################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:54:32 2021
# Report_file: c_1319_115.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00237.pdb
#   2: usage_00607.pdb
#   3: usage_00608.pdb
#   4: usage_00612.pdb
#   5: usage_00765.pdb
#   6: usage_00773.pdb
#   7: usage_00806.pdb
#   8: usage_01122.pdb
#   9: usage_01939.pdb
#  10: usage_01940.pdb
#  11: usage_02293.pdb
#  12: usage_02411.pdb
#
# Length:         34
# Identity:        4/ 34 ( 11.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      9/ 34 ( 26.5%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           12/ 34 ( 35.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00237.pdb         1  LPISRLYARYFQGDLKLYSMEGVGTDAVIYLKAL   34
usage_00607.pdb         1  LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   32
usage_00608.pdb         1  LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   32
usage_00612.pdb         1  LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   32
usage_00765.pdb         1  LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   32
usage_00773.pdb         1  LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   32
usage_00806.pdb         1  -PTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   31
usage_01122.pdb         1  --------KYFQGDLQLFSMEGFGTDAVIYLK--   24
usage_01939.pdb         1  LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   32
usage_01940.pdb         1  LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   32
usage_02293.pdb         1  MDVVKNVVESLNGSMGIESEKDKGTKVTIR----   30
usage_02411.pdb         1  LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR--   32
                                    y  G l l S  g GTd        


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################