################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:18:52 2021
# Report_file: c_1395_19.html
################################################################################################
#====================================
# Aligned_structures: 19
#   1: usage_00017.pdb
#   2: usage_00178.pdb
#   3: usage_00209.pdb
#   4: usage_00277.pdb
#   5: usage_00278.pdb
#   6: usage_00279.pdb
#   7: usage_00281.pdb
#   8: usage_00282.pdb
#   9: usage_00333.pdb
#  10: usage_00363.pdb
#  11: usage_00382.pdb
#  12: usage_00942.pdb
#  13: usage_00984.pdb
#  14: usage_00985.pdb
#  15: usage_01193.pdb
#  16: usage_01368.pdb
#  17: usage_01471.pdb
#  18: usage_01472.pdb
#  19: usage_01523.pdb
#
# Length:         33
# Identity:       13/ 33 ( 39.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     13/ 33 ( 39.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 33 (  6.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00017.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00178.pdb         1  --GTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   31
usage_00209.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00277.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00278.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00279.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00281.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00282.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00333.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00363.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00382.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00942.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_00984.pdb         1  --GTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   31
usage_00985.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_01193.pdb         1  DQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   33
usage_01368.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
usage_01471.pdb         1  --GISDIIERLLSETCPRYLLGVLDAGKAELQR   31
usage_01472.pdb         1  --GISDIIERLLSETCPRYLLGVLDAGKAELQR   31
usage_01523.pdb         1  -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK   32
                             G S     LL  TCP    G L AGK  L  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################