################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:20 2021 # Report_file: c_1442_6.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_13798.pdb # 2: usage_14132.pdb # 3: usage_15658.pdb # 4: usage_15660.pdb # 5: usage_17192.pdb # 6: usage_17193.pdb # 7: usage_17194.pdb # 8: usage_18958.pdb # 9: usage_21002.pdb # 10: usage_21003.pdb # 11: usage_21004.pdb # # Length: 39 # Identity: 22/ 39 ( 56.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 39 ( 69.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 39 ( 28.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_13798.pdb 1 --HYWTTQ---AAIGLAWIPYFGPAAEGIYTEGL----- 29 usage_14132.pdb 1 NLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQD 39 usage_15658.pdb 1 --HYWTTQDEGAAIGLAWIPYFGPAAEGIYTEG------ 31 usage_15660.pdb 1 --HYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGL----- 32 usage_17192.pdb 1 --HYWTTQDEGAAIGLAWIPYFGPAAEGIYIEG------ 31 usage_17193.pdb 1 NLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHN-- 37 usage_17194.pdb 1 NLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHN-- 37 usage_18958.pdb 1 --HYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHN-- 35 usage_21002.pdb 1 --HYWTTQ---AAIGLAWIPYFGPAAEGIYTEGL----- 29 usage_21003.pdb 1 --HYWTTQ---AAIGLAWIPYFGPAAEGIYTEGL----- 29 usage_21004.pdb 1 --HYWTTQ---AAIGLAWIPYFGPAAEGIYTEGL----- 29 HYWTtQ aAiGlAWIPYFGPaAEGIY EG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################