################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:36:32 2021 # Report_file: c_0470_9.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00064.pdb # 2: usage_00076.pdb # 3: usage_00367.pdb # 4: usage_00465.pdb # 5: usage_00466.pdb # 6: usage_00490.pdb # 7: usage_00618.pdb # # Length: 82 # Identity: 4/ 82 ( 4.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 82 ( 11.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 82 ( 19.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00064.pdb 1 ---GIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGM 57 usage_00076.pdb 1 ---SIAVGSTGNLGLSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQ--DY 55 usage_00367.pdb 1 ---GVVTHSSGNHAAAVALAAKLRGIPAHIVIP--AP-SKVENVKCYGGHIIWS-D---- 49 usage_00465.pdb 1 EKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDM--NY 58 usage_00466.pdb 1 EKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDM--NY 58 usage_00490.pdb 1 --ATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIF-----SS 53 usage_00618.pdb 1 -KMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDM--NY 57 GN g a G mp G usage_00064.pdb 58 KGAVEKALEISRETGAHML-N- 77 usage_00076.pdb 56 GVAVEEGRKAAQSDPNCFFI-- 75 usage_00367.pdb 50 ESREYVSKRVQEETGAVLI-HP 70 usage_00465.pdb 59 DDTVRLTMQHAQQHGWEVV-QD 79 usage_00466.pdb 59 DDTVRLTMQHAQQHGWEVV-QD 79 usage_00490.pdb 54 NTAVATAKELAATNPSWVM-LY 74 usage_00618.pdb 58 DDTVRLTMQHAQQHGWEVV-QD 78 v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################