################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:06 2021 # Report_file: c_1393_1.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00296.pdb # 2: usage_00297.pdb # 3: usage_00298.pdb # 4: usage_00857.pdb # 5: usage_00858.pdb # 6: usage_01268.pdb # # Length: 98 # Identity: 66/ 98 ( 67.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 67/ 98 ( 68.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 98 ( 2.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00296.pdb 1 DTLRLLKSEIKKLEQKIDMDEKLKKMGELQLSSVTDSKAAATILDQIFVWEQNLEQFQMD 60 usage_00297.pdb 1 DTLRLLKSEIKKLEQKIDMDEKLKKMGELQLSSVTDSKAAATILDQIFVWEQNLEQFQMD 60 usage_00298.pdb 1 DTLRLLKSEIKKLEQKIDMDEKLKKMGELQLSSVTDSKAAATILDQIFVWEQNLEQFQMD 60 usage_00857.pdb 1 --VRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMD 58 usage_00858.pdb 1 -TVRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMD 59 usage_01268.pdb 1 DTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKAAATILDQIFVWEQNLEQFQMD 60 RLLKS L QKIDMD K KKM ElQLS V D K I QI WEQNLE F MD usage_00296.pdb 61 LFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLG 98 usage_00297.pdb 61 LFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLG 98 usage_00298.pdb 61 LFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLG 98 usage_00857.pdb 59 LFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLG 96 usage_00858.pdb 60 LFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLG 97 usage_01268.pdb 61 LFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLG 98 LFR RCYLASLQGGELPNPK LLA SRP K A GRLG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################