################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Sun Jan 24 08:57:04 2021 # Report_file: c_0669_56.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_01230.pdb # 2: usage_01231.pdb # 3: usage_01258.pdb # 4: usage_01259.pdb # 5: usage_01260.pdb # 6: usage_01261.pdb # 7: usage_01262.pdb # 8: usage_01263.pdb # 9: usage_01264.pdb # 10: usage_01265.pdb # 11: usage_01757.pdb # # Length: 48 # Identity: 10/ 48 ( 20.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 48 ( 89.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 48 ( 8.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01230.pdb 1 ANFIEKITYLGTPAI-KAGNEHL-EIVVPEWGSNVISLVDKTTNVQLL 46 usage_01231.pdb 1 ANFIEKITYLGTPAI-KAGNEHL-EIVVPEWGSNVISLVDKTTNVQLL 46 usage_01258.pdb 1 ANFIEKITYLGTPAI-KAGNEHLEMIVVPEWGSNVISLVDKTTNVQLL 47 usage_01259.pdb 1 ANFIEKITYLGTPAI-KAGNEHLEMIVVPEWGSNVISLVDKTTNVQLL 47 usage_01260.pdb 1 ANFIEKITYLGTPAI-KAGNEHLEMIVVPEWGSNVISLVDKTTNVQLL 47 usage_01261.pdb 1 ANFIEKITYLGTPAI-KAGNEHLEMIVVPEWGSNVISLVDKTTNVQLL 47 usage_01262.pdb 1 ANFIEKITYLGTPAI-KAGNEHLEMIVVPEWGSNVISLVDKTTNVQLL 47 usage_01263.pdb 1 ANFIEKITYLGTPAI-KAGNEHLEMIVVPEWGSNVISLVDKTTNVQLL 47 usage_01264.pdb 1 ANFIEKITYLGTPAI-KAGNEHLEMIVVPEWGSNVISLVDKTTNVQLL 47 usage_01265.pdb 1 ANFIEKITYLGTPAI-KAGNEHLEMIVVPEWGSNVISLVDKTTNVQLL 47 usage_01757.pdb 1 WIKEEIIW--SEHKCIRFAAGGYEALIIPDVGGNVVELKDTNKGVTIL 46 anfiEkIt gtpai kagnehl ivvPewGsNVisLvDkttnVqlL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################