################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:06:36 2021 # Report_file: c_0737_26.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00006.pdb # 2: usage_00007.pdb # 3: usage_00272.pdb # 4: usage_00523.pdb # # Length: 83 # Identity: 17/ 83 ( 20.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 83 ( 49.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 83 ( 9.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00006.pdb 1 GETKVIYHLDEEETPDLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDF--GVVKE 58 usage_00007.pdb 1 GETKVIYHLDEEETPDLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDF--GVVKE 58 usage_00272.pdb 1 --IVVAYYFCGEPIPYRTLVRGRA--VTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFE 56 usage_00523.pdb 1 TCTKVLYFTDRSLTPF-VNIPKRLEEVTLKDFKAAIDREGNHRYHFKAMDPEF--GTVKE 57 tkV Y d e tP v ip a TLgdFK l r Y FK md F GvVkE usage_00006.pdb 59 EISDDNARLPCFNGRVVSWLVS- 80 usage_00007.pdb 59 EISDDNARLPCFNGRVVSWLVSS 81 usage_00272.pdb 57 EVREDEAILPVFEEKIIGKVEK- 78 usage_00523.pdb 58 EIFHDDDAIPGWEGKIVAWVEE- 79 Ei D a lP f g v w #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################