################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:10 2021 # Report_file: c_1227_158.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_01417.pdb # 2: usage_01418.pdb # 3: usage_01419.pdb # 4: usage_01420.pdb # 5: usage_01421.pdb # 6: usage_01684.pdb # 7: usage_01685.pdb # 8: usage_01687.pdb # 9: usage_01688.pdb # 10: usage_01689.pdb # 11: usage_01690.pdb # # Length: 38 # Identity: 37/ 38 ( 97.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 38 ( 97.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 38 ( 2.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01417.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGGL 38 usage_01418.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGGL 38 usage_01419.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGG- 37 usage_01420.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGGL 38 usage_01421.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGG- 37 usage_01684.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGGL 38 usage_01685.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGG- 37 usage_01687.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGGL 38 usage_01688.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGG- 37 usage_01689.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGGL 38 usage_01690.pdb 1 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGG- 37 TEFVFGNRVDRYVGSDPKDWEDPDSPTLKVLGVVAGG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################