################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:34 2021 # Report_file: c_1001_15.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00157.pdb # 2: usage_00219.pdb # 3: usage_00320.pdb # 4: usage_00336.pdb # 5: usage_00337.pdb # 6: usage_00338.pdb # 7: usage_00432.pdb # 8: usage_00694.pdb # # Length: 71 # Identity: 10/ 71 ( 14.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 71 ( 50.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 71 ( 26.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00157.pdb 1 ---------GEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYDPKSF--EKYHLLAE 49 usage_00219.pdb 1 -------IWGDYQGYQIATTPPPSSGGIFLLQMPKILDHFNLSQYDVRSW--EKYQLLAE 51 usage_00320.pdb 1 -------VFTDLDEFRIYETSPNSQG-ITVIEWIRGE-SHGY---DSRTWEA-KIEDIFE 47 usage_00336.pdb 1 -------IWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSW--EKYQLLAE 51 usage_00337.pdb 1 -------IWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSW--EKYQLLAE 51 usage_00338.pdb 1 DITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSW--EKYQLLAE 58 usage_00432.pdb 1 -------IWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYDPKSF--EKYHLLAE 51 usage_00694.pdb 1 -------IWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSW--EKYQLLAE 51 g y gy Ia pPpSsG f lqm k f l D s Ky llaE usage_00157.pdb 50 TMHLSYADRAA 60 usage_00219.pdb 52 TMHLSYADRAS 62 usage_00320.pdb 48 T-EEAYDKRR- 56 usage_00336.pdb 52 TMHLSYADRAS 62 usage_00337.pdb 52 TMHLSYADRAS 62 usage_00338.pdb 59 TMHLSYADRAS 69 usage_00432.pdb 52 TMHLSYADRA- 61 usage_00694.pdb 52 TMHLSYADRAS 62 T hlsYadRa #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################