################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:11 2021 # Report_file: c_1434_80.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00193.pdb # 2: usage_00215.pdb # 3: usage_00611.pdb # 4: usage_00922.pdb # 5: usage_02598.pdb # # Length: 115 # Identity: 17/115 ( 14.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/115 ( 54.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 48/115 ( 41.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00193.pdb 1 ---------EWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLS 51 usage_00215.pdb 1 -------RPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLS 53 usage_00611.pdb 1 ----------WIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLS 50 usage_00922.pdb 1 --------PEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLS 52 usage_02598.pdb 1 AAAVRENALLSSSLWVNVALAGIAILVFVYMGRTIRPGRPRLIWGATLMIPLVSISSYLG 60 wiwLalgtALmGlgtLyFlvkGmgvsdpdakkfyaiTtlvPaiaftmYLs usage_00193.pdb 52 MLLGYGLTMVPF------GGEQ--NPI----YWARYADWLFTTPLLLLDLALLV- 93 usage_00215.pdb 54 MLLGYGLTMVPF------------GGEQNPIYWARYADWLF-------------- 82 usage_00611.pdb 51 MLLGYGLTMVPF------GGEQ--NPI----YWARYADWLFTTPLLLLDLALLVD 93 usage_00922.pdb 53 MLLG------------------YQNPI----YWARYASWLF-------------- 71 usage_02598.pdb 61 LLSGLTVGMIEMPAGHALAGEM--VRS----QWGRYLTWALSTPMILLALGLLAD 109 mLlG yWaRYa Wlf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################