################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:23 2021 # Report_file: c_0905_145.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00501.pdb # 2: usage_00637.pdb # 3: usage_00849.pdb # 4: usage_00850.pdb # 5: usage_00851.pdb # 6: usage_00852.pdb # 7: usage_01022.pdb # 8: usage_01023.pdb # 9: usage_01024.pdb # 10: usage_01026.pdb # 11: usage_01027.pdb # 12: usage_01028.pdb # # Length: 37 # Identity: 3/ 37 ( 8.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 37 ( 43.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 37 ( 18.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00501.pdb 1 --VPIKTEE-GWLILYHGATEE---NRYVMGAALLD- 30 usage_00637.pdb 1 GFSLVSTSMGTIHIIGGGATCYG-FGSVTNVGLKLIA 36 usage_00849.pdb 1 --IPVETPE-GWLLIYHGVLHSCNGYVYSFGSALLD- 33 usage_00850.pdb 1 --IPVETPE-GWLLIYHGVLHSCNGYVYSFGSALLD- 33 usage_00851.pdb 1 --IPVETPE-GWLLIYHGVLHSCNGYVYSFGSALLD- 33 usage_00852.pdb 1 --IPVETPE-GWLLIYHGVLHSCNGYVYSFGSALLD- 33 usage_01022.pdb 1 --YPIETSE-GWLLIYHGVTLTCNGYVYSFGAALLD- 33 usage_01023.pdb 1 --YPIETSE-GWLLIYHGVTLTCNGYVYSFGAALLD- 33 usage_01024.pdb 1 --YPIETSE-GWLLIYHGVTLTCNGYVYSFGAALLD- 33 usage_01026.pdb 1 --YPIETSE-GWLLIYHGVTLTCNGYVYSFGAALLD- 33 usage_01027.pdb 1 --YPIETSE-GWLLIYHGVTLTCNGYVYSFGAALLD- 33 usage_01028.pdb 1 --YPIETSE-GWLLIYHGVTLTCNGYVYSFGAALLD- 33 p T e gwl iyhG y g alLd #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################