################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:02:53 2021 # Report_file: c_0959_35.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00119.pdb # 2: usage_00125.pdb # 3: usage_00129.pdb # 4: usage_00339.pdb # 5: usage_00465.pdb # 6: usage_00981.pdb # 7: usage_00982.pdb # 8: usage_00983.pdb # 9: usage_00984.pdb # 10: usage_01013.pdb # 11: usage_01022.pdb # 12: usage_01161.pdb # 13: usage_01278.pdb # # Length: 45 # Identity: 8/ 45 ( 17.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 45 ( 26.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 45 ( 17.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00119.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAA 39 usage_00125.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG-- 37 usage_00129.pdb 1 -----VELKDLANVLSFGEAKLGDNGQKFNFLFHTASSNVWVP-- 38 usage_00339.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG-- 37 usage_00465.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG-- 37 usage_00981.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG-- 37 usage_00982.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG-- 37 usage_00983.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG-- 37 usage_00984.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG-- 37 usage_01013.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVG-- 37 usage_01022.pdb 1 ------ELDDVANLMFYGEGQIGTNKQPFMFIFDTGSANLWVP-- 37 usage_01161.pdb 1 NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVP-- 43 usage_01278.pdb 1 ------NLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAA 39 L y E G Q dTgSsN V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################