################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:51:55 2021 # Report_file: c_0900_39.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00074.pdb # 2: usage_00075.pdb # 3: usage_00076.pdb # 4: usage_00109.pdb # 5: usage_00151.pdb # 6: usage_00174.pdb # 7: usage_00274.pdb # 8: usage_00396.pdb # 9: usage_00540.pdb # 10: usage_00970.pdb # 11: usage_00971.pdb # 12: usage_00972.pdb # # Length: 45 # Identity: 5/ 45 ( 11.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 45 ( 33.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 45 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00074.pdb 1 ETFTVKMG--ADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNI-- 41 usage_00075.pdb 1 ETFTVKMG--ADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNI-- 41 usage_00076.pdb 1 ETFTVKMG--ADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNI-- 41 usage_00109.pdb 1 -DATVKLG--ADSGALEFVPKTLTIKSGETVNFVNNAGFPHNIVF 42 usage_00151.pdb 1 ETFTVKMG--ADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNI-- 41 usage_00174.pdb 1 ETYTVKLG--SDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNV-- 41 usage_00274.pdb 1 ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVE-- 43 usage_00396.pdb 1 ETYTVKLG--SDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNV-- 41 usage_00540.pdb 1 -MIDVLLG--ADDGSLAFVPSEFSCSPGCKIVFKNNAGFPHNI-- 40 usage_00970.pdb 1 ETFTVKMG--ADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNI-- 41 usage_00971.pdb 1 ETFTVKMG--ADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNI-- 41 usage_00972.pdb 1 ETFTVKMG--ADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNI-- 41 V g d G F P pG tv nn phn #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################