################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:37 2021 # Report_file: c_1171_63.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00075.pdb # 2: usage_00214.pdb # 3: usage_00856.pdb # 4: usage_01609.pdb # 5: usage_01675.pdb # 6: usage_01757.pdb # 7: usage_01758.pdb # 8: usage_01762.pdb # # Length: 33 # Identity: 0/ 33 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 33 ( 21.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 33 ( 33.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00075.pdb 1 QPYIAPIVKSRELFSSNDRNCIHSEFDLS---- 29 usage_00214.pdb 1 DPIL-LMKSARNSCWSKDAEYGLYSIYQGGIFE 32 usage_00856.pdb 1 DPIL-LMKSARNSCWSKDAEYGLYSIYQGG--- 29 usage_01609.pdb 1 SSHN-LMKGGSTKNWSGNSEFHFYSINVGG--- 29 usage_01675.pdb 1 SSHN-LMKGGSTKNWSGNSEFHFYSINVGG--- 29 usage_01757.pdb 1 DPIL-LMKSARNSC------YGLYSIYQGG--- 23 usage_01758.pdb 1 DPIL-LMKSARNSC------YGLYSIYQGG--- 23 usage_01762.pdb 1 DPIL-LMKSARNSCWSKDAEYGLYSIYQGG--- 29 lmk ysi g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################