################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:18:39 2021 # Report_file: c_1305_8.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00270.pdb # 2: usage_00274.pdb # 3: usage_00516.pdb # 4: usage_00914.pdb # 5: usage_00915.pdb # 6: usage_00916.pdb # 7: usage_00918.pdb # 8: usage_01082.pdb # 9: usage_01236.pdb # 10: usage_01238.pdb # # Length: 37 # Identity: 5/ 37 ( 13.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 37 ( 29.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 37 ( 35.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00270.pdb 1 ----PWVLTGFADAEGSFILRIRNNNKSSAGYSTELG 33 usage_00274.pdb 1 -----WFLTGFIDGEGCFRISVTK------WRVQL-- 24 usage_00516.pdb 1 ---NPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVA- 33 usage_00914.pdb 1 ----PWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVA- 32 usage_00915.pdb 1 ----PWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVA- 32 usage_00916.pdb 1 ---NPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVA- 33 usage_00918.pdb 1 -----WAVVGFIDAEGSFMVRVRKNSKYKTGWLVVA- 31 usage_01082.pdb 1 EDFKEGYILGFIEAEGSFSVSIKFQRDVFGGVRLDP- 36 usage_01236.pdb 1 ----PWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVA- 32 usage_01238.pdb 1 ---NPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVA- 33 w GFidaEGsF g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################