################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:23 2021 # Report_file: c_0929_52.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00472.pdb # 2: usage_00789.pdb # 3: usage_01022.pdb # 4: usage_01023.pdb # 5: usage_01101.pdb # 6: usage_01102.pdb # 7: usage_01121.pdb # 8: usage_01122.pdb # # Length: 62 # Identity: 9/ 62 ( 14.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 62 ( 72.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 62 ( 27.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00472.pdb 1 PFTVEVPVPNKVVKGQTVEIRCELKKEGDFSGTLYTIRYFQFEGEGSLK----------- 49 usage_00789.pdb 1 --FLEMNIPYSVVRGEQIQLKGTVYNYRT-SGMQFCVKMSAVEGICTSESPVIDHQGTKS 57 usage_01022.pdb 1 --FLEMNIPYSVVRGEQIQLKGTVYNYRT-SGMQFCVKMSAVEGICTS------------ 45 usage_01023.pdb 1 --FLEMNIPYSVVRGEQIQLKGTVYNYRT-SGMQFCVKMSAVEGICTS------------ 45 usage_01101.pdb 1 -VFLEMNIPYSVVRGEQIQLKGTVYNYRT-SGMQFCVKMSAVEGICTS------------ 46 usage_01102.pdb 1 -VFLEMNIPYSVVRGEQIQLKGTVYNYRT-SGMQFCVKMSAVEGICTS------------ 46 usage_01121.pdb 1 DVFLEMNIPYSVVRGEQIQLKGTVYNYRT-SGMQFCVKMSAVEGICTS------------ 47 usage_01122.pdb 1 DVFLEMNIPYSVVRGEQIQLKGTVYNYRT-SGMQFCVKMSAVEGICTS------------ 47 flEmniPysVVrGeqiqlkgtvynyrt SGmqfcvkmsavEGicts usage_00472.pdb -- usage_00789.pdb 58 SK 59 usage_01022.pdb -- usage_01023.pdb -- usage_01101.pdb -- usage_01102.pdb -- usage_01121.pdb -- usage_01122.pdb -- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################