################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:16 2021 # Report_file: c_1417_47.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00607.pdb # 2: usage_00608.pdb # 3: usage_00730.pdb # 4: usage_00939.pdb # 5: usage_00940.pdb # 6: usage_01266.pdb # # Length: 94 # Identity: 23/ 94 ( 24.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 94 ( 27.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 57/ 94 ( 60.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00607.pdb 1 SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKT 60 usage_00608.pdb 1 DDQLVSM-SVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKT 59 usage_00730.pdb 1 TDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNR---------------------- 38 usage_00939.pdb 1 TDEELVT-SVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKA 59 usage_00940.pdb 1 TDEELVT-SVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKA 59 usage_01266.pdb 1 SDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKC 60 D lv SVRELN hLRG K E I LKQ RRTLKNR usage_00607.pdb 61 QLIQQVEQLKQEVSRLARERDAYKVKSEKLANS- 93 usage_00608.pdb 60 QLIQQVEQLKQEVSRLARERDAYKVKSEKLANS- 92 usage_00730.pdb ---------------------------------- usage_00939.pdb 60 ELQQEVEKLASENASKLELDALRSK--------Y 85 usage_00940.pdb 60 ELQQEVEKLASENASKLELDALRSK--------Y 85 usage_01266.pdb 61 QLQSQVEQLKLEVGRLAKERDLYKEKYEKLA--- 91 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################