################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:42:58 2021 # Report_file: c_1209_110.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00057.pdb # 2: usage_00126.pdb # 3: usage_00127.pdb # 4: usage_00141.pdb # 5: usage_00222.pdb # 6: usage_00223.pdb # 7: usage_00224.pdb # 8: usage_00225.pdb # 9: usage_00226.pdb # 10: usage_00227.pdb # 11: usage_00228.pdb # 12: usage_00229.pdb # 13: usage_01481.pdb # 14: usage_01482.pdb # 15: usage_01547.pdb # 16: usage_01548.pdb # # Length: 34 # Identity: 4/ 34 ( 11.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 34 ( 26.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 34 ( 14.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00057.pdb 1 NVVV-SGNIVTANGPTSSKDFANAVVGVLNSLS- 32 usage_00126.pdb 1 EVVVDKDQLVTSRTPDDLPAFNREALRLLG---- 30 usage_00127.pdb 1 EVVVDKDQLVTSRTPDDLPAFNREALRLLG---- 30 usage_00141.pdb 1 ALVV-DGNLITSREPGDLAIFTTAILSRLG---- 29 usage_00222.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQ---- 29 usage_00223.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQLEHH 33 usage_00224.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQ---- 29 usage_00225.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQ---- 29 usage_00226.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQL--- 30 usage_00227.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQLEHH 33 usage_00228.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQ---- 29 usage_00229.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQL--- 30 usage_01481.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQ---- 29 usage_01482.pdb 1 SVVV-DNNIVTSRVPDDLDDFNREIVKQLQL--- 30 usage_01547.pdb 1 ECVT-DKGVVTSRKPDDLPAFNKKIVEEFAEG-- 31 usage_01548.pdb 1 ECVT-DKGVVTSRKPDDLPAFNKKIVEEFAE--- 30 V vTsr P dl F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################