################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:47 2021 # Report_file: c_1487_103.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_02191.pdb # 2: usage_03065.pdb # 3: usage_04255.pdb # 4: usage_04256.pdb # 5: usage_04258.pdb # 6: usage_04260.pdb # 7: usage_04261.pdb # # Length: 31 # Identity: 1/ 31 ( 3.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 31 ( 22.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 31 ( 32.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02191.pdb 1 --VEEILDTWYGFVGSHP------HLLYYFT 23 usage_03065.pdb 1 --DLYERFIETKRLT-E-VFAQNETLSEIYS 27 usage_04255.pdb 1 --SHMQRLIEGLQKFREGYFSSHRDLFEQLS 29 usage_04256.pdb 1 --SHMQRLIEGLQKFREGYFSSHRDLFEQLS 29 usage_04258.pdb 1 --SHMQRLIEGLQKFREGYFSSHRDLFEQLS 29 usage_04260.pdb 1 --SHMQRLIEGLQKFREGYFSSHRDLFEQLS 29 usage_04261.pdb 1 RGSHMQRLIEGLQKFREGYFSSHRDLFEQLS 31 r ie e L e s #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################