################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:18:55 2021 # Report_file: c_1368_112.html ################################################################################################ #==================================== # Aligned_structures: 19 # 1: usage_00161.pdb # 2: usage_00162.pdb # 3: usage_00250.pdb # 4: usage_01013.pdb # 5: usage_01014.pdb # 6: usage_01019.pdb # 7: usage_01020.pdb # 8: usage_01021.pdb # 9: usage_01022.pdb # 10: usage_01122.pdb # 11: usage_01233.pdb # 12: usage_01256.pdb # 13: usage_01257.pdb # 14: usage_01258.pdb # 15: usage_01259.pdb # 16: usage_01444.pdb # 17: usage_01459.pdb # 18: usage_01548.pdb # 19: usage_01594.pdb # # Length: 34 # Identity: 31/ 34 ( 91.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 34 ( 94.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 34 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00161.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_00162.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_00250.pdb 1 DRENMWRTWINVFFETFGSHKAVTRAGQAARATS 34 usage_01013.pdb 1 -RENMWRTGINVFFETFGSHKAVTRAGQAARAT- 32 usage_01014.pdb 1 -RENMWRTGINVFFETFGSHKAVTRAGQAARATS 33 usage_01019.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01020.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01021.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01022.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01122.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01233.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01256.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01257.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01258.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01259.pdb 1 -RENMWRTGINVFFETFGSHKAVTRAGQAARATS 33 usage_01444.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01459.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 usage_01548.pdb 1 -RENMWRTGINVFFETFGSHKAVTRAGQAARATS 33 usage_01594.pdb 1 DRENMWRTGINVFFETFGSHKAVTRAGQAARATS 34 RENMWRTgINVFFETFGSHKAVTRAGQAARAT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################