################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:17 2021 # Report_file: c_1172_83.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00406.pdb # 2: usage_00407.pdb # 3: usage_01013.pdb # 4: usage_01014.pdb # 5: usage_02636.pdb # 6: usage_02637.pdb # 7: usage_02754.pdb # 8: usage_03691.pdb # 9: usage_03692.pdb # 10: usage_04690.pdb # 11: usage_04691.pdb # 12: usage_05001.pdb # # Length: 40 # Identity: 37/ 40 ( 92.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 40 ( 92.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 40 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00406.pdb 1 -TQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 37 usage_00407.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 38 usage_01013.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 38 usage_01014.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 38 usage_02636.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 38 usage_02637.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISCNR 40 usage_02754.pdb 1 -TQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 37 usage_03691.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 38 usage_03692.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISCNR 40 usage_04690.pdb 1 -TQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 37 usage_04691.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 38 usage_05001.pdb 1 ETQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC-- 38 TQIFQGSNWIMLIYKGGDEYDNHCGREQRRAVVMISC #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################