################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:53:13 2021 # Report_file: c_0994_69.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00110.pdb # 2: usage_00194.pdb # 3: usage_00402.pdb # 4: usage_00404.pdb # 5: usage_00405.pdb # 6: usage_00406.pdb # 7: usage_00407.pdb # 8: usage_00408.pdb # 9: usage_00409.pdb # 10: usage_00410.pdb # 11: usage_00411.pdb # 12: usage_00412.pdb # 13: usage_00416.pdb # 14: usage_00417.pdb # 15: usage_00574.pdb # 16: usage_00860.pdb # 17: usage_01058.pdb # # Length: 43 # Identity: 33/ 43 ( 76.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 43 ( 76.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 43 ( 14.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00110.pdb 1 ----AELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00194.pdb 1 TSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 43 usage_00402.pdb 1 TSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 43 usage_00404.pdb 1 ----AELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00405.pdb 1 ----AELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00406.pdb 1 ----AELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00407.pdb 1 ----AELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00408.pdb 1 ----AELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00409.pdb 1 ----AELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00410.pdb 1 ----AELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00411.pdb 1 ----AELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00412.pdb 1 ----AELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00416.pdb 1 ----AELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00417.pdb 1 ----AELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIG 39 usage_00574.pdb 1 ----AELDGQSVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVG 39 usage_00860.pdb 1 ----AELDGQSVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVG 39 usage_01058.pdb 1 TSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLR-- 41 AELDG V VCSTGIGGPSTSIAVEELAQLG RTFLR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################