################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:12:02 2021 # Report_file: c_0524_4.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00004.pdb # 2: usage_00020.pdb # 3: usage_00024.pdb # 4: usage_00030.pdb # 5: usage_00034.pdb # # Length: 121 # Identity: 23/121 ( 19.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/121 ( 38.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 25/121 ( 20.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 TWVDADLYCQNMNS-GNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDP-KK-----N 53 usage_00020.pdb 1 -WTDADLAC-QKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDP-TQG-TE-G 55 usage_00024.pdb 1 SWQESKKAC-LRGG-GDLVSIHSMAELEFITKQI-K--QEVEELWIGLNDLK-L-----Q 49 usage_00030.pdb 1 TWVDADLYCQNMNS-GNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDP-KK-----N 53 usage_00034.pdb 1 -WTDADLAC-QKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDP-TQGTEPNG 57 W dadl C GnLVSvl AEg Fv sl vWIGLhDp usage_00004.pdb 54 RAWHWSSGSLVSYKSWGIGAPS----SVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKF 109 usage_00020.pdb 56 EGWEWSSSDVMNYFAWER-N---PSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKF 111 usage_00024.pdb 50 MNFEWSDGSLVSFTHWHPFEPNNFRDSLE--DCVTIWG--PEGRWNDSPCNQSLPSICKK 105 usage_00030.pdb 54 RRWHWSSGSLVSYKSWGIGAPS----SVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKF 109 usage_00034.pdb 58 EGWEWSSSDVMNYFAWER-N---PSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKF 113 w WSs y W C sl f WkD C vCKf usage_00004.pdb 110 K 110 usage_00020.pdb - usage_00024.pdb 106 A 106 usage_00030.pdb 110 K 110 usage_00034.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################