################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:36:22 2021 # Report_file: c_0413_1.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00036.pdb # 2: usage_00041.pdb # 3: usage_00042.pdb # 4: usage_00043.pdb # 5: usage_00044.pdb # 6: usage_00045.pdb # 7: usage_00046.pdb # # Length: 65 # Identity: 24/ 65 ( 36.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 59/ 65 ( 90.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 65 ( 9.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00036.pdb 1 -----NVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEG 55 usage_00041.pdb 1 MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60 usage_00042.pdb 1 MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60 usage_00043.pdb 1 -IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 59 usage_00044.pdb 1 MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60 usage_00045.pdb 1 -IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 59 usage_00046.pdb 1 MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEG 60 NiTKvfhqGtrtIqALnNVsLhvpaGqiygviGaSGaGKSTlircvnlLerPTEG usage_00036.pdb 56 EVYI- 59 usage_00041.pdb 61 SVLVD 65 usage_00042.pdb 61 SVLV- 64 usage_00043.pdb 60 SVLVD 64 usage_00044.pdb 61 SVLVD 65 usage_00045.pdb 60 SVLVD 64 usage_00046.pdb 61 SVLVD 65 sVlv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################