################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:19:05 2021 # Report_file: c_1486_100.html ################################################################################################ #==================================== # Aligned_structures: 19 # 1: usage_00045.pdb # 2: usage_00046.pdb # 3: usage_00262.pdb # 4: usage_00263.pdb # 5: usage_00264.pdb # 6: usage_00265.pdb # 7: usage_00266.pdb # 8: usage_00267.pdb # 9: usage_01059.pdb # 10: usage_01981.pdb # 11: usage_01982.pdb # 12: usage_01983.pdb # 13: usage_01984.pdb # 14: usage_01985.pdb # 15: usage_01986.pdb # 16: usage_01988.pdb # 17: usage_01989.pdb # 18: usage_01990.pdb # 19: usage_01991.pdb # # Length: 33 # Identity: 2/ 33 ( 6.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 33 ( 66.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 33 ( 33.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00045.pdb 1 PNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD 33 usage_00046.pdb 1 PNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD 33 usage_00262.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLERKV---- 28 usage_00263.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLERKV---- 28 usage_00264.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLERKVN--- 29 usage_00265.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLERKV---- 28 usage_00266.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLERKVNQ-- 30 usage_00267.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLERKV---- 28 usage_01059.pdb 1 --RVAYWVGKALGN-LSDVNQASRINRKKKH-- 28 usage_01981.pdb 1 PNKVWRKTAALVMNIDDMSKRLKSLERKVN--- 30 usage_01982.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLERKV---- 28 usage_01983.pdb 1 PNKVWRKTAALVMNIDDMSKRLKSLERKV---- 29 usage_01984.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLERKVN--- 29 usage_01985.pdb 1 PNKVWRKTAALVMNIDDMSKRLKSLERKVN--- 30 usage_01986.pdb 1 PNKVWRKTAALVMNIDDMSKRLKSLERKVN--- 30 usage_01988.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSL-------- 24 usage_01989.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLE------- 25 usage_01990.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSLE------- 25 usage_01991.pdb 1 -NKVWRKTAALVMNIDDMSKRLKSL-------- 24 kVwrktaalvmN ddmskrlksl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################