################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:44 2021 # Report_file: c_0835_141.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00457.pdb # 2: usage_00459.pdb # 3: usage_00460.pdb # 4: usage_00461.pdb # 5: usage_00521.pdb # 6: usage_00652.pdb # 7: usage_00653.pdb # 8: usage_01328.pdb # # Length: 68 # Identity: 17/ 68 ( 25.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 68 ( 26.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 68 ( 2.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00457.pdb 1 -KPTQHSVAALRSIGITPDALILRCDRDVPEALKNKIALMCDVDIDGVISTPDAPSIYDI 59 usage_00459.pdb 1 -KPTQHSVAALRSIGITPDALILRCDRDVPEALKNKIALMCDVDIDGVISTPDAPSIYDI 59 usage_00460.pdb 1 -KPTQHSVAALRSIGITPDALILRCDRDVPEALKNKIALMCDVDIDGVISTPDAPSIYDI 59 usage_00461.pdb 1 -KPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRV 59 usage_00521.pdb 1 -KPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRV 59 usage_00652.pdb 1 -KPTQHSVATLRGVGIQPDILVLRSARPVPEEVRRKVALFTNVRPGHVFSSPTVEHLYEV 59 usage_00653.pdb 1 -KPTQHSVATLRGVGIQPDILVLRSARPVPEEVRRKVALFTNVRPGHVFSSPTVEHLYEV 59 usage_01328.pdb 1 TKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKI 60 KPTQ SV Lr G PD R K V V Y usage_00457.pdb 60 PKVLHRE- 66 usage_00459.pdb 60 PKVLHREE 67 usage_00460.pdb 60 PKVLHREE 67 usage_00461.pdb 60 PLLLEEQG 67 usage_00521.pdb 60 PVLLEEQS 67 usage_00652.pdb 60 PLLLEEQG 67 usage_00653.pdb 60 PLLLEEQG 67 usage_01328.pdb 61 PGLLKSQG 68 P L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################