################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:11 2021 # Report_file: c_0673_116.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00756.pdb # 2: usage_00834.pdb # 3: usage_00835.pdb # 4: usage_00886.pdb # 5: usage_01811.pdb # # Length: 79 # Identity: 39/ 79 ( 49.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 79 ( 49.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 79 ( 11.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00756.pdb 1 VVKLVSDAQGRFEITGLLAGTYYLEETKQPAGYALLTSRQKFEVTATSYSA--TGQGIEY 58 usage_00834.pdb 1 VVKLISNDKGQFEITGLTEGQYSLEETQAPTGYAKLSGDVSFNVNATSYSKGSAQ-DIEY 59 usage_00835.pdb 1 VVKLISNDKGQFEITGLTEGQYSLEETQAPTGYAKLSGDVSFNVNATSYSKGSAQ-DIEY 59 usage_00886.pdb 1 -VKLVSDAQGRFEITGLLAGTYYLEETKQPAGYALLTSRQKFEVTATSYSA--TGQGIEY 57 usage_01811.pdb 1 VVKLVSDAQGRFEITGLLAGTYYLEETKQPAGYALLTSRQKFEVTATSYSA--TGQGIEY 58 VKL S G FEITGL G Y LEET P GYA L F V ATSYS IEY usage_00756.pdb 59 TAGSGKDDATKVVNK---- 73 usage_00834.pdb 60 TQGSKTKDAQQVINK---- 74 usage_00835.pdb 60 TQGSKTKDAQQVINK---- 74 usage_00886.pdb 58 TAGSGKDDATKVVNKKITI 76 usage_01811.pdb 59 TAGSGKDDATKVVN----- 72 T GS DA V N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################