################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:57 2021 # Report_file: c_1432_18.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00378.pdb # 2: usage_00570.pdb # 3: usage_00582.pdb # 4: usage_00583.pdb # 5: usage_00607.pdb # 6: usage_00608.pdb # 7: usage_01097.pdb # 8: usage_01107.pdb # 9: usage_01108.pdb # 10: usage_01109.pdb # 11: usage_01110.pdb # 12: usage_01111.pdb # 13: usage_01112.pdb # 14: usage_01320.pdb # # Length: 45 # Identity: 4/ 45 ( 8.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 45 ( 26.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 45 ( 17.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00378.pdb 1 -MLDAIRRAVMVSNILLINKVNE-KSLTLKEVFRLATLGGSQALG 43 usage_00570.pdb 1 -PWVSIDAAVNRY----V--VDPGERVSREEALHLYTHGSAQVTL 38 usage_00582.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_00583.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_00607.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_00608.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_01097.pdb 1 SMLDAIRRAVMVSNILLINKVNE-KSLTLKEVFRLATLGGSQALG 44 usage_01107.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_01108.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_01109.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_01110.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_01111.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_01112.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 usage_01320.pdb 1 NLLGDLRLAALAHRPADP--NEPEKWLSARELLRMATRGSAECLG 43 l r A k l E r aT G lg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################