################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:23:16 2021 # Report_file: c_0428_14.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00087.pdb # 2: usage_00088.pdb # 3: usage_00167.pdb # 4: usage_00168.pdb # 5: usage_00203.pdb # 6: usage_00204.pdb # 7: usage_00205.pdb # 8: usage_00206.pdb # 9: usage_00207.pdb # 10: usage_00305.pdb # # Length: 70 # Identity: 63/ 70 ( 90.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/ 70 ( 90.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 70 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00087.pdb 1 -MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 59 usage_00088.pdb 1 -MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 59 usage_00167.pdb 1 -MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 59 usage_00168.pdb 1 -MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 59 usage_00203.pdb 1 -MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 59 usage_00204.pdb 1 GMKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 60 usage_00205.pdb 1 -MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 59 usage_00206.pdb 1 -MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQ---LCLTGGNAGVIAE 56 usage_00207.pdb 1 ----GIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 56 usage_00305.pdb 1 ----GIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAE 56 GIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQ LCLTGGNAGVIAE usage_00087.pdb 60 NINIPAQIFV 69 usage_00088.pdb 60 NINIPAQIFV 69 usage_00167.pdb 60 NINIPAQIFV 69 usage_00168.pdb 60 NINIPAQIFV 69 usage_00203.pdb 60 NINIPAQIFV 69 usage_00204.pdb 61 NINIPAQIFV 70 usage_00205.pdb 60 NINIPAQIFV 69 usage_00206.pdb 57 NINIPAQIFV 66 usage_00207.pdb 57 NINIPAQIFV 66 usage_00305.pdb 57 NINIPAQIFV 66 NINIPAQIFV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################