################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:32 2021 # Report_file: c_1307_131.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_01284.pdb # 2: usage_01407.pdb # 3: usage_01413.pdb # 4: usage_01414.pdb # 5: usage_01415.pdb # 6: usage_01416.pdb # 7: usage_01512.pdb # 8: usage_01514.pdb # 9: usage_01842.pdb # 10: usage_01935.pdb # 11: usage_02121.pdb # 12: usage_02205.pdb # # Length: 33 # Identity: 26/ 33 ( 78.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 33 ( 78.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 33 ( 3.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01284.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVD- 32 usage_01407.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVD- 32 usage_01413.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVDY 33 usage_01414.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVDY 33 usage_01415.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVDY 33 usage_01416.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVDY 33 usage_01512.pdb 1 CWSELLVFDHIYRQVQHGKEGSILLVTGQEVEL 33 usage_01514.pdb 1 CWSELLVFDHIYRQVQHGKEGSILLVTGQEVEL 33 usage_01842.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVD- 32 usage_01935.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVD- 32 usage_02121.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVD- 32 usage_02205.pdb 1 CWSELLILDHIYRQVVHGKEGSIFLVTGQQVD- 32 CWSELL DHIYRQV HGKEGSI LVTGQ V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################