################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:35 2021 # Report_file: c_1172_296.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00168.pdb # 2: usage_02062.pdb # 3: usage_02063.pdb # 4: usage_02117.pdb # 5: usage_02244.pdb # 6: usage_02245.pdb # 7: usage_02246.pdb # 8: usage_02771.pdb # 9: usage_03405.pdb # 10: usage_03434.pdb # # Length: 41 # Identity: 16/ 41 ( 39.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 41 ( 46.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 41 ( 12.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00168.pdb 1 -FVRFSTVAGSRGSADTARDVHGFATRFYTDEGNFDI---- 36 usage_02062.pdb 1 -FTRFSTVAGSRGSADTARDVHGFATRFYTDEGNFDI---- 36 usage_02063.pdb 1 -FTRFSTVAGSRGSADTARDVHGFATRFYTDEGNFDI---- 36 usage_02117.pdb 1 -FARFSTVIHGTHSPETLRDPRGFSVKFYTEEGNWDFVG-- 38 usage_02244.pdb 1 -FTRFSTVGGEKGSADTARDPRGFATKFYTEDGNLDLV--- 37 usage_02245.pdb 1 -FTRFSTVGGEKGSADTARDPRGFATKFYTEDGNLDLV--- 37 usage_02246.pdb 1 -FTRFSTVGGEKGSADTARDPRGFATKFYTEDGNLDLV--- 37 usage_02771.pdb 1 -FVRFSSVVHGNHSPETLRDPHGFATKFYTADGNWDLV--- 37 usage_03405.pdb 1 -FVRFSTVAGSRGSADTARDVHGFATRFYTDEGNFDIVGN- 39 usage_03434.pdb 1 IAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNN 41 f RFStV S T RD GFa FYT GN D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################