################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:52 2021 # Report_file: c_0821_33.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00211.pdb # 2: usage_00382.pdb # 3: usage_00516.pdb # 4: usage_00696.pdb # 5: usage_00697.pdb # 6: usage_00732.pdb # 7: usage_00934.pdb # 8: usage_01413.pdb # # Length: 90 # Identity: 13/ 90 ( 14.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 90 ( 21.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/ 90 ( 32.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00211.pdb 1 ATSIINTILNNIYVLYALRRHYEGVELDTYTMISYGDDIVVASDYDLDFEALKPHFKSLG 60 usage_00382.pdb 1 GTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYG 60 usage_00516.pdb 1 --SIFN-SINNIIIRTLVLDAYKHIDLDKLKIIAYGDDVIFSYKYKLD-EAIAKEGQKYG 56 usage_00696.pdb 1 -TSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYG 59 usage_00697.pdb 1 -TSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYG 59 usage_00732.pdb 1 ATSMLNTIMNNIIIRAGLYLTYKNFEFDDVKVLSYGDDLLVATNYQLNFDRVRTSLAKTG 60 usage_00934.pdb 1 -TSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYG 59 usage_01413.pdb 1 ATSIINTILNNIYVLYALRRHYEGVELDTYTMISYGDDIVVASDYDLDFEALKPHFKSLG 60 Si N NN l Y lD i YGDD d G usage_00211.pdb 61 QTITP------------------------- 65 usage_00382.pdb 61 LTMTPADKSATFETVTWENVTFL-KRFFRA 89 usage_00516.pdb 57 LTITP------------------------- 61 usage_00696.pdb 60 LTMTPADKSATFETVTWENVTFL-KRFFRA 88 usage_00697.pdb 60 LTMTP------------------------- 64 usage_00732.pdb 61 YKITPANKTSTFPLESTLEDVVFLKRKFKK 90 usage_00934.pdb 60 LTMTP------------------------- 64 usage_01413.pdb 61 QTITP------------------------- 65 t TP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################