################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:08:10 2021
# Report_file: c_1192_22.html
################################################################################################
#====================================
# Aligned_structures: 4
#   1: usage_00265.pdb
#   2: usage_00898.pdb
#   3: usage_00899.pdb
#   4: usage_00900.pdb
#
# Length:         74
# Identity:       31/ 74 ( 41.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     55/ 74 ( 74.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           19/ 74 ( 25.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00265.pdb         1  SGMEVVLANGELLRTGMGALPDPKRPETMGLKPEDQPWSKIAHLFPYGFGPYIDGLFSQS   60
usage_00898.pdb         1  CGMEVVLANGDVYRTGMGGVPG----------------SNTWQIFKWGYGPTLDGMFTQA   44
usage_00899.pdb         1  CGMEVVLANGDVYRTGMGGVPG----------------SNTWQIFKWGYGPTLDGMFTQA   44
usage_00900.pdb         1  CGMEVVLANGDVYRTGMGGVPG----------------SNTWQIFKWGYGPTLDGMFTQA   44
                           cGMEVVLANGdvyRTGMGgvPg                SntwqiFkwGyGPtlDGmFtQa

usage_00265.pdb        61  NMGIVTKIGIW---   71
usage_00898.pdb        45  NYGICTKMGFWLMP   58
usage_00899.pdb        45  NYGICTKMGFWLMP   58
usage_00900.pdb        45  NYGICTKMGFWLMP   58
                           NyGIcTKmGfW   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################