################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:58 2021 # Report_file: c_1261_282.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_01267.pdb # 2: usage_01269.pdb # 3: usage_01273.pdb # 4: usage_01274.pdb # 5: usage_01276.pdb # 6: usage_01278.pdb # 7: usage_01282.pdb # 8: usage_01284.pdb # 9: usage_01286.pdb # 10: usage_01287.pdb # 11: usage_01288.pdb # 12: usage_01290.pdb # 13: usage_01911.pdb # # Length: 30 # Identity: 11/ 30 ( 36.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 30 ( 96.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 30 ( 3.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01267.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01269.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01273.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01274.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01276.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01278.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01282.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01284.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01286.pdb 1 -AVVIGAGVTGIYQAFLINQAGMKVLGIEA 29 usage_01287.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01288.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01290.pdb 1 DAVVIGAGVTGIYQAFLINQAGMKVLGIEA 30 usage_01911.pdb 1 PAVVIGTGYGAAVSALRLGEAGVQTLMLEM 30 AVVIGaGvtgiyqAflinqAGmkvLgiEa #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################