################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:16 2021 # Report_file: c_1198_23.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00895.pdb # 2: usage_00905.pdb # 3: usage_00907.pdb # 4: usage_01033.pdb # 5: usage_01421.pdb # 6: usage_01641.pdb # 7: usage_01642.pdb # 8: usage_02134.pdb # 9: usage_02135.pdb # # Length: 33 # Identity: 23/ 33 ( 69.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 33 ( 69.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 33 ( 24.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00895.pdb 1 RLEQPNVVISLSRTEAL-NHHNTLVCSVTDFYP 32 usage_00905.pdb 1 RLEQPSVVISLSRTEAL-NHHNTLVCSVTDFYP 32 usage_00907.pdb 1 RLEQPNVAISLSRTEALNH-HNTLVCSVTDFYP 32 usage_01033.pdb 1 RLEQPSVVISLSRTEAL-NHHNTLVCSVTDFYP 32 usage_01421.pdb 1 RLEQPNVAISLS--------HNTLVCSVTDFYP 25 usage_01641.pdb 1 RLEQPNVVISLSRTEAL-NHHNTLVCSVTDFYP 32 usage_01642.pdb 1 RLEQPNVVISLSRTEAL-NHHNTLVCSVTDFYP 32 usage_02134.pdb 1 RLEQPNVAISLSRTEAL-NHHNTLVCSVTDFYP 32 usage_02135.pdb 1 RLEQPNVAISLSRTEAL-NHHNTLVCSVTDFYP 32 RLEQP V ISLS HNTLVCSVTDFYP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################