################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:41 2021 # Report_file: c_0653_104.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00131.pdb # 2: usage_00157.pdb # 3: usage_00169.pdb # 4: usage_00840.pdb # 5: usage_00901.pdb # 6: usage_00979.pdb # # Length: 65 # Identity: 11/ 65 ( 16.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 65 ( 32.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 65 ( 18.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00131.pdb 1 QVSLRTRFGMHFCGGTLISPEWVLTAAHCLEK----S-PRPSSYKVILGAHQEVNL-EPH 54 usage_00157.pdb 1 IAALYWGH-S-FCAGSLIAPCWVLTAAHCLQD----R-PAPEDLTVVLGQERRNHS-CEP 52 usage_00169.pdb 1 QVSLQDKTGFHFCGGSLINENWVVTAAHCG--------V-TTSDVVVAGEFDQGSS-SEK 50 usage_00840.pdb 1 QVSLQDKTGFHFCGGSLISEDWVVTAAHCG--------V-KTSDVVVAGEFDQGSD-EEN 50 usage_00901.pdb 1 QVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPG 60 usage_00979.pdb 1 QVSLQDKTGFHFCGGSLINENWVVTAAHCG--------V-TTSDVVVAGEFDQGSS-SEK 50 qvsL fCggsLI Wv tAAHC v G usage_00131.pdb 55 VQEIE 59 usage_00157.pdb 53 CQTLA 57 usage_00169.pdb 51 IQKLK 55 usage_00840.pdb 51 IQVLK 55 usage_00901.pdb 61 VQERR 65 usage_00979.pdb 51 IQKLK 55 Q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################