################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:08 2021 # Report_file: c_1377_50.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00091.pdb # 2: usage_00099.pdb # 3: usage_00119.pdb # 4: usage_00127.pdb # 5: usage_00162.pdb # 6: usage_00521.pdb # 7: usage_00523.pdb # 8: usage_00747.pdb # 9: usage_00788.pdb # 10: usage_01145.pdb # 11: usage_01312.pdb # # Length: 35 # Identity: 3/ 35 ( 8.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 35 ( 60.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 35 ( 40.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00091.pdb 1 ----VMPTLRQAAEDKSWRVRYMVADKFTELQKAV 31 usage_00099.pdb 1 -LSQYHKIKAQL-NY--WSAKSLWAKLDKRA---- 27 usage_00119.pdb 1 ----VMPTLRQAAEDKSWRVRYMVADKFTELQKA- 30 usage_00127.pdb 1 -----MPTLRQAAEDKSWRVRYMVADKFTELQKAV 30 usage_00162.pdb 1 ------PTLRQAAEDKSWRVRY-VADKFTELQKA- 27 usage_00521.pdb 1 ----VMPTLRQAAEDKSWRVRYMVADKFTELQKAV 31 usage_00523.pdb 1 ----VMPTLRQAAEDKSWRVRYMVADKFTELQKAV 31 usage_00747.pdb 1 ----VMPTLRQAAEDKSWRVRYMVADKFTELQKAV 31 usage_00788.pdb 1 -----VPTLRQAAEDKSWRVRY-VADKFTELQKA- 28 usage_01145.pdb 1 LEALVMPTLRQAAEDKSWRVRYMVADKFTELQKA- 34 usage_01312.pdb 1 ----VMPTLRQAAEDKSWRVRYMVADKFTELQKA- 30 ptlrQa ed Wrvry vAdkftel #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################