################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:05 2021 # Report_file: c_0740_43.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00258.pdb # 2: usage_00441.pdb # 3: usage_00540.pdb # 4: usage_00541.pdb # 5: usage_00774.pdb # 6: usage_00775.pdb # 7: usage_00868.pdb # # Length: 67 # Identity: 9/ 67 ( 13.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 67 ( 50.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 67 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00258.pdb 1 GTTYKALLPD--GSALAVKHLST--CKL-GEREFRYEMNQLWELRHSNLAPLLGFCVVEE 55 usage_00441.pdb 1 GDVYKAILKD--GSAVAIKKLIH--D-----REFMAEMETIGKIKHRNLVPLLGYCKVGD 51 usage_00540.pdb 1 -DVYKAILKD--GSAVAIKKLIHVSD-----REF--AEETIGKIKHRNLVPLLGYCKVGD 50 usage_00541.pdb 1 GDVYKAILKD--GSAVAIKKLIH--D-----REF--AEETIGKIKHRNLVPLLGYCKVGD 49 usage_00774.pdb 1 GDVYKAILKD--GSAVAIKKLIH--VSGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGD 56 usage_00775.pdb 1 GDVYKAILKD--GSAVAIKKLIH--VSGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGD 56 usage_00868.pdb 1 GKVFLAECYNLCKILVAVKTLKD--ASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGD 58 vykA l d gsavA K L reF e H nlvpllG C vgd usage_00258.pdb 56 EKFLVYK 62 usage_00441.pdb 52 ERLLVYE 58 usage_00540.pdb 51 ERLLVYE 57 usage_00541.pdb 50 ERLLVYE 56 usage_00774.pdb 57 ERLLVYE 63 usage_00775.pdb 57 ERLLVYE 63 usage_00868.pdb 59 PLIMVFE 65 e lVye #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################