################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:03 2021 # Report_file: c_1260_116.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00275.pdb # 2: usage_00322.pdb # 3: usage_00877.pdb # 4: usage_00878.pdb # 5: usage_01036.pdb # 6: usage_01037.pdb # 7: usage_01038.pdb # 8: usage_01122.pdb # 9: usage_01123.pdb # 10: usage_01261.pdb # 11: usage_01279.pdb # # Length: 30 # Identity: 7/ 30 ( 23.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 30 ( 43.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 30 ( 6.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00275.pdb 1 SPNRVGFDLMRIMNTRYRIDTFQKTYFVID 30 usage_00322.pdb 1 SPNRVGFDLMRIMNTRYRIDTFQKTYFVI- 29 usage_00877.pdb 1 SPNRVGFDLMRIMNTRYRIDTFQKTYFVI- 29 usage_00878.pdb 1 SPNRVGFDLMRIMNTRYRIDTFQKTYFVI- 29 usage_01036.pdb 1 SPNRVGFDLMRIMNTRYRIDTFQKTYFVI- 29 usage_01037.pdb 1 SPNRVGFDLMRIMNTRYRIDTFQKTYFVI- 29 usage_01038.pdb 1 SPNRVGFDLMRIMNTRYRIDTFQKTYFVI- 29 usage_01122.pdb 1 IPVRILFDPVVAFRMPYRIDQLQPVYFVID 30 usage_01123.pdb 1 IPVRILFDPVVAFRMPYRIDQLQPVYFVID 30 usage_01261.pdb 1 SPNRVGFDLMRIMNTRYRIDTFQKTYFVI- 29 usage_01279.pdb 1 -ACVKAFDPKTTCLQECLITTFQEAYFVS- 28 p r FD yrId Q YFVi #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################