################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:36:48 2021 # Report_file: c_0564_7.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00009.pdb # 2: usage_00018.pdb # 3: usage_00044.pdb # 4: usage_00070.pdb # 5: usage_00073.pdb # 6: usage_00081.pdb # 7: usage_00095.pdb # # Length: 62 # Identity: 17/ 62 ( 27.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 62 ( 46.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 62 ( 12.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00009.pdb 1 --FTVDSVTISGVV-VACEGGCQAILDTGTSKLVGPSSDILNIQQAIGATQNQYGEFDID 57 usage_00018.pdb 1 WQITVDSITMNGEA-IACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVS 59 usage_00044.pdb 1 -----EEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQEDEYGQFLVN 55 usage_00070.pdb 1 --ITLDSITMDGET-IACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVIS 57 usage_00073.pdb 1 --FTVDSVTISGVV-VACEGGCQAILDTGTSKLVGPSSDILNIQQAIGATQNQYGEFDID 57 usage_00081.pdb 1 --ITLDSITMDGET-IACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVIS 57 usage_00095.pdb 1 WQITVDSITMNGEA-IACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVS 59 ds t G aC GCQAI DTGTS L gP s i niq iGA n G usage_00009.pdb -- usage_00018.pdb -- usage_00044.pdb -- usage_00070.pdb -- usage_00073.pdb -- usage_00081.pdb 58 CS 59 usage_00095.pdb -- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################