################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:35 2021 # Report_file: c_1012_43.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00516.pdb # 2: usage_00517.pdb # 3: usage_00518.pdb # 4: usage_00519.pdb # 5: usage_00520.pdb # 6: usage_00609.pdb # 7: usage_00610.pdb # 8: usage_00624.pdb # # Length: 66 # Identity: 13/ 66 ( 19.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 66 ( 19.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 66 ( 36.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00516.pdb 1 NVFRCNVIGVKNCGKSGVLQALLG-RN--------------SYYAINTVY----EKYLLL 41 usage_00517.pdb 1 NVFRCNVIGVKNCGKSGVLQALLG-RNLMRQKKIREDHK--SYYAINTVYVYGQEKYLLL 57 usage_00518.pdb 1 NVFRCNVIGVKNCGKSGVLQALLG-RNLMRQKKIREDHK--SYYAINTVYVYGQEKYLLL 57 usage_00519.pdb 1 SVLLCKVVGACGVGKSAFLQAFLG-RGLGHQ----TREQ-PPGYAIDTVQVNGQEKYLIL 54 usage_00520.pdb 1 SVLLCKVVGACGVGKSAFLQAFLG-RGLGHQ----DTREQPPGYAIDTVQVNGQEKYLIL 55 usage_00609.pdb 1 SVYKCHVIGPKGSGKTGMCRGFLVE-DMHKLIGKEFKTN--VVNCINSVQVYGQEKHLIL 57 usage_00610.pdb 1 SVYKCHVIGPKGSGKTGMCRGFLVE-DMHKLIGKEFKTN--VVNCINSVQVYGQEKHLIL 57 usage_00624.pdb 1 NVFRCNVIGVKNCGKSGVLQALLG-RNLMRQK---------SYYAINTVYVYGQEKYLLL 50 V C V G GK L I V EK L L usage_00516.pdb 42 HDIS-- 45 usage_00517.pdb 58 HDISE- 62 usage_00518.pdb 58 HDISE- 62 usage_00519.pdb 55 CEVGTD 60 usage_00520.pdb 56 CEVGTD 61 usage_00609.pdb 58 RD---- 59 usage_00610.pdb 58 RD---- 59 usage_00624.pdb 51 HDIS-- 54 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################