################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:09 2021 # Report_file: c_1133_31.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00125.pdb # 2: usage_00328.pdb # 3: usage_00413.pdb # 4: usage_00486.pdb # 5: usage_00665.pdb # 6: usage_00667.pdb # # Length: 101 # Identity: 15/101 ( 14.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/101 ( 29.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/101 ( 30.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00125.pdb 1 ---------------TPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKAD 45 usage_00328.pdb 1 ------------YKMSSINADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCS 48 usage_00413.pdb 1 SEEEKAWLMASRQQLAKETSNFGFSLLRKISMRH-DGNMVFSPFGMSLAMTGLMLGATGP 59 usage_00486.pdb 1 ------------LGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNT 48 usage_00665.pdb 1 ---------T-FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKAD 50 usage_00667.pdb 1 -----------FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKAD 49 FaFsLyr N FSP si A LslG usage_00125.pdb 46 THDEILEGLNFNLTEI------PEAQIHEGFQELLRTLNQ- 79 usage_00328.pdb 49 TQTEIVETLGFNLTDT------PMVEIQHGFQHLICSLNF- 82 usage_00413.pdb 60 TETQIKRGLHLQ---ALKPTKP--GLLPSLFKGLRETLSRN 95 usage_00486.pdb 49 TLTEILKGLKFNLTET------SEAEIHQSFQHLLRT---- 79 usage_00665.pdb 51 THDEILEGLNFNLTEI------PEAQIHEGFQELLRTLNQ- 84 usage_00667.pdb 50 THDEILEGLNFNLTEI------PEAQIHEGFQELLRTLNQ- 83 T eI gL fn i Fq L t #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################