################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:03:50 2021
# Report_file: c_1219_54.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00528.pdb
#   2: usage_00530.pdb
#   3: usage_00704.pdb
#   4: usage_00705.pdb
#   5: usage_01316.pdb
#   6: usage_01317.pdb
#   7: usage_01319.pdb
#   8: usage_01381.pdb
#   9: usage_01596.pdb
#  10: usage_01597.pdb
#  11: usage_02078.pdb
#  12: usage_02081.pdb
#  13: usage_02083.pdb
#
# Length:         33
# Identity:        7/ 33 ( 21.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      7/ 33 ( 21.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            3/ 33 (  9.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00528.pdb         1  ---IITVNVNGKAQEKAVEPRTLLIHFLREELN   30
usage_00530.pdb         1  ---IITVNVNGKAQEKAVEPRTLLIHFLREELN   30
usage_00704.pdb         1  QLMRISATINGKPRVFYVEPRMHLADALREVVG   33
usage_00705.pdb         1  QLMRISATINGKPRVFYVEPRMHLADALREVVG   33
usage_01316.pdb         1  ---HIELTINGHPVEALVEPRTLLIHFIREQQN   30
usage_01317.pdb         1  ---HIELTINGHPVEALVEPRTLLIHFIREQQN   30
usage_01319.pdb         1  ---HIELTINGHPVEALVEPRTLLIHFIREQQN   30
usage_01381.pdb         1  ---HIELTINGHPVEALVEPRTLLIHFIREQQN   30
usage_01596.pdb         1  ---PLTLKVNGKTEQLEVDTRTTLLDTLRENLH   30
usage_01597.pdb         1  ---PLTLKVNGKTEQLEVDTRTTLLDTLRENLH   30
usage_02078.pdb         1  ---HIELTINGHPVEALVEPRTLLIHFIREQQN   30
usage_02081.pdb         1  ---HIELTINGHPVEALVEPRTLLIHFIREQQN   30
usage_02083.pdb         1  ---HIELTINGHPVEALVEPRTLLIHFIREQQN   30
                                    NG      V  R  L    RE   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################