################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:06 2021 # Report_file: c_0755_29.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00143.pdb # 2: usage_00144.pdb # 3: usage_00145.pdb # 4: usage_00146.pdb # 5: usage_00147.pdb # 6: usage_00148.pdb # 7: usage_00149.pdb # 8: usage_00150.pdb # 9: usage_00151.pdb # 10: usage_00152.pdb # # Length: 65 # Identity: 56/ 65 ( 86.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 65 ( 86.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 65 ( 13.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00143.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE--------PTIASVVLHLPPYRYRFDFS 52 usage_00144.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE-------RPTIASVVLHLPPYRYRFDFS 53 usage_00145.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE--------PTIASVVLHLPPYRYRFDFS 52 usage_00146.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE--------PTIASVVLHLPPYRYRFDFS 52 usage_00147.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFEKRGFLIKRPTIASVVLHLPPYRYRFDFS 60 usage_00148.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFEKRGFLIKRPTIASVVLHLPPYRYRFDFS 60 usage_00149.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE--------PTIASVVLHLPPYRYRFDFS 52 usage_00150.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE--------PTIASVVLHLPPYRYRFDFS 52 usage_00151.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE--------PTIASVVLHLPPYRYRFDFS 52 usage_00152.pdb 1 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE--------PTIASVVLHLPPYRYRFDFS 52 YNIDVDFLTTADPVELAKNFAKRIGGHFFVFE PTIASVVLHLPPYRYRFDFS usage_00143.pdb 53 PLKG- 56 usage_00144.pdb 54 PLKGK 58 usage_00145.pdb 53 PLKGK 57 usage_00146.pdb 53 PLKGK 57 usage_00147.pdb 61 PLKGK 65 usage_00148.pdb 61 PLKGK 65 usage_00149.pdb 53 PLKGK 57 usage_00150.pdb 53 PLKGK 57 usage_00151.pdb 53 PLKGK 57 usage_00152.pdb 53 PLKGK 57 PLKG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################