usage_00561.pdb 58 LQRLHFISFEKF 69 usage_00562.pdb 58 LQRLHFISFEK- 68 usage_00704.pdb 60 LQRLHFISFEK- 70 qRlhfISFEK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################