################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:56 2021 # Report_file: c_1373_96.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00022.pdb # 2: usage_00897.pdb # 3: usage_01352.pdb # 4: usage_01389.pdb # 5: usage_01776.pdb # 6: usage_01777.pdb # 7: usage_01861.pdb # 8: usage_01863.pdb # # Length: 73 # Identity: 41/ 73 ( 56.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 73 ( 58.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 28/ 73 ( 38.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 IDPIIELIRHAPTPAEAKTALVANPWQLGN-VAAML-E---DAARPEWLEPEFGVRDGLY 55 usage_00897.pdb 1 ---IIELIRHAPTPAEAKTALVANPWQLGN-VAAML-E---DAARPEWLEPEFGVRDGLY 52 usage_01352.pdb 1 IDPIIELIRHAPTPAEAKTALVANPW------VAAL----EDAARPEWLEPEF-----LY 45 usage_01389.pdb 1 -DPIIELIRHAPTPAEAKTALVANPWQLGN-MLERA-G-----ARPEWL--EFGVRDG-- 48 usage_01776.pdb 1 IDPIIELIRHAPTPAEAKTALVANPWQL--NVAAML-E--DDAARPEWLEPEFGVRDGLY 55 usage_01777.pdb 1 IDPIIELIRHAPTPAEAKTALVANPWQLGN-VAAML-E--DDAARPEWLEPEFGVRDGLY 56 usage_01861.pdb 1 IDPIIELIRHAPTPAEAKTALVANPWQLGN-VAAMLER--DDAARPEWLEPEFGVRDGLY 57 usage_01863.pdb 1 IDPIIELIRHAPTPAEAKTALVANPWQLGN-VAAMLERAGDDAARPEWLEPEFGVRDGLY 59 IIELIRHAPTPAEAKTALVANPW a l ARPEWL EF usage_00022.pdb 56 YLTEQQAQAILDL 68 usage_00897.pdb 53 YLTEQQAQAILDL 65 usage_01352.pdb 46 YLTEQQAQAILDL 58 usage_01389.pdb 49 ---EQQAQAILDL 58 usage_01776.pdb 56 YLTEQQAQAILDL 68 usage_01777.pdb 57 YLTEQQAQAILDL 69 usage_01861.pdb 58 YLTEQQAQAILDL 70 usage_01863.pdb 60 YLTEQQAQAILDL 72 EQQAQAILDL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################