################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:12:41 2021
# Report_file: c_1452_53.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00120.pdb
#   2: usage_00938.pdb
#   3: usage_01240.pdb
#   4: usage_01412.pdb
#   5: usage_01414.pdb
#   6: usage_01803.pdb
#   7: usage_01857.pdb
#   8: usage_02922.pdb
#   9: usage_03576.pdb
#  10: usage_03577.pdb
#  11: usage_03600.pdb
#  12: usage_05524.pdb
#
# Length:         32
# Identity:        9/ 32 ( 28.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     23/ 32 ( 71.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 32 (  6.2%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00120.pdb         1  GGINTEENYPYTAQDGECNVDLQNEKYVTID-   31
usage_00938.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
usage_01240.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
usage_01412.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
usage_01414.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
usage_01803.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
usage_01857.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
usage_02922.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
usage_03576.pdb         1  GGIEADASYPYKAMDEKCHYNSKNRAA-TCSR   31
usage_03577.pdb         1  GGIEADASYPYKAMDEKCHYNSKNRAA-TCSR   31
usage_03600.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
usage_05524.pdb         1  KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK   31
                            GI  dasYPYkAmD kC y sk raa Tcs 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################