################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:15 2021 # Report_file: c_1186_27.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00680.pdb # 2: usage_00681.pdb # 3: usage_00693.pdb # 4: usage_00783.pdb # 5: usage_00787.pdb # 6: usage_00798.pdb # 7: usage_00799.pdb # 8: usage_00803.pdb # 9: usage_00806.pdb # 10: usage_01738.pdb # 11: usage_01739.pdb # 12: usage_01754.pdb # # Length: 36 # Identity: 35/ 36 ( 97.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 36 ( 97.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 36 ( 2.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00680.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYP- 35 usage_00681.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_00693.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_00783.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_00787.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_00798.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_00799.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_00803.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_00806.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_01738.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_01739.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 usage_01754.pdb 1 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYPS 36 GYVAVQYAHRLFSSSLANKRNRVTYTHPPTGMAYP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################