################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:57 2021 # Report_file: c_0868_34.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00007.pdb # 2: usage_00008.pdb # 3: usage_00053.pdb # 4: usage_00055.pdb # 5: usage_00056.pdb # 6: usage_00250.pdb # # Length: 81 # Identity: 14/ 81 ( 17.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 81 ( 39.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 81 ( 14.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00007.pdb 1 -PRLVEAIKDQAEKLIHCSNL-FWNRPQ-ELAELLSKNT---FGGKVFFANTGTEANEAA 54 usage_00008.pdb 1 -PRLVEAIKDQAEKLIHCSNL-FWNRPQ-ELAELLSKNT---FGGKVFFANTGTEANEAA 54 usage_00053.pdb 1 -PRLVEAIKDQAEKLIHCSNL-FWNRPQMELAELLSKNT---FGGKVFFANTGTEANEAA 55 usage_00055.pdb 1 -PKLTEALKEQVEKLLHVSNL-YENPWQEELAHKLVKHF--WTEGKVFFANSGTESVEAA 56 usage_00056.pdb 1 HEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKLAKIAPGNSPKMVSFGNSGSDANDAI 60 usage_00250.pdb 1 -AKFNAKIKAQVDKLLHTSNL-YYNENIAAAAKNLAKAS---ALERVFFTNSGTESIEGA 55 aik Q KL H snl n ela L K VfF N Gte eaa usage_00007.pdb 55 IKIARKYGKKKSEKKYRILSA 75 usage_00008.pdb 55 IKIARKYGKKKSEKKYRILSA 75 usage_00053.pdb 56 IKIARKYGKKKSEKKYRILSA 76 usage_00055.pdb 57 IKLARKYWRDKGKNKWKFISF 77 usage_00056.pdb 61 IKFARAYTG---R--QYIVSY 76 usage_00250.pdb 56 -KTARKYAFNKGVKGGQFIAF 75 K ARkY s #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################