################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:30:10 2021 # Report_file: c_0895_32.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00017.pdb # 2: usage_00021.pdb # 3: usage_00032.pdb # 4: usage_00064.pdb # 5: usage_00137.pdb # 6: usage_00319.pdb # # Length: 70 # Identity: 2/ 70 ( 2.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 70 ( 12.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 70 ( 24.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00017.pdb 1 LAVWLSMIGLAQYYKVLVDNGYENIDFITDITW----EDLQEIGITKLGHQKKLMLAVRK 56 usage_00021.pdb 1 LAVWLSMIGLAQYYKVLVDNGYENIDFITDITW----EDLQEIGITKLGHQKKLMLAVRK 56 usage_00032.pdb 1 IGLWLKSLRLHKYIELFKN---MTYEEMLLITE----DFLQSVGV-TKGASHKLALCIDK 52 usage_00064.pdb 1 LERFLTAIKAGHDSVLFNANGIYTMGDMIREF-EKHNDIFERIGI-DSSKLSKYYEAFLS 58 usage_00137.pdb 1 MSAWLRAIGLERYEEGLVHNGWDDLEFLSDITE----EDLEEAGVQDPAHKRLLLDTLQL 56 usage_00319.pdb 1 LLEWLCALGLPQYHKQLVSSGYDSMGLVADLTW----EELQEIGVNKLGHQKKLMLGVKR 56 wL l y t l G kl usage_00017.pdb 57 LAELRRHH-- 64 usage_00021.pdb 57 LAELQKA--- 63 usage_00032.pdb 53 LKER------ 56 usage_00064.pdb 59 FYRIQEAMKL 68 usage_00137.pdb 57 SK-------- 58 usage_00319.pdb 57 LAELRRG--- 63 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################