################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:57 2021 # Report_file: c_0866_11.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00006.pdb # 2: usage_00007.pdb # 3: usage_00008.pdb # 4: usage_00009.pdb # 5: usage_00011.pdb # 6: usage_00067.pdb # # Length: 71 # Identity: 7/ 71 ( 9.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 71 ( 29.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 71 ( 19.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00006.pdb 1 -KNLPAEFARYSEQQVSDYLALNAGLVANLVLALTDQGIGSNIILGFDKSKVNEVLEIED 59 usage_00007.pdb 1 ---LPAEFARYSEQQVSDYLALNAGLVANLVLALTDQGIGSNIILGFDKSKVNEVLEIED 57 usage_00008.pdb 1 FKNLPAEFARYSEQQVSDYLALNAGLVANLVLALTDQGIGSNIILGFDKSKVNEVLEIED 60 usage_00009.pdb 1 ---LPAEFARYSEQQVSDYLALNAGLVANLVLALTDQGIGSNIILGFDKSKVNEVLEIED 57 usage_00011.pdb 1 -----KSAIAQYGDRVYRYLHDAGHLGQRLNLAAIQLNLGVSGIGGFFDDQVNEVLGIPN 55 usage_00067.pdb 1 ----VLGRTH-NPQMDLYSTVCAVQN---LWLAARAEGVGVGWVSIFHESEIKAILGIPD 52 q v yl l L LA g G i gF s vnevL I d usage_00006.pdb 60 RFRPELLITVG 70 usage_00007.pdb 58 RFRPELLITVG 68 usage_00008.pdb 61 RFRPELLITVG 71 usage_00009.pdb 58 RFRPELLITVG 68 usage_00011.pdb 56 DEAVIYITTLG 66 usage_00067.pdb 53 HVEIVA----- 58 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################