################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:55 2021 # Report_file: c_0974_55.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00148.pdb # 2: usage_00472.pdb # 3: usage_00474.pdb # 4: usage_00512.pdb # 5: usage_01113.pdb # 6: usage_01114.pdb # 7: usage_01132.pdb # 8: usage_01133.pdb # 9: usage_01138.pdb # 10: usage_01153.pdb # # Length: 55 # Identity: 27/ 55 ( 49.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 55 ( 49.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 55 ( 12.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00148.pdb 1 DILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESID--- 52 usage_00472.pdb 1 EIILVPIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRN 55 usage_00474.pdb 1 EIILVPIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRN 55 usage_00512.pdb 1 DILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQE------ 49 usage_01113.pdb 1 DILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQ------- 48 usage_01114.pdb 1 DILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKR 55 usage_01132.pdb 1 DILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESID--- 52 usage_01133.pdb 1 DILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESID--- 52 usage_01138.pdb 1 DILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDK-- 53 usage_01153.pdb 1 EIILVPIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRN 55 I LVPIH VHW L V D RKK Y DSMG C ILLQYL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################