################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:36 2021 # Report_file: c_0518_38.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00015.pdb # 2: usage_00074.pdb # 3: usage_00075.pdb # 4: usage_00199.pdb # 5: usage_00200.pdb # 6: usage_00202.pdb # 7: usage_00402.pdb # 8: usage_00664.pdb # # Length: 94 # Identity: 63/ 94 ( 67.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/ 94 ( 67.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 94 ( 8.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 SEEDKFFYFFNHFCFYIINNTKEYALVYK-NFAFYIPYGSVGINALKNVFDYLNSN-IPT 58 usage_00074.pdb 1 ----EFFYFFNHFCFYIINETNKYALTFKMNFAFYIPYGSVGIDVLKNVFDYLYELNIPT 56 usage_00075.pdb 1 ----EFFYFFNHFCFYIINETNKYALTFKMNFAFYIPYGSVGIDVLKNVFDYLYELNIPT 56 usage_00199.pdb 1 SEEDKFFYFFNHFCFYIINNTKEYALIYKMNFAFYIPYGSVGINALKNVFDYLNSMNIPT 60 usage_00200.pdb 1 SEEDKFFYFFNHFCFYIINNTKEYALIYKMNFAFYIPYGSVGINALKNVFDYLNSMNIPT 60 usage_00202.pdb 1 -EKDEFFYFFNHFCFYIINETKEYALAYKMNFAFYLPYGSLGVDVLKNVFDYLHHLNVPT 59 usage_00402.pdb 1 ----EFFYFFNHFCFYIINETNKYALTFKMNFAFYIPYGSVGIDVLKNVFDYLYELNIPT 56 usage_00664.pdb 1 -EKDEFFYFFNHFCFYIINETKEYALAYKMNFAFYLPYGSLGVDVLKNVFDYLHHLNVPT 59 FFYFFNHFCFYIIN T YAL K NFAFY PYGS G LKNVFDYL PT usage_00015.pdb 59 L--DKINDIGNTVKNYRKFIFEYLKSDSCTINVY 90 usage_00074.pdb 57 ILDMKINDIGNTVKNYRKFIFEYLKSDSCTVNIY 90 usage_00075.pdb 57 ILDMKINDIGNTVKNYRKFIFEYLKSDSCTVNIY 90 usage_00199.pdb 61 MLDMKINDIGNTVKNYRKFIFEYLKSDSCTINVY 94 usage_00200.pdb 61 MLDMKINDIGNTVKNYRKFIFEYLKSDSCTINVY 94 usage_00202.pdb 60 ILDIKMNDIGNTVKHYRKFIFDYLRSDSCTANIY 93 usage_00402.pdb 57 ILDMKINDIGNTVKNYRKFIFEYLKSDSCTVNIY 90 usage_00664.pdb 60 ILDIKMNDIGNTVKHYRKFIFDYLRSDSCTANIY 93 K NDIGNTVK YRKFIF YL SDSCT N Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################