################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:54 2021 # Report_file: c_1221_137.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00498.pdb # 2: usage_00520.pdb # 3: usage_01584.pdb # 4: usage_01587.pdb # 5: usage_01588.pdb # 6: usage_01589.pdb # 7: usage_01594.pdb # 8: usage_02001.pdb # # Length: 31 # Identity: 3/ 31 ( 9.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 31 ( 67.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 31 ( 16.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00498.pdb 1 --TL-VFPNG-RTQSGYS-PPQLEEIIRKNQ 26 usage_00520.pdb 1 RAVWVDGKARTAWVDSGAQLGELYYAIYKAS 31 usage_01584.pdb 1 RAVWVDGKARTAWVDSGAQLGELYYAIYKAS 31 usage_01587.pdb 1 RAVWVDGKARTAWVDSGAQLGELYYAIYKAS 31 usage_01588.pdb 1 RAVWVDGKARTAWVDSGAQLGELYYAIYKAS 31 usage_01589.pdb 1 RAVWVDGKARTAWVDSGAQLGELYYAIYKAS 31 usage_01594.pdb 1 RAVWVDGKARTAWVDSGAQLGELYYAIYKAS 31 usage_02001.pdb 1 RAVSIDGKAATAWVDSGAQLGDLYYGIAKAS 31 v dgka awvdsga lg Lyy I Kas #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################