################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:21 2021 # Report_file: c_1380_168.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00222.pdb # 2: usage_00447.pdb # 3: usage_00448.pdb # 4: usage_00449.pdb # 5: usage_00462.pdb # 6: usage_00482.pdb # 7: usage_00603.pdb # 8: usage_00856.pdb # 9: usage_02164.pdb # 10: usage_02272.pdb # # Length: 47 # Identity: 8/ 47 ( 17.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 47 ( 19.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 47 ( 38.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00222.pdb 1 ----------VCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLED- 36 usage_00447.pdb 1 -----------------ELVHMINWAKRVPGFVDLTLHDQVHLLECA 30 usage_00448.pdb 1 -----------------ELVHMINWAKRVPGFVDLTLHDQVHLLECA 30 usage_00449.pdb 1 -----------------ELVHMINWAKRVPGFVDLTLHDQVHLLECA 30 usage_00462.pdb 1 -----SMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLESA 42 usage_00482.pdb 1 PDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYS 47 usage_00603.pdb 1 ---EASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAW 44 usage_00856.pdb 1 -------LPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGA 40 usage_02164.pdb 1 ------LLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGA 41 usage_02272.pdb 1 -----SMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECA 42 i AK F L DQ LL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################