################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:54 2021 # Report_file: c_1231_24.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00053.pdb # 2: usage_00054.pdb # 3: usage_00069.pdb # 4: usage_00070.pdb # 5: usage_00130.pdb # 6: usage_00133.pdb # 7: usage_00163.pdb # 8: usage_00171.pdb # 9: usage_00174.pdb # 10: usage_00175.pdb # # Length: 44 # Identity: 2/ 44 ( 4.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 4/ 44 ( 9.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 44 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00053.pdb 1 -----YYV-KLPSDVEERDFIIVDPMLATGGSAVAAIDALKKRG 38 usage_00054.pdb 1 -----YYV-KLPSDVEERDFIIVDPMLATGGSAVAAIDALKKRG 38 usage_00069.pdb 1 -----YYI-KLPPDIAERRAF-LLDPLATGGSASLALSLLKERG 37 usage_00070.pdb 1 -----YYI-KLPPDIAERRAF-LLDPLATGGSASLALSLLKERG 37 usage_00130.pdb 1 HQPVPYLD-SLPDDLTDVPVMVLDPMVATGGSMTHTLGLLISRG 43 usage_00133.pdb 1 -------NQIEGKAEKGQKVVVVEDLISTGGSAITCVEALREAG 37 usage_00163.pdb 1 -----STS-IPAGGIDDALVILVDDVLYSGRSVRSALDALRDVG 38 usage_00171.pdb 1 -EPLVKGT-DIPVDITDKKVILVDDVLYTGRTVRAGMDALMDL- 41 usage_00174.pdb 1 -----YLV-RL-PDLEDRIFILCDPMVATGYSAAHAIDVLKRRG 37 usage_00175.pdb 1 -RPVEYLV-RL-PDLEDRIFILCDPMVATGYSAAHAIDVLKRRG 41 tG s L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################