################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:00:43 2021 # Report_file: c_0964_6.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00243.pdb # 2: usage_00494.pdb # 3: usage_00662.pdb # 4: usage_00663.pdb # 5: usage_00664.pdb # 6: usage_00665.pdb # 7: usage_00698.pdb # 8: usage_00699.pdb # 9: usage_00700.pdb # 10: usage_00701.pdb # 11: usage_00702.pdb # 12: usage_00703.pdb # 13: usage_00704.pdb # 14: usage_00705.pdb # 15: usage_00706.pdb # 16: usage_00707.pdb # 17: usage_00817.pdb # 18: usage_00821.pdb # # Length: 44 # Identity: 3/ 44 ( 6.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 44 ( 18.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 44 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00243.pdb 1 IQVSGKYK-----WYLKKLVFVTDKGRYLSFGKDSGTSFNAVP- 38 usage_00494.pdb 1 -QVSGKYK-----WYLKKLVFVTDKGRYLSFGKDSGTSFNAVP- 37 usage_00662.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00663.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00664.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00665.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00698.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00699.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00700.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00701.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00702.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNI--- 41 usage_00703.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIK-- 42 usage_00704.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00705.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIK-- 42 usage_00706.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00707.pdb 1 IEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIP 44 usage_00817.pdb 1 -SISGTYGNYKGFEVLTSLSFITNVTKHGPFGIASGTSFSR--- 40 usage_00821.pdb 1 ---DVIANG---PEAIDRIVFHFSDDRTFVVGENSGKPSVR-LQ 37 sg F t G Gt f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################