################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:28:42 2021 # Report_file: c_1392_35.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00237.pdb # 2: usage_00238.pdb # 3: usage_00386.pdb # 4: usage_00387.pdb # 5: usage_00388.pdb # 6: usage_00389.pdb # 7: usage_00390.pdb # 8: usage_00394.pdb # 9: usage_00395.pdb # 10: usage_00794.pdb # 11: usage_00795.pdb # 12: usage_00796.pdb # 13: usage_00797.pdb # 14: usage_00835.pdb # 15: usage_00836.pdb # # Length: 40 # Identity: 32/ 40 ( 80.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 40 ( 80.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 40 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00237.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 37 usage_00238.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 37 usage_00386.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIG--- 36 usage_00387.pdb 1 DDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 38 usage_00388.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCS 39 usage_00389.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 37 usage_00390.pdb 1 DDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCS 40 usage_00394.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAAIGKCS- 38 usage_00395.pdb 1 DDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAAIGK--- 37 usage_00794.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 37 usage_00795.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 37 usage_00796.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 37 usage_00797.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 37 usage_00835.pdb 1 -DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 37 usage_00836.pdb 1 DDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGK-- 38 DAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################