################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:01 2021 # Report_file: c_0618_16.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00061.pdb # 2: usage_00064.pdb # 3: usage_00065.pdb # 4: usage_00108.pdb # 5: usage_00109.pdb # 6: usage_00204.pdb # # Length: 75 # Identity: 62/ 75 ( 82.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 66/ 75 ( 88.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 75 ( 8.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00061.pdb 1 --PAQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCF 58 usage_00064.pdb 1 GPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCF 60 usage_00065.pdb 1 GPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCF 60 usage_00108.pdb 1 GPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCF 60 usage_00109.pdb 1 GPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCF 60 usage_00204.pdb 1 -PAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCF 59 amQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCF usage_00061.pdb 59 KVTKRDD-SSLQL-- 70 usage_00064.pdb 61 KVTKRDEDSSL-MQL 74 usage_00065.pdb 61 KVTKRDEDSSL-MQL 74 usage_00108.pdb 61 KVTKRDS-SLMQL-- 72 usage_00109.pdb 61 KVTKRDE-DSSLMQL 74 usage_00204.pdb 60 KVTKRDEDSSL-MQL 73 KVTKRD ss #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################