################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:04 2021 # Report_file: c_1387_31.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00171.pdb # 2: usage_00172.pdb # 3: usage_00173.pdb # 4: usage_00174.pdb # 5: usage_00175.pdb # 6: usage_00176.pdb # 7: usage_00261.pdb # 8: usage_00916.pdb # 9: usage_02226.pdb # # Length: 48 # Identity: 2/ 48 ( 4.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 48 ( 27.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 48 ( 45.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00171.pdb 1 PIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFR--NLFHRQG 46 usage_00172.pdb 1 PIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFR--NLFHRQG 46 usage_00173.pdb 1 PIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFR--NLFHRQG 46 usage_00174.pdb 1 PIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFR--NLFHRQ- 45 usage_00175.pdb 1 PIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFR--NLFHRQG 46 usage_00176.pdb 1 PIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFR--NLFHRQG 46 usage_00261.pdb 1 PIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFR--NLFHRQG 46 usage_00916.pdb 1 TAEEMTKYHSDEYIKFLRSI-------------------RPDNMSEY- 28 usage_02226.pdb 1 SVETLCAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFK--DLSIKLE 46 E lckg p Ef yln c l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################