################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:54 2021 # Report_file: c_1382_60.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01197.pdb # 2: usage_01198.pdb # 3: usage_01340.pdb # 4: usage_01445.pdb # 5: usage_01446.pdb # 6: usage_01755.pdb # # Length: 77 # Identity: 51/ 77 ( 66.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 77 ( 66.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 77 ( 16.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01197.pdb 1 --NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVV 58 usage_01198.pdb 1 --NLTCPACKVLFTALNHGLKKEPNVARVGSVAIKICKMLNIAPLDVCQSAVHLFEDDVV 58 usage_01340.pdb 1 ----TCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 56 usage_01445.pdb 1 WGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 60 usage_01446.pdb 1 -----CPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 55 usage_01755.pdb 1 ----TCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMV 56 CP CK LFTA N GLKKEPNVARVGSVAIK C L IAP VCQS VHLFEDD V usage_01197.pdb 59 EVWTRSVLSPSEACGLL 75 usage_01198.pdb 59 EVWTRSVLSPSEACGLL 75 usage_01340.pdb 57 EVWRRSVLS-------- 65 usage_01445.pdb 61 EVWRRSVLS-------- 69 usage_01446.pdb 56 EVWRRSVLS-------- 64 usage_01755.pdb 57 EVWRRSVLS-------- 65 EVW RSVLS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################