################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:23:50 2021 # Report_file: c_0869_8.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00012.pdb # 2: usage_00039.pdb # 3: usage_00049.pdb # 4: usage_00056.pdb # 5: usage_00095.pdb # 6: usage_00096.pdb # # Length: 62 # Identity: 14/ 62 ( 22.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 62 ( 43.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 62 ( 8.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 DPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATIL 60 usage_00039.pdb 1 DQNVLALAEKTHKTPAQVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKLE 60 usage_00049.pdb 1 DALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIE 60 usage_00056.pdb 1 DPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLL 60 usage_00095.pdb 1 IPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQVFDFQLSEEDMAAIL 60 usage_00096.pdb 1 DPKIKEIAAKH--TAAQVLIRFHIQRNVIVIP-SVTPARIVENIQVFDFKLSDEEMATIL 57 d a k T AQvl Rf qR viP S rI EN vFDF L e m usage_00012.pdb 61 S- 61 usage_00039.pdb -- usage_00049.pdb 61 A- 61 usage_00056.pdb 61 SY 62 usage_00095.pdb 61 S- 61 usage_00096.pdb 58 S- 58 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################