################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:23 2021 # Report_file: c_1163_37.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00167.pdb # 2: usage_00457.pdb # 3: usage_00610.pdb # 4: usage_00804.pdb # 5: usage_00805.pdb # 6: usage_00890.pdb # 7: usage_00891.pdb # 8: usage_00892.pdb # # Length: 33 # Identity: 19/ 33 ( 57.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 33 ( 69.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 33 ( 3.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00167.pdb 1 -IKLYVRRVFITDEAEDLIPEWLSFVKGVVDSE 32 usage_00457.pdb 1 NIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSE 33 usage_00610.pdb 1 YIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSD 33 usage_00804.pdb 1 NIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSE 33 usage_00805.pdb 1 NIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSE 33 usage_00890.pdb 1 NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSE 33 usage_00891.pdb 1 NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSE 33 usage_00892.pdb 1 NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSE 33 IKLYVRRVFI D liPe L F GVVDSe #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################