################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:07 2021 # Report_file: c_1070_20.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00029.pdb # 2: usage_00030.pdb # 3: usage_00191.pdb # 4: usage_00192.pdb # 5: usage_00612.pdb # 6: usage_00613.pdb # 7: usage_00614.pdb # 8: usage_00615.pdb # 9: usage_00978.pdb # 10: usage_00979.pdb # # Length: 61 # Identity: 26/ 61 ( 42.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 61 ( 42.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/ 61 ( 42.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00029.pdb 1 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDI 60 usage_00030.pdb 1 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDI 60 usage_00191.pdb 1 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDI 60 usage_00192.pdb 1 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDI 60 usage_00612.pdb 1 -------LKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDL 53 usage_00613.pdb 1 SQEVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQY------------------ 42 usage_00614.pdb 1 ---VEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDL 57 usage_00615.pdb 1 ---VEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDL 57 usage_00978.pdb 1 -AEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQY------------------ 41 usage_00979.pdb 1 EAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQY------------------ 42 LKR QS KGV G IVVN EGIP KST DN TT QY usage_00029.pdb 61 D 61 usage_00030.pdb 61 D 61 usage_00191.pdb 61 D 61 usage_00192.pdb 61 D 61 usage_00612.pdb 54 D 54 usage_00613.pdb - usage_00614.pdb 58 D 58 usage_00615.pdb 58 D 58 usage_00978.pdb - usage_00979.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################