################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:14:24 2021 # Report_file: c_1442_626.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00623.pdb # 2: usage_00970.pdb # 3: usage_00971.pdb # 4: usage_02213.pdb # 5: usage_06534.pdb # 6: usage_06535.pdb # 7: usage_07792.pdb # 8: usage_07793.pdb # 9: usage_08653.pdb # 10: usage_08654.pdb # 11: usage_18561.pdb # 12: usage_18562.pdb # 13: usage_18563.pdb # 14: usage_18564.pdb # # Length: 32 # Identity: 2/ 32 ( 6.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 32 ( 9.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 32 ( 15.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00623.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRLALH-- 30 usage_00970.pdb 1 SKKSFDRTWVIVPMNNSVIIASDLLTV----- 27 usage_00971.pdb 1 SKKSFDRTWVIVPMNNSVIIASDLLTV----- 27 usage_02213.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRLALH-- 30 usage_06534.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRL----- 27 usage_06535.pdb 1 NPQRFSQVFHLIPDGNSYYVFNDIFRLNYS-- 30 usage_07792.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRLALHNF 32 usage_07793.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRL----- 27 usage_08653.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRL----- 27 usage_08654.pdb 1 PIMGFHQMFLLKNINDAWVCTNDEFRL----- 27 usage_18561.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRL----- 27 usage_18562.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRL----- 27 usage_18563.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRL----- 27 usage_18564.pdb 1 PIMGFHQMFLLKNINDAWVCTNDMFRL----- 27 F n D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################