################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:16:16 2021 # Report_file: c_1400_31.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00017.pdb # 2: usage_00018.pdb # 3: usage_00118.pdb # 4: usage_00119.pdb # 5: usage_00130.pdb # 6: usage_00131.pdb # 7: usage_00132.pdb # 8: usage_00170.pdb # 9: usage_00199.pdb # 10: usage_00472.pdb # 11: usage_00473.pdb # 12: usage_00474.pdb # 13: usage_00475.pdb # 14: usage_00690.pdb # 15: usage_00691.pdb # 16: usage_00693.pdb # # Length: 34 # Identity: 8/ 34 ( 23.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 34 ( 50.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 34 ( 11.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00017.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00018.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00118.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00119.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00130.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00131.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00132.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00170.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00199.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00472.pdb 1 TDEVFQSLH-NKAFDQAENRMHSIKAIILSTIG- 32 usage_00473.pdb 1 TDEVFQSLH-NKAFDQAENRMHSIKAIILSTIG- 32 usage_00474.pdb 1 TDEVFQSLH-NKAFDQAENRMHSIKAIILSTI-- 31 usage_00475.pdb 1 TDEVFQSLH-NKAFDQAENRMHSIKAIILSTI-- 31 usage_00690.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00691.pdb 1 TEEVFESEH-SIVFDEAENRMHTIKAVMVATLG- 32 usage_00693.pdb 1 SEEIFEKH-ADVIFEEARNRLYVVKALLCFLDNQ 33 t EvF s Fd AeNRmh iKA t #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################