################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:17:48 2021 # Report_file: c_0982_40.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00046.pdb # 2: usage_00047.pdb # 3: usage_00048.pdb # 4: usage_00050.pdb # 5: usage_00052.pdb # 6: usage_00053.pdb # 7: usage_00183.pdb # 8: usage_00259.pdb # 9: usage_00260.pdb # 10: usage_00388.pdb # 11: usage_00393.pdb # 12: usage_00516.pdb # 13: usage_00808.pdb # 14: usage_00809.pdb # 15: usage_00905.pdb # 16: usage_00911.pdb # 17: usage_01022.pdb # 18: usage_01023.pdb # # Length: 49 # Identity: 31/ 49 ( 63.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 49 ( 63.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 49 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00047.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00048.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00050.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00052.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00053.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00183.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00259.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00260.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00388.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00393.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00516.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00808.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00809.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00905.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_00911.pdb 1 PVTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRA 49 usage_01022.pdb 1 PLVVSRNEQEQCLIESSVNSVRFSIRIKQVDEIERILVRKFMQFLMGRA 49 usage_01023.pdb 1 PLVVSRNEQEQCLIESSVNSVRFSIRIKQVDEIERILVRKFMQFLMGRA 49 P SRNE E LIE S NSVR SI KQ DEIE IL KFM F M RA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################