################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:24 2021 # Report_file: c_1297_174.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00989.pdb # 2: usage_00990.pdb # 3: usage_01043.pdb # 4: usage_02077.pdb # 5: usage_02078.pdb # 6: usage_02261.pdb # 7: usage_02646.pdb # 8: usage_02647.pdb # 9: usage_02990.pdb # 10: usage_02991.pdb # 11: usage_03347.pdb # 12: usage_03348.pdb # # Length: 45 # Identity: 5/ 45 ( 11.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 45 ( 15.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 45 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00989.pdb 1 -SEVNDKIRAIAIQAYQTLGCAGMARVDVFLTADNEVVINEINTL 44 usage_00990.pdb 1 -SEVNDKIRAIAIQAYQTLGCAGMARVDVFLTADNEVVINEINTL 44 usage_01043.pdb 1 DAQTQQRIQQIAVQAYQALGCAGMARVDVFLCADGRIVINEVNT- 44 usage_02077.pdb 1 -DQVAEAIRQLAIRAFAAIDCRGLARVDFFLTDDGPVINEINT-- 42 usage_02078.pdb 1 -DQVAEAIRQLAIRAFAAIDCRGLARVDFFLTDDGPVINEINT-- 42 usage_02261.pdb 1 --DVQLTLRNMALEAFKETDCSGLVRADFFVTEDNQIYINETNAM 43 usage_02646.pdb 1 PSEVNDKIRAIAIQAYQTLGCAG-ARVDVFLTADNEVVINEINT- 43 usage_02647.pdb 1 -SEVNDKIRAIAIQAYQTLGCAG-ARVDVFLTADNEVVINEINTL 43 usage_02990.pdb 1 SAEERGRIQETVKKIYKTLGCRGLARVDMFLQDNGRIVLNEVNTL 45 usage_02991.pdb 1 SAEERGRIQETVKKIYKTLGCRGLARVDMFLQDRGRIVLNEVNTL 45 usage_03347.pdb 1 -AEAEKRIQEAAVTIYKALGCSGFSRVDMFYTPSGEIVFNEVNTI 44 usage_03348.pdb 1 -AEAEKRIQEAAVTIYKALGCSGFSRVDMFYTPSGEIVFNEVNTI 44 i C G RvD F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################