################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:23 2021 # Report_file: c_0680_59.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00964.pdb # 2: usage_00965.pdb # 3: usage_00966.pdb # 4: usage_00967.pdb # 5: usage_01340.pdb # 6: usage_01341.pdb # 7: usage_01342.pdb # 8: usage_01343.pdb # # Length: 63 # Identity: 54/ 63 ( 85.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 54/ 63 ( 85.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 63 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00964.pdb 1 --------PWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY 52 usage_00965.pdb 1 --------PWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY 52 usage_00966.pdb 1 GLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY 60 usage_00967.pdb 1 --------PWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY 52 usage_01340.pdb 1 GLAIVPEQPWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY 60 usage_01341.pdb 1 --------PWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY 52 usage_01342.pdb 1 --------PWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY 52 usage_01343.pdb 1 --------PWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY 52 PWDWSEFTSASLYFDIVSVGDHSTQFYLDVTDQNGAVFTRSIDIPVGKMQSY usage_00964.pdb 53 YAK 55 usage_00965.pdb 53 YAK 55 usage_00966.pdb 61 YAK 63 usage_00967.pdb 53 YA- 54 usage_01340.pdb 61 YAK 63 usage_01341.pdb 53 YA- 54 usage_01342.pdb 53 YAK 55 usage_01343.pdb 53 YAK 55 YA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################