################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:27:07 2021 # Report_file: c_1038_24.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00065.pdb # 2: usage_00066.pdb # 3: usage_00067.pdb # 4: usage_00159.pdb # 5: usage_00291.pdb # 6: usage_00345.pdb # 7: usage_00346.pdb # 8: usage_00347.pdb # 9: usage_00348.pdb # 10: usage_00349.pdb # 11: usage_00350.pdb # 12: usage_00351.pdb # 13: usage_00352.pdb # 14: usage_00376.pdb # 15: usage_00443.pdb # # Length: 44 # Identity: 17/ 44 ( 38.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 44 ( 59.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 44 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00065.pdb 1 WLVIYFYPKDSTPGSTTEGLDFNALLPEFDKAGAKILGVSR--- 41 usage_00066.pdb 1 WLVIYFYPKDSTPGATTEGLDFNALLPEFDKAGAKILG------ 38 usage_00067.pdb 1 WLVIYFYPK----GATTEGLDFNALLPEFDKAGAKILGVSR--- 37 usage_00159.pdb 1 WLVLYFYPKDNTPGSSTEGLEFNLLLPQFEQINATVLGVSR--- 41 usage_00291.pdb 1 KLVLYFYPKDNTPGCTTEGLQFRELYPKFKKAGAEIIGVSR--- 41 usage_00345.pdb 1 WLVIYFYPKDSTP-GTTEGLDFNALLPEFDKAGAKILGVSR--- 40 usage_00346.pdb 1 WLVIYFYPKDSTP-GTTEGLDFNALLPEFDKAGAKILGVSR--- 40 usage_00347.pdb 1 WLVIYFYPKDSTP-GTTEGLDFNALLPEFDKAGAKILG------ 37 usage_00348.pdb 1 WLVIYFYPKDSTP-GTTEGLDFNALLPEFDKAGAKILGVSR--- 40 usage_00349.pdb 1 WLVIYFYPKDSTP-GTTEGLDFNALLPEFDKAGAKILGVSR--- 40 usage_00350.pdb 1 WLVIYFYPKDSTP-GTTEGLDFNALLPEFDKAGAKILGVSR--- 40 usage_00351.pdb 1 WLVIYFYPKDSTPGSTTEGLDFNALLPEFDKAGAKILG------ 38 usage_00352.pdb 1 WLVIYFYPKDSTPGCTTEGLDFNALLPEFDKAGAKILGVSRDSV 44 usage_00376.pdb 1 WLVIYFYPKDSTPGCTTEGLDFNALLPEFDKAGAKILGVSRDSV 44 usage_00443.pdb 1 WLVIYFYPKDSTP-GTTEGLDFNALLPEFDKAGAKILGVSR--- 40 wLV YFYPK tTEGL Fn LlP F kagA ilG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################