################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:35 2021 # Report_file: c_1394_150.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00940.pdb # 2: usage_00942.pdb # 3: usage_01136.pdb # 4: usage_01218.pdb # 5: usage_01247.pdb # # Length: 65 # Identity: 14/ 65 ( 21.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 65 ( 24.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 65 ( 23.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00940.pdb 1 ------AQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVC 54 usage_00942.pdb 1 --------TLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVC 52 usage_01136.pdb 1 ----KATKTLGIILGAFIVCWLPFFIISLVMPI---WFHLAIFDFFTWLGYLNSLINPII 53 usage_01218.pdb 1 ------LKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPII 54 usage_01247.pdb 1 LKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLI 60 TL I F W P i V Wl Y NS NP usage_00940.pdb 55 YALC- 58 usage_00942.pdb 53 YALCN 57 usage_01136.pdb 54 YTMS- 57 usage_01218.pdb 55 Y---- 55 usage_01247.pdb 61 Y---- 61 Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################