################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:05 2021 # Report_file: c_1132_18.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00048.pdb # 2: usage_00050.pdb # 3: usage_00078.pdb # 4: usage_00085.pdb # 5: usage_00105.pdb # 6: usage_00131.pdb # 7: usage_00247.pdb # 8: usage_00253.pdb # 9: usage_00517.pdb # 10: usage_00541.pdb # 11: usage_00619.pdb # 12: usage_00651.pdb # # Length: 56 # Identity: 9/ 56 ( 16.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 56 ( 32.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 56 ( 5.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00048.pdb 1 TPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN 54 usage_00050.pdb 1 TPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN 54 usage_00078.pdb 1 TPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN 54 usage_00085.pdb 1 TAEEKGLVNGLWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSSADAIMSN 54 usage_00105.pdb 1 TPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN 54 usage_00131.pdb 1 TPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN 54 usage_00247.pdb 1 SDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKAS 56 usage_00253.pdb 1 TPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN 54 usage_00517.pdb 1 -DFERATIKDIFSKL--EYDVVGPATLARCLVVYPWTQRYFGKFGNLYNAAAIAQN 53 usage_00541.pdb 1 -DKERSIISDIFSHM--DYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSN 53 usage_00619.pdb 1 -DKERSIISDIFSHM--DYDDIGPKALSRCLIVYPWTQRHFSGFGNLYNAEAIIGN 53 usage_00651.pdb 1 TAEEKGLVNGLWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSSADAIMSN 54 E d G L R l vyPwTqr F Fg L n #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################