################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:09 2021 # Report_file: c_1048_16.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00085.pdb # 2: usage_00086.pdb # 3: usage_00087.pdb # 4: usage_00088.pdb # 5: usage_00124.pdb # 6: usage_00159.pdb # 7: usage_00160.pdb # 8: usage_00161.pdb # 9: usage_00162.pdb # 10: usage_00183.pdb # 11: usage_00184.pdb # 12: usage_00540.pdb # 13: usage_00541.pdb # # Length: 36 # Identity: 32/ 36 ( 88.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 36 ( 88.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 36 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00085.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLSVP 36 usage_00086.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLSVP 36 usage_00087.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLSVP 36 usage_00088.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLSVP 36 usage_00124.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 34 usage_00159.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 34 usage_00160.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 34 usage_00161.pdb 1 --SYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 32 usage_00162.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 34 usage_00183.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 34 usage_00184.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 34 usage_00540.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 34 usage_00541.pdb 1 KWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLS-- 34 SYEPASAAEVPHAMSRAIHMASMAPQGPVYLS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################