################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:41:33 2021 # Report_file: c_0578_10.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00030.pdb # 2: usage_00142.pdb # 3: usage_00143.pdb # 4: usage_00165.pdb # 5: usage_00216.pdb # 6: usage_00248.pdb # 7: usage_00249.pdb # # Length: 84 # Identity: 3/ 84 ( 3.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 84 ( 21.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 84 ( 21.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00030.pdb 1 -KILIRGLPGDV-------TNQEVHDLLSDYE-LKYCFVD-K-----YKGTAFVTLLNGE 45 usage_00142.pdb 1 -VLYVGGLAEEV-------DDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 52 usage_00143.pdb 1 -VLYVGGLAEEV-------DDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 52 usage_00165.pdb 1 --IVVNGAPVI-PSAKVPVLKKALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVECGSMN 57 usage_00216.pdb 1 -IIYVSRLPHGF-------HEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKE 52 usage_00248.pdb 1 -VLYVGGLAEEV-------DDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 52 usage_00249.pdb 1 RVLYVGGLAEEV-------DDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAE 53 v gl k l f g g Fve e usage_00030.pdb 46 QAEAAINAFHQSRLRE-RELSVQL 68 usage_00142.pdb 53 DAAAAIDNMNESELFG-RTIRVNL 75 usage_00143.pdb 53 DAAAAIDNMNESELFG-RTIRVNL 75 usage_00165.pdb 58 DAKKIIKSFHGKRLDLKHRLFLYT 81 usage_00216.pdb 53 DAMIAQESMNNYLLMG-HLLQVRV 75 usage_00248.pdb 53 DAAAAIDNMNESELFG-RTIRVNL 75 usage_00249.pdb 54 DAAAAIDNMNESELFG-RTIRVNL 76 dA ai L v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################