################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:41:58 2021 # Report_file: c_0701_83.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00869.pdb # 2: usage_00870.pdb # 3: usage_00871.pdb # 4: usage_00872.pdb # 5: usage_01092.pdb # 6: usage_01093.pdb # 7: usage_01448.pdb # # Length: 75 # Identity: 50/ 75 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 75 ( 74.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 75 ( 25.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00869.pdb 1 -LTSGYCWFDYERDICRIDGLFNPWSERDTGYRLWMSEVGNAASGRTWKQKVAYGRERTA 59 usage_00870.pdb 1 QLTSGYCWFDYERDICRIDGLFNPWSERDTGYRLWMSEVGNAASGRTWKQKVAYGR---- 56 usage_00871.pdb 1 QLTSGYCWFDYERDICRIDGLFNPWSERDTGYRLWMSEVGNAASGRTWKQKVAYGRE--G 58 usage_00872.pdb 1 -LTSGYCWFDYERDICRIDGLFNPWSERDTGYRLWMSEVGNAASGRTWKQKVAYGRERTA 59 usage_01092.pdb 1 -LTSGYCWFDYERDICRIDGLFNPWSERDTGYRLWMSEVGNAASGRTWKQKVAYGRERTA 59 usage_01093.pdb 1 QLTSGYCWFDYERDICRIDGLFNPWSERDTGYRLWMSEVGNAASGRTWKQKVAYGRERTA 60 usage_01448.pdb 1 -LTSGYCWFDYERDICRIDGLFNP-----TGYRLWMSEVGNAASGRTWKQKVAYGRERTG 54 LTSGYCWFDYERDICRIDGLFNP TGYRLWMSEVGNAASGRTWKQKVAYGR usage_00869.pdb 60 LGEQLCERP------ 68 usage_00870.pdb 57 --EQLCERP------ 63 usage_00871.pdb 59 --EQLCERP------ 65 usage_00872.pdb 60 E-QLCERP------- 66 usage_01092.pdb 60 LGEQLCERP------ 68 usage_01093.pdb 61 LGEQLCERPLDDETG 75 usage_01448.pdb 55 --EQLCERP------ 61 eqlcer #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################