################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:19:08 2021
# Report_file: c_1423_33.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00112.pdb
#   2: usage_00113.pdb
#   3: usage_00175.pdb
#   4: usage_00176.pdb
#   5: usage_00858.pdb
#
# Length:         84
# Identity:       38/ 84 ( 45.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     38/ 84 ( 45.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           23/ 84 ( 27.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00112.pdb         1  ---------------------F-ALAKTQFPDVNILRLAFFGPFIGAIARSVGGAISDKF   38
usage_00113.pdb         1  WLLS-LLYLATFGSFIGFSAGF-ALAKTQFPDVNILRLAFFGPFIGAIARSVGGAISDKF   58
usage_00175.pdb         1  ---------------------FAMLSKTQFPDVQILQYAFFGPFIGALARSAGGALSDRL   39
usage_00176.pdb         1  -WIMSLLYLATFGSFIGFSAGFAMLSKTQFPDVQILQYAFFGPFIGALARSAGGALSDRL   59
usage_00858.pdb         1  ---------------------FAMLSKTQFPDVQILQYAFFGPFIGALARSAGGALSDRL   39
                                                F  L KTQFPDV IL  AFFGPFIGA ARS GGA SD  

usage_00112.pdb        39  GGVRVTLINFIFAIFSALLFLTL-   61
usage_00113.pdb        59  GGVRVTLINFIFAIFSALLFLTL-   81
usage_00175.pdb        40  GGTRVTLVNFILMAIFSGLLFLTL   63
usage_00176.pdb        60  GGTRVTLVNFILMAIFSGLLFLTL   83
usage_00858.pdb        40  GGTRVTLVNFILMAIFSGLLFLTL   63
                           GG RVTL NFI       L     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################