################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:51 2021 # Report_file: c_0842_38.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00076.pdb # 2: usage_00362.pdb # 3: usage_00516.pdb # 4: usage_00526.pdb # 5: usage_00527.pdb # 6: usage_00818.pdb # # Length: 80 # Identity: 14/ 80 ( 17.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 80 ( 56.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 80 ( 16.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00076.pdb 1 DAIQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASVEEYEANLKEIVAYAKQKQAET 60 usage_00362.pdb 1 ---------PVETVQRLAELGAHGVTFHDDDLIPFGS----SDTERESHIKRFRQALDAT 47 usage_00516.pdb 1 ---------PVESVQRLAELGAHGVTFHDDDLIPFGS----SDSEREEHVKRFRQALDDT 47 usage_00526.pdb 1 ---------PVEAVHKLAELGAYGITFHDNDLIPFDA----TEAEREKILGDFNQALKDT 47 usage_00527.pdb 1 --------DPVEAVHKLAELGAYGITFHDNDLIPFDA----TEAEREKILGDFNQALKDT 48 usage_00818.pdb 1 ---------PVESVQRLAELGAHGVTFHDDDLIPFGS----SDSEREEHVKRFRQALDDT 47 pve v laelGa g tFHD DLipf ere f Qal T usage_00076.pdb 61 GIKLLWGTANVFGHARYMNG 80 usage_00362.pdb 48 GMTVPMATTNLFTHPVFKDG 67 usage_00516.pdb 48 GMKVPMATTNLFTHPVFKDG 67 usage_00526.pdb 48 GLKVPMVTTNLFSHPVFKDG 67 usage_00527.pdb 49 GLKVPMVTTNLFSHPVFKDG 68 usage_00818.pdb 48 GMKVPMATTNLFTHPVFKDG 67 G kvpm TtNlF HpvfkdG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################