################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:41 2021 # Report_file: c_1409_29.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00580.pdb # 2: usage_01250.pdb # 3: usage_01251.pdb # 4: usage_01252.pdb # 5: usage_01812.pdb # # Length: 79 # Identity: 34/ 79 ( 43.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 74/ 79 ( 93.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 79 ( 6.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00580.pdb 1 EAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFD 60 usage_01250.pdb 1 --FKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLD-FGTVELLLAIENRFDILVPITEFD 57 usage_01251.pdb 1 -DFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLD-FGTVELLLAIENRFDILVPITEFD 58 usage_01252.pdb 1 -DFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFD 59 usage_01812.pdb 1 --FKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDAFGTVELLLAIENRFDILVPITEFD 58 fKqeVLDvLAevcqdDiVKeNpDieiFEeGLLD fGTVeLLLaienrFdilvPitEFD usage_00580.pdb 61 RKEWDTPNKIIAKVEQA-- 77 usage_01250.pdb 58 RDVWNTPNNIVNQLSELK- 75 usage_01251.pdb 59 RDVWNTPNNIVNQLSELKR 77 usage_01252.pdb 60 RDVWNTPNNIVNQLSEL-- 76 usage_01812.pdb 59 RDVWNTPNNIVNQLSEL-- 75 RdvWnTPNnIvnqlsel #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################