################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:07 2021 # Report_file: c_1432_92.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00517.pdb # 2: usage_00518.pdb # 3: usage_00519.pdb # 4: usage_00520.pdb # 5: usage_00521.pdb # 6: usage_00522.pdb # 7: usage_00523.pdb # 8: usage_00524.pdb # 9: usage_01613.pdb # 10: usage_01614.pdb # 11: usage_01615.pdb # 12: usage_01616.pdb # # Length: 38 # Identity: 33/ 38 ( 86.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 38 ( 86.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 38 ( 13.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00517.pdb 1 ----RMPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 34 usage_00518.pdb 1 ----RMPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 34 usage_00519.pdb 1 ----RMPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 34 usage_00520.pdb 1 ----RMPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 34 usage_00521.pdb 1 ----RMPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 34 usage_00522.pdb 1 -----MPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 33 usage_00523.pdb 1 -----MPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 33 usage_00524.pdb 1 GVCTRMPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 38 usage_01613.pdb 1 -----MPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 33 usage_01614.pdb 1 -----MPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 33 usage_01615.pdb 1 -----MPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 33 usage_01616.pdb 1 -----MPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG 33 MPLLYDYGYLRGNLTSMMKLVEIQCTNPAKVYG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################