################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:18:18 2021
# Report_file: c_1059_2.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00081.pdb
#   2: usage_00107.pdb
#   3: usage_00108.pdb
#   4: usage_00109.pdb
#   5: usage_00110.pdb
#   6: usage_00111.pdb
#   7: usage_00112.pdb
#   8: usage_00113.pdb
#   9: usage_00114.pdb
#  10: usage_00129.pdb
#
# Length:         33
# Identity:        7/ 33 ( 21.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     14/ 33 ( 42.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           11/ 33 ( 33.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00081.pdb         1  TLKDSGSYFCRGLVGSKNV-SSETVNIT-----   27
usage_00107.pdb         1  TVEDSGTYYCTGKVWQLDY-ESEPLNITVIK--   30
usage_00108.pdb         1  TVEDSGTYYCTGKVWQLDY-ESEPLNITVIK--   30
usage_00109.pdb         1  KFEDSGEYKCQHQ----QVNESEPVYLEV----   25
usage_00110.pdb         1  -VEDSGTYYCTGKVWQLDY-ESEPLNITVIK--   29
usage_00111.pdb         1  TVEDSGTYYCTGKVWQLDY-ESEPLNITVIK--   30
usage_00112.pdb         1  TVEDSGTYYCTGKVWQLDY-ESEPLNITVIK--   30
usage_00113.pdb         1  TVEDSGTYYCTGKVWQLDY-ESEPLNITVIK--   30
usage_00114.pdb         1  TVEDSGTYYCTGKVWQLDY-ESEPLNITVIK--   30
usage_00129.pdb         1  AAEDSGTYYCTGKVWQLDY-ESEPLNITVIKAP   32
                             eDSG Y C g        eSEp nit     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################