################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:00:07 2021 # Report_file: c_1419_120.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00009.pdb # 2: usage_00685.pdb # 3: usage_01057.pdb # 4: usage_01059.pdb # # Length: 76 # Identity: 10/ 76 ( 13.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 76 ( 35.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 76 ( 15.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00009.pdb 1 -EEVYFDVIRKKTAALFAACAEAAALSVQVGEEEVAFARLLGEYIGICFQIKDDIFDYFD 59 usage_00685.pdb 1 SEEEYYRMIDQKTGQLFSIATSLLLNAA--RTKIQSCLHRLTRLLGRCFQIRDDYQNLVS 58 usage_01057.pdb 1 -LDDYIKMVSLKTGALIAAAAKWGVLSVSDDRGLAEAAWNFGMAAGVAFQIIDDVLDIYG 59 usage_01059.pdb 1 -LDDYIKMVSLKTGALIAAAAKWGVLSVSDDRGLAEAAWNFGMAAGVAFQIIDDVLDIYG 59 Y m KTgaL aaaa lsv a g G FQI DD d usage_00009.pdb 60 S-K--GKPTGNDMLEG 72 usage_00685.pdb 59 ---------ADYTKQK 65 usage_01057.pdb 60 DPKKFGKEIGKDIKEH 75 usage_01059.pdb 60 D------EIGKDIKEH 69 g d ke #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################