################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:34 2021 # Report_file: c_1380_197.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00429.pdb # 2: usage_00430.pdb # 3: usage_00431.pdb # 4: usage_00442.pdb # 5: usage_00443.pdb # 6: usage_00444.pdb # 7: usage_00514.pdb # 8: usage_00699.pdb # 9: usage_00831.pdb # 10: usage_01424.pdb # 11: usage_01460.pdb # 12: usage_01541.pdb # # Length: 52 # Identity: 2/ 52 ( 3.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 52 ( 57.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 52 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00429.pdb 1 NRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYE-LGEEAMEMFREDE- 50 usage_00430.pdb 1 NRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYE-LGEEAMEMFREDE- 50 usage_00431.pdb 1 NRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYE-LGEEAMEMFREDE- 50 usage_00442.pdb 1 NRPSFDAILYFYQSGGRLRRPVDVPLDVFSEEIKFYE-LGENAFERYREDE- 50 usage_00443.pdb 1 NRPSFDAILYFYQSGGRLRRPRNVPLDVFSEEIKFYE-LGENAFERYREDE- 50 usage_00444.pdb 1 NRPSFDAILYFYQSGGRLRRPVAVPLDVFSEEIKFYE-LGENAFERYREDEG 51 usage_00514.pdb 1 NRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYE-LGEEAMEMFREDEG 51 usage_00699.pdb 1 NRPSFDAILYFYQSGGRLRRPVNVPLDVFSEEIKFYE-LGENAFERYREDE- 50 usage_00831.pdb 1 -NQVIKDATIYLYH----------EEDRLRSFLWSINPLFPRFLSEFKSGT- 40 usage_01424.pdb 1 NRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYE-LGEEAMEMFREDE- 50 usage_01460.pdb 1 NRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYE-LGEEAMEMFREDEG 51 usage_01541.pdb 1 NRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQ-LGEEAMEKFREDEG 51 rpsfdaily yqs p D fseei fy Lge a e rede #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################