################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:23 2021 # Report_file: c_1262_84.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_01328.pdb # 2: usage_01329.pdb # 3: usage_01330.pdb # 4: usage_01331.pdb # 5: usage_01332.pdb # 6: usage_01333.pdb # 7: usage_01334.pdb # 8: usage_01335.pdb # 9: usage_02085.pdb # 10: usage_02086.pdb # 11: usage_02087.pdb # 12: usage_02088.pdb # # Length: 46 # Identity: 39/ 46 ( 84.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 46 ( 84.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 46 ( 15.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01328.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLRM- 45 usage_01329.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLR-- 44 usage_01330.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLR-- 44 usage_01331.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLR-- 44 usage_01332.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLRM- 45 usage_01333.pdb 1 KVIMYAPTWRDDEFVSK---LFELKIDLDNLYKELGDDYVILLRM- 42 usage_01334.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLRM- 45 usage_01335.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLR-- 44 usage_02085.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLRM- 45 usage_02086.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLRM- 45 usage_02087.pdb 1 KVIMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLR-- 44 usage_02088.pdb 1 KVIMYAPTWRDDEFV----YLFELKIDLDNLYKELGDDYVILLRMH 42 KVIMYAPTWRDDEFV LFELKIDLDNLYKELGDDYVILLR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################