################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:09 2021 # Report_file: c_1368_85.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00195.pdb # 2: usage_00196.pdb # 3: usage_00427.pdb # 4: usage_00734.pdb # 5: usage_00765.pdb # 6: usage_00766.pdb # 7: usage_00979.pdb # 8: usage_00995.pdb # 9: usage_01116.pdb # 10: usage_01153.pdb # 11: usage_01154.pdb # 12: usage_01338.pdb # 13: usage_01387.pdb # # Length: 58 # Identity: 1/ 58 ( 1.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 58 ( 36.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 58 ( 37.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00195.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_00196.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_00427.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_00734.pdb 1 TTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTR-- 56 usage_00765.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_00766.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_00979.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_00995.pdb 1 ----MALIERIGKALEPLMLVMGLISPLATMPQLYKLYVS----------------HS 38 usage_01116.pdb 1 TTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTR-- 56 usage_01153.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_01154.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_01338.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 usage_01387.pdb 1 TMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKS--- 55 Akdv tfl w aepehd rkr glk l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################