################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:23 2021 # Report_file: c_0906_173.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00164.pdb # 2: usage_00276.pdb # 3: usage_00582.pdb # 4: usage_00696.pdb # 5: usage_00844.pdb # 6: usage_00850.pdb # 7: usage_01009.pdb # 8: usage_01218.pdb # # Length: 48 # Identity: 0/ 48 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 2/ 48 ( 4.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 48 ( 37.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00164.pdb 1 ------ILSN-LNKPHALLWGP---D--NQIWLTERATGKILRVN--- 33 usage_00276.pdb 1 -----RTVQHQDSQVNALEVTPD--R--SMIAAAG-YQ-HIRMYD--- 34 usage_00582.pdb 1 -----KTLNAHEHFVTSLDFHKT--A--PYVVTGSVDQ-TVKVWE--- 35 usage_00696.pdb 1 ----MSTLRTHKDYVKALAYAKD--K--ELVASAGLDR-QIFLWD--- 36 usage_00844.pdb 1 -----QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDG-RVFIWT--C 40 usage_00850.pdb 1 TYVLESTLEGHSDWVRDVAWSPT-VLLRSYLASVSQDR-TCIIWTQDN 46 usage_01009.pdb 1 VLVLRGTLEGHNGWVTSLATSAG--QP-NLLLSASRDK-TLISW---- 40 usage_01218.pdb 1 -----STLRTHKDYVKALAYAKD--K--ELVASAGLDR-QIFLWD--- 35 l v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################