################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:40 2021 # Report_file: c_1148_41.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_02049.pdb # 2: usage_02051.pdb # 3: usage_02052.pdb # 4: usage_02796.pdb # 5: usage_03767.pdb # 6: usage_03768.pdb # 7: usage_03769.pdb # # Length: 43 # Identity: 20/ 43 ( 46.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 43 ( 72.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 43 ( 27.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02049.pdb 1 -VKYGIVLDAGSSHTNLYIYKWP---------VVQQLEECQV- 32 usage_02051.pdb 1 -VKYGIVLDAGSSHTNLYIYKWP---------VVQQLEECQ-- 31 usage_02052.pdb 1 NVKYGIVLDAGSSHTNLYIYKWPA--------VVQQLEECQV- 34 usage_02796.pdb 1 ALKYGIVLDAGSSHTSMFVYKWPAD-KENDTGIVGQHSSCDVQ 42 usage_03767.pdb 1 NVKYGIVLDAGSSHTNLYIYKWPAEK-ENDTGVVQQLEECQ-- 40 usage_03768.pdb 1 NVKYGIVLDAGSSHTNLYIYKWP--------GVVQQLEECQV- 34 usage_03769.pdb 1 -VKYGIVLDAGSSHTNLYIYKWP---------VVQQLEECQV- 32 vKYGIVLDAGSSHTnlyiYKWP vVqQleeCq #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################