################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:40:11 2021 # Report_file: c_1045_40.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00165.pdb # 2: usage_00166.pdb # 3: usage_00167.pdb # 4: usage_00168.pdb # 5: usage_00169.pdb # 6: usage_00170.pdb # 7: usage_00439.pdb # 8: usage_00440.pdb # 9: usage_00441.pdb # 10: usage_00442.pdb # 11: usage_00443.pdb # 12: usage_00478.pdb # 13: usage_00481.pdb # 14: usage_00482.pdb # 15: usage_00696.pdb # 16: usage_00697.pdb # # Length: 43 # Identity: 40/ 43 ( 93.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 43 ( 93.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 43 ( 7.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00165.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00166.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00167.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00168.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS- 41 usage_00169.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS- 41 usage_00170.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00439.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00440.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLS- 41 usage_00441.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00442.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00443.pdb 1 GKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00478.pdb 1 -KWFVLFSHPADFTPVSTTEFVSFARRYEDFQRLGVDLIGLSV 42 usage_00481.pdb 1 GKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSV 43 usage_00482.pdb 1 GKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSV 43 usage_00696.pdb 1 GKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSV 43 usage_00697.pdb 1 GKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLS- 42 KWFVLFSHPADFTPV TTEFVSFARRYEDFQRLGVDLIGLS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################