################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:17 2021 # Report_file: c_1386_95.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00047.pdb # 2: usage_00048.pdb # 3: usage_00049.pdb # 4: usage_00229.pdb # 5: usage_00230.pdb # 6: usage_00294.pdb # 7: usage_00295.pdb # 8: usage_00296.pdb # 9: usage_00297.pdb # 10: usage_00298.pdb # 11: usage_00299.pdb # 12: usage_00300.pdb # 13: usage_00301.pdb # # Length: 34 # Identity: 15/ 34 ( 44.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 34 ( 44.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 34 ( 2.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00047.pdb 1 SFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 34 usage_00048.pdb 1 -FGAAWNRFKEVNVNVEQVGKLLGGKVQHNIDAG 33 usage_00049.pdb 1 -FGAAWNRFKEVNVNVEQVGKLLGGKVQHNIDAG 33 usage_00229.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 usage_00230.pdb 1 SFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 34 usage_00294.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 usage_00295.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 usage_00296.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 usage_00297.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 usage_00298.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 usage_00299.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 usage_00300.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 usage_00301.pdb 1 -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG 33 F AW F VN V VG GG V NI G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################