################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:28 2021 # Report_file: c_0746_1.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00012.pdb # 2: usage_00016.pdb # 3: usage_00045.pdb # 4: usage_00067.pdb # 5: usage_00068.pdb # 6: usage_00069.pdb # 7: usage_00070.pdb # 8: usage_00071.pdb # # Length: 64 # Identity: 8/ 64 ( 12.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 64 ( 25.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 64 ( 10.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 --DWLLNEGKCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLDELEFIQNSLKPGH--FGW 56 usage_00016.pdb 1 KVYWFCYGMKCYYFVMDRKTWSGCKQTCQSSSLSLLKIDDEDELKFLQLVVPSDS--CWV 58 usage_00045.pdb 1 --NWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYW 58 usage_00067.pdb 1 --DWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSS--FPF 56 usage_00068.pdb 1 --DWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSS--FPF 56 usage_00069.pdb 1 --DWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSS--FPF 56 usage_00070.pdb 1 --DWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSS--FPF 56 usage_00071.pdb 1 --DWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSS--FPF 56 W g CY f W s C a Ll I l Fiq usage_00012.pdb 57 -I-- 57 usage_00016.pdb 59 -G-- 59 usage_00045.pdb 59 VG-- 60 usage_00067.pdb 57 -WMG 59 usage_00068.pdb 57 -WMG 59 usage_00069.pdb 57 -WMG 59 usage_00070.pdb 57 -WG- 58 usage_00071.pdb 57 -WMG 59 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################