################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:01 2021 # Report_file: c_0717_19.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00126.pdb # 2: usage_00223.pdb # 3: usage_00235.pdb # 4: usage_00264.pdb # 5: usage_00295.pdb # 6: usage_00385.pdb # 7: usage_00395.pdb # # Length: 61 # Identity: 37/ 61 ( 60.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 61 ( 70.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 61 ( 26.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00126.pdb 1 ETFYVD-----------AGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVT 49 usage_00223.pdb 1 ETFYVD-----------AGYVTNRGRQKVV----TTNQKTELQAIYLALQDSGLEVNIVT 45 usage_00235.pdb 1 VDGAAN----RETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVT 56 usage_00264.pdb 1 ETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQAIHLALQDSGLEVNIVT 60 usage_00295.pdb 1 ETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVT 60 usage_00385.pdb 1 ETFYVD-----------AGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVT 49 usage_00395.pdb 1 T-FYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVT 59 fyvd AGYVTN GRQKVV TTNQKTELQAIyLALQDSGLEVNIVT usage_00126.pdb 50 D 50 usage_00223.pdb 46 D 46 usage_00235.pdb 57 D 57 usage_00264.pdb 61 A 61 usage_00295.pdb 61 D 61 usage_00385.pdb 50 D 50 usage_00395.pdb 60 D 60 d #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################