################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:47 2021 # Report_file: c_1135_85.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00157.pdb # 2: usage_00159.pdb # 3: usage_00160.pdb # 4: usage_00974.pdb # 5: usage_00976.pdb # 6: usage_01016.pdb # # Length: 79 # Identity: 37/ 79 ( 46.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 54/ 79 ( 68.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 79 ( 2.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00157.pdb 1 LDLFERLWAVDTVERLGIDRHFKEEIKEALDYVYSHWDERGIGWARENPVPDIDDTAMGL 60 usage_00159.pdb 1 LDLFERLWAVDTVERLGIDRHFKEEIKEALDYVYSHWDERGIGWARENPVPDIDDTAMGL 60 usage_00160.pdb 1 LDLFERLWAVDTVERLGIDRHFKEEIKEALDYVYSHWDERGIGWARENPVPDIDDTAMGL 60 usage_00974.pdb 1 -DLLERLSLVDNIEHLGIGRHFKQEIKGALDYVYRHWSERGIGWGRDSLVPDLNTTALGL 59 usage_00976.pdb 1 -DLLERLSLVDNIEHLGIGRHFKQEIKGALDYVYRHWSERGIGWGRDSLVPDLNTTALGL 59 usage_01016.pdb 1 -DLFEHIWIVDRLQRLGISRYFEEEIKECLDYVHRYWTDNGICWARCSHVQDIDDTAMAF 59 DL Erl VD e LGI RhFk EIK aLDYVy hW erGIgW R VpD TA gl usage_00157.pdb 61 RILRLHGYNVSSDVLKTFR 79 usage_00159.pdb 61 RILRLHGYNVSSDVLKTFR 79 usage_00160.pdb 61 RILRLHGYNVSSDVLKTFR 79 usage_00974.pdb 60 RTLRMHGYNVSSDVLNNF- 77 usage_00976.pdb 60 RTLRMHGYNVSSDVLNNF- 77 usage_01016.pdb 60 RLLRQHGYQVSADVFKNFE 78 R LR HGYnVSsDVl F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################