################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:30 2021 # Report_file: c_1261_285.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_02117.pdb # 2: usage_02327.pdb # 3: usage_02328.pdb # 4: usage_02329.pdb # 5: usage_02330.pdb # 6: usage_02332.pdb # 7: usage_02639.pdb # 8: usage_02640.pdb # 9: usage_02641.pdb # 10: usage_02642.pdb # 11: usage_02643.pdb # 12: usage_03141.pdb # # Length: 43 # Identity: 11/ 43 ( 25.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 43 ( 81.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 43 ( 18.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02117.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02327.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02328.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02329.pdb 1 ---PVIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 36 usage_02330.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02332.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02639.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02640.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02641.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02642.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_02643.pdb 1 ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV 35 usage_03141.pdb 1 RPVGIVANQPMQFAGCLDITASEKAARFVRTCDAFNVPVLTFV 43 vikinsnQr yat nSEtAgfFrhlCqdseVPVqsFV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################