################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:11:03 2021
# Report_file: c_1260_116.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00275.pdb
#   2: usage_00322.pdb
#   3: usage_00877.pdb
#   4: usage_00878.pdb
#   5: usage_01036.pdb
#   6: usage_01037.pdb
#   7: usage_01038.pdb
#   8: usage_01122.pdb
#   9: usage_01123.pdb
#  10: usage_01261.pdb
#  11: usage_01279.pdb
#
# Length:         30
# Identity:        7/ 30 ( 23.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     13/ 30 ( 43.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 30 (  6.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00275.pdb         1  SPNRVGFDLMRIMNTRYRIDTFQKTYFVID   30
usage_00322.pdb         1  SPNRVGFDLMRIMNTRYRIDTFQKTYFVI-   29
usage_00877.pdb         1  SPNRVGFDLMRIMNTRYRIDTFQKTYFVI-   29
usage_00878.pdb         1  SPNRVGFDLMRIMNTRYRIDTFQKTYFVI-   29
usage_01036.pdb         1  SPNRVGFDLMRIMNTRYRIDTFQKTYFVI-   29
usage_01037.pdb         1  SPNRVGFDLMRIMNTRYRIDTFQKTYFVI-   29
usage_01038.pdb         1  SPNRVGFDLMRIMNTRYRIDTFQKTYFVI-   29
usage_01122.pdb         1  IPVRILFDPVVAFRMPYRIDQLQPVYFVID   30
usage_01123.pdb         1  IPVRILFDPVVAFRMPYRIDQLQPVYFVID   30
usage_01261.pdb         1  SPNRVGFDLMRIMNTRYRIDTFQKTYFVI-   29
usage_01279.pdb         1  -ACVKAFDPKTTCLQECLITTFQEAYFVS-   28
                            p r  FD        yrId  Q  YFVi 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################