################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:45 2021 # Report_file: c_1297_339.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00210.pdb # 2: usage_02159.pdb # 3: usage_02160.pdb # 4: usage_02161.pdb # 5: usage_02162.pdb # 6: usage_02163.pdb # 7: usage_02165.pdb # 8: usage_02166.pdb # 9: usage_02221.pdb # 10: usage_03244.pdb # # Length: 31 # Identity: 18/ 31 ( 58.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 31 ( 87.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 31 ( 3.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00210.pdb 1 SGDRFRAGLPDDWTLGDKTGAGRYGTNNDA- 30 usage_02159.pdb 1 GGQSIRAGLPAHWVVGDKTGACDYGTTNDIA 31 usage_02160.pdb 1 GGQSIRAGLPAHWVVGDKTGACDYGTTNDIA 31 usage_02161.pdb 1 GGQSIRAGLPAHWVVGDKTGACDYGTTNDIA 31 usage_02162.pdb 1 GGQSIRAGLPAHWVVGDKTGACDYGTTNDIA 31 usage_02163.pdb 1 GGQSIRAGLPAHWVVGDKTGAGDYGTTNDIA 31 usage_02165.pdb 1 GGQSIRAGLPAHWVVGDKTGACDYGTTNDIA 31 usage_02166.pdb 1 GGQSIRAGLPAHWVVGDKTGACDYGTTNDIA 31 usage_02221.pdb 1 GGQSIRAGLPASWAVGDKTGAGDYGTTNDIA 31 usage_03244.pdb 1 GGQSIRAGLPAHWVVGDKTGACDYGTTNDIA 31 gGqsiRAGLPa W vGDKTGA dYGTtNDi #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################