################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:08 2021 # Report_file: c_1076_93.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00113.pdb # 2: usage_00168.pdb # 3: usage_00414.pdb # 4: usage_00421.pdb # 5: usage_00563.pdb # 6: usage_00564.pdb # 7: usage_00672.pdb # 8: usage_00860.pdb # 9: usage_01345.pdb # 10: usage_01615.pdb # # Length: 59 # Identity: 16/ 59 ( 27.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 59 ( 78.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 59 ( 18.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00113.pdb 1 -TDESIKGLCERGRKNILLVPIAATSDHIETLYELDIEYSQVLAKECG-VENIRRA--- 54 usage_00168.pdb 1 QTDESIKGLCERGRKNILLVPIAFTSDHIKTLYELDIEYSQVLAKECG-VENIRRA--- 55 usage_00414.pdb 1 QTDESIKGLCERGRKNILLVPIAFTSDHIDTLYELDIEYSQVLAKECG-VENIRRA--- 55 usage_00421.pdb 1 QTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECG-VENIRR---- 54 usage_00563.pdb 1 -TDESIKGLCERGRKNILLVPIAFTSDHIKTLYELDIEYSQVLAKECG-VENIRRA--- 54 usage_00564.pdb 1 QTDESIKGLCERGRKNILLVPIAFTSDHIKTLYELDIEYSQVLAKECG-VENIRR---- 54 usage_00672.pdb 1 QTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECG-VENIRRAESL 58 usage_00860.pdb 1 -TAEIAEFLGP-KVDGLMFIPIAFTSDHIETLHEIDLGVIGES----EYKDKFKRCES- 52 usage_01345.pdb 1 QTDESIKGLCERGRKNILLVPIARTSDHIETLYELDIEYSQVLAKECG-VENIRRA--- 55 usage_01615.pdb 1 QTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECG-VENIRRA--- 55 TdEsikgLce grknillvPIA TSDHI TLyElDieysqvl g venirR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################