################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:13 2021 # Report_file: c_0811_32.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00011.pdb # 2: usage_00012.pdb # 3: usage_00117.pdb # 4: usage_00118.pdb # 5: usage_00119.pdb # 6: usage_00151.pdb # 7: usage_00294.pdb # 8: usage_00378.pdb # 9: usage_00379.pdb # 10: usage_00544.pdb # 11: usage_00545.pdb # # Length: 57 # Identity: 22/ 57 ( 38.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 57 ( 38.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 57 ( 14.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00011.pdb 1 -WHMRCKIAQGAANGINFLHE-N--HHIHRDIKSANILLDEAFTAKISDFGLARAS- 52 usage_00012.pdb 1 -WHMRCKIAQGAANGINFLHE-N--HHIHRDIKSANILLDEAFTAKISDFGLARASE 53 usage_00117.pdb 1 DWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMD 57 usage_00118.pdb 1 -WPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMD 56 usage_00119.pdb 1 -WPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMD 56 usage_00151.pdb 1 -WPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMD 56 usage_00294.pdb 1 --STRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEARVSDFGMARLMS 55 usage_00378.pdb 1 -WSTRRKIAIGSARGLAFLHHNCSPHIIHRD-KSSNVLLDENLEARVSDFGARLS-- 53 usage_00379.pdb 1 -WSTRRKIAIGSARGLAFLHHNCSPHIIHRD-KSSNVLLDENLEARVSDFGARLS-- 53 usage_00544.pdb 1 -WSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEARVSDFGMARLMS 56 usage_00545.pdb 1 -WSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEARVSDFGMARLMS 56 R IA G A G LH IHRD K N LLDE A DFG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################