################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:59 2021 # Report_file: c_1056_38.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00322.pdb # 2: usage_00617.pdb # 3: usage_00618.pdb # 4: usage_00633.pdb # 5: usage_00634.pdb # 6: usage_00635.pdb # 7: usage_00636.pdb # 8: usage_00637.pdb # 9: usage_00638.pdb # 10: usage_00794.pdb # 11: usage_00795.pdb # # Length: 46 # Identity: 19/ 46 ( 41.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 46 ( 50.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 46 ( 13.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00322.pdb 1 -LGDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYP 45 usage_00617.pdb 1 LLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFY- 45 usage_00618.pdb 1 -LDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCV--ATFY--- 40 usage_00633.pdb 1 LLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFY- 45 usage_00634.pdb 1 LLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFY- 45 usage_00635.pdb 1 LLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFY- 45 usage_00636.pdb 1 LLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFY- 45 usage_00637.pdb 1 LLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFY- 45 usage_00638.pdb 1 -LDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFY- 44 usage_00794.pdb 1 LLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFY- 45 usage_00795.pdb 1 LLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYP 46 LdDFV KS DL V SKV V ID MLWCk v t #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################