################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:57 2021 # Report_file: c_1292_22.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00374.pdb # 2: usage_00648.pdb # 3: usage_00649.pdb # 4: usage_00995.pdb # 5: usage_01324.pdb # 6: usage_01346.pdb # 7: usage_01636.pdb # # Length: 68 # Identity: 51/ 68 ( 75.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 68 ( 75.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 68 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00374.pdb 1 IAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLP 60 usage_00648.pdb 1 IAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVE---------------ELPYPKTFVLP 45 usage_00649.pdb 1 IAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVE---------------ELPYPKTFVLP 45 usage_00995.pdb 1 IAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVE---------------ELPYPKTFVLP 45 usage_01324.pdb 1 IAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVE---------------ELPYPKTFVLP 45 usage_01346.pdb 1 -AQLVWYAQWLVIWTVVLLYLRREDRREGYPLVE--------PEDGQVYELPYPKTFVLP 51 usage_01636.pdb 1 IAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLP 60 AQLVWYAQWLVIWTVVLLYLRREDRREGYPLVE ELPYPKTFVLP usage_00374.pdb 61 HGGTVTVP 68 usage_00648.pdb 46 HGGTVTV- 52 usage_00649.pdb 46 HGGTVTV- 52 usage_00995.pdb 46 HGGTVTVP 53 usage_01324.pdb 46 HGGTVTV- 52 usage_01346.pdb 52 HGGTVTVP 59 usage_01636.pdb 61 HGGTVTVP 68 HGGTVTV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################