################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:03 2021 # Report_file: c_1442_332.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_02850.pdb # 2: usage_07435.pdb # 3: usage_11315.pdb # 4: usage_11316.pdb # 5: usage_11317.pdb # 6: usage_11318.pdb # 7: usage_11319.pdb # 8: usage_11320.pdb # # Length: 33 # Identity: 0/ 33 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 33 ( 9.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 33 ( 72.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02850.pdb 1 --------CR-TGAGDV-----GAHVVCAQ--- 16 usage_07435.pdb 1 -GECFMVKDLS----------N-PSRYLCK-C- 19 usage_11315.pdb 1 GSAFIIHEQA-DDYLTNPSGNSGARIVCGA--- 29 usage_11316.pdb 1 GSAFIIHEQA-DDYLTNPSGNSGARIVCGALLG 32 usage_11317.pdb 1 GSAFIIHEQA-DDYLTNPSGNSGARIVCGA--- 29 usage_11318.pdb 1 GSAFIIHEQA-DDYLTNPSGNSGARIVCGA--- 29 usage_11319.pdb 1 GSAFIIHEQA-DDYLTNPSGNSGARIVCGA--- 29 usage_11320.pdb 1 GSAFIIHEQA-DDYLTNPSGNSGARIVCGALLG 32 a vc #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################