################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:15 2021 # Report_file: c_1399_113.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00205.pdb # 2: usage_00213.pdb # 3: usage_00214.pdb # 4: usage_00517.pdb # 5: usage_00657.pdb # 6: usage_00872.pdb # 7: usage_00886.pdb # 8: usage_01026.pdb # 9: usage_01166.pdb # 10: usage_01167.pdb # 11: usage_01382.pdb # # Length: 32 # Identity: 20/ 32 ( 62.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 32 ( 62.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 32 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00205.pdb 1 GVTKSALSTKSWLSAASFQNTTHVLTEAAIAG 32 usage_00213.pdb 1 GVTKSALSTKSWLSAASFQNTTHVLTEAAIAG 32 usage_00214.pdb 1 GVTKSALSTKSWLSAASFQNTTHVLTEAAIAG 32 usage_00517.pdb 1 GVTKSALSTKSWLSAASFQNTTHVLTEAAIAG 32 usage_00657.pdb 1 GVTKSALSTKSWLSAASFQNTTHVLTEAAIAG 32 usage_00872.pdb 1 -VTKSALSTKSWLSAASFQNTTHVLTEAAIAG 31 usage_00886.pdb 1 -VTKSALSTKSWLSAASFQNTTHVLTEAAIAG 31 usage_01026.pdb 1 -VTKSALSTKSWLSAASFQNTTHVLTEAAIAG 31 usage_01166.pdb 1 -ITKASLATESFISAASFQETTRVLTEAAVA- 30 usage_01167.pdb 1 -ITKASLATESFISAASFQETTRVLTEAAVA- 30 usage_01382.pdb 1 -VTKSALSTKSWLSAASFQNTTHVLTEAAIAG 31 TK L T S SAASFQ TT VLTEAA A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################