################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:11 2021 # Report_file: c_1082_75.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00219.pdb # 2: usage_00268.pdb # 3: usage_00368.pdb # 4: usage_00369.pdb # 5: usage_00370.pdb # 6: usage_00465.pdb # 7: usage_00466.pdb # 8: usage_00671.pdb # 9: usage_00778.pdb # 10: usage_00808.pdb # # Length: 62 # Identity: 3/ 62 ( 4.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 4/ 62 ( 6.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 62 ( 25.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00219.pdb 1 ---------TIGTEINRQL-----KDIHAVFIPVGGGGLIAGVATFFKQIAP-NTKIIGV 45 usage_00268.pdb 1 ---------TTGPEIWKDTD----GKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAV 47 usage_00368.pdb 1 --LVIAGQGTAGLELLAQAGRMG-VFPGAVLAPVGGGGLLAGLATAVKALSP-TTLVLGV 56 usage_00369.pdb 1 -PLVIAGQGTAGLELLAQAGRMG-VFPGAVLAPVGGGGLLAGLATAVKALSP-TTLVLGV 57 usage_00370.pdb 1 -PLVIAGQGTAGLELLAQAGRMG-VFPGAVLAPVGGGGLLAGLATAVKALSP-TTLVLGV 57 usage_00465.pdb 1 -KYTISGQGTVSLELLEQV-----PEIDTIIVPISGGGLISGVALAAKAINP-SIRILAA 53 usage_00466.pdb 1 -KYTISGQGTVSLELLEQV-----PEIDTIIVPISGGGLISGVALAAKAINP-SIRILAA 53 usage_00671.pdb 1 SALGAMGYVESALEIAQQCE--EVVGLSSVVVASGSAGTHAGLAVGLEHLMP-DVELIGV 57 usage_00778.pdb 1 -PLIWEGHASIVKELKETLW----EKPGAIALSVGGGGLLCGVVQGLQECGWGDVPVIAM 55 usage_00808.pdb 1 --KVIAGQGTIGLEIMEDL-----YDVDNVIVPIGGGGLIAGIAIAIKSINP-TIKVIGV 52 E gG G usage_00219.pdb 46 EP 47 usage_00268.pdb 48 EP 49 usage_00368.pdb 57 EP 58 usage_00369.pdb 58 EP 59 usage_00370.pdb 58 EP 59 usage_00465.pdb 54 EP 55 usage_00466.pdb 54 EP 55 usage_00671.pdb 58 T- 58 usage_00778.pdb 56 ET 57 usage_00808.pdb 53 QA 54 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################