################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:22 2021 # Report_file: c_1480_230.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00200.pdb # 2: usage_01491.pdb # 3: usage_01492.pdb # 4: usage_01493.pdb # 5: usage_01620.pdb # 6: usage_02163.pdb # 7: usage_02707.pdb # 8: usage_03073.pdb # 9: usage_03074.pdb # 10: usage_03075.pdb # 11: usage_03076.pdb # # Length: 40 # Identity: 11/ 40 ( 27.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 40 ( 35.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 40 ( 27.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00200.pdb 1 DEEGILKFLCDEHDFSEERVKNGLERLKKAIKSGKQSTL- 39 usage_01491.pdb 1 -EEELIKFMCGEKQFSEERIRSGVKRLSKSR--------- 30 usage_01492.pdb 1 --EELIKFMCGEKQFSEERIRSGVKRLSKSRQG------- 31 usage_01493.pdb 1 -EEELIKFMCGEKQFSEERIRSGVKRLSKSRQ-------- 31 usage_01620.pdb 1 -GEDIINILVYEHNFSEERVKNGIERLTKAIKEAKGASRQ 39 usage_02163.pdb 1 --EGILKFLCDEHNFSEERVKNGIERLKKAIKAGR----- 33 usage_02707.pdb 1 -EEELIKFMCGEKQFSEERIRSGVKRLSKSRQGS------ 33 usage_03073.pdb 1 -EEELIKFMCGEKQFSEERIRSGVKRLSKSRQGS------ 33 usage_03074.pdb 1 -EEELIKFMCGEKQFSEERIRSGVKRLSKSRQGS------ 33 usage_03075.pdb 1 -EEELIKFMCGEKQFSEERIRSGVKRLSKSRQG------- 32 usage_03076.pdb 1 -EEELIKFMCGEKQFSEERIRSGVKRLSKSRQ-------- 31 E kf c E FSEER G RL K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################