################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:47 2021 # Report_file: c_0832_61.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00286.pdb # 2: usage_00381.pdb # 3: usage_00430.pdb # 4: usage_00678.pdb # 5: usage_00812.pdb # 6: usage_00813.pdb # # Length: 82 # Identity: 11/ 82 ( 13.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 82 ( 48.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 82 ( 29.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00286.pdb 1 ------QPELANKVDMVWIVGGSSVYKEAMNHPGHL-KLFVTRIMQDFESDTFFPEIDLE 53 usage_00381.pdb 1 SVEEAVDIAASLDAETAYVIGGAAIYALFQPH---LDRMVLSRVPGEYEGDTYYPEWDAA 57 usage_00430.pdb 1 ------QPELANKVDMVWIVGGSSVYKEAMNHPGHL-KLFVTRIMQDFESDTFFPEIDLE 53 usage_00678.pdb 1 ------QPELANKVDMVWIVGGSSVYKEAMNHPGHL-KLFVTRIMQDFESDTFFPEIDLE 53 usage_00812.pdb 1 ------SPELKSKVDMVWIVGGTAVYKAAMEKPINH-RLFVTRILHEFESDTFFPEIDYK 53 usage_00813.pdb 1 ------SPELKSKVDMVWIVGGTAVYKAAMEKPINH-RLFVTRILHEFESDTFFPEIDYK 53 pel kvdmvwivGG vYk am lfvtRi fEsDTffPEiD usage_00286.pdb 54 KYKLLPEYP---GVLSDVQEEK 72 usage_00381.pdb 58 EWELDA-ETDHE---------- 68 usage_00430.pdb 54 KYKLLPEYP---GVLSDVQEEK 72 usage_00678.pdb 54 KYKLLPEYP---GVLSDVQEEK 72 usage_00812.pdb 54 DFKLLTEYP---GVPADIQEED 72 usage_00813.pdb 54 DFKLLTEYP---GVPADIQEE- 71 kLl yp #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################