################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:04 2021 # Report_file: c_0851_63.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00003.pdb # 2: usage_00004.pdb # 3: usage_00158.pdb # 4: usage_00497.pdb # 5: usage_00825.pdb # 6: usage_00826.pdb # 7: usage_00829.pdb # 8: usage_00830.pdb # # Length: 91 # Identity: 31/ 91 ( 34.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 91 ( 47.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 91 ( 18.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 PALERMKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLASG---EPDVRGGFP 57 usage_00004.pdb 1 PALERMKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLASG---EPDVRGGFP 57 usage_00158.pdb 1 SPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIG---EPPATKGYP 57 usage_00497.pdb 1 PALERVRALFVATTIAEFFRDNGKRVVLLADSLTRYARAAREIALAAGETA--------- 51 usage_00825.pdb 1 -SVDRCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAG---E-----PV- 50 usage_00826.pdb 1 -SVDRCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAG---E-----PV- 50 usage_00829.pdb 1 SSVDRCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAG---------PV- 50 usage_00830.pdb 1 SSVDRCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAG----------V- 49 R aa AT IAE FR G V L DS TRYArA R LA G usage_00003.pdb 58 PSVFSSLPKLLERAGPAP-K-GSITAIYTVL 86 usage_00004.pdb 58 PSVFSSLPKLLERAGPAP-KGSITAIYTV-L 86 usage_00158.pdb 58 PSVFAKLPALVERAGNGIHGGGSITAFYTVL 88 usage_00497.pdb 52 -GVFSALPRLLERTGMGE-K-GSITAFYTVL 79 usage_00825.pdb 51 -SVFDSLPRLLERPGKLK-AGGSITAFYTVL 79 usage_00826.pdb 51 -SVFDSLPRLLERPGKLK-AGGSITAFYTVL 79 usage_00829.pdb 51 -SVFDSLPRLLERPGKLK-AGGSITAFYTVL 79 usage_00830.pdb 50 -SVFDSLPRLLERPGKLK-AGGSITAFYTVL 78 sVF LP LlER G gsita yt L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################