################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:16:29 2021
# Report_file: c_0679_32.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00142.pdb
#   2: usage_00143.pdb
#   3: usage_00310.pdb
#   4: usage_00582.pdb
#   5: usage_00644.pdb
#
# Length:         62
# Identity:       25/ 62 ( 40.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     33/ 62 ( 53.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           15/ 62 ( 24.2%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00142.pdb         1  ------------GTNVGSRFYLMN--GPDKYQMFNLMGNELAFDVDLSTVECGINSALYF   46
usage_00143.pdb         1  ALTLKFVTKHEYGTNVGSRFYLMN--GPDKYQMFNLMGNELAFDVDLSTVECGINSALYF   58
usage_00310.pdb         1  ------------STNIGSRVYLMSADD-TNYEIFKLKNQEFAFDVDMSNLPCGLNGALYF   47
usage_00582.pdb         1  ------------GTNVGSRFYLMN--GPDKYQMFNLMGNELAFDVDLSTVECGINSALYF   46
usage_00644.pdb         1  ------------STNVGSRTYLMD--GEDKYQTFELLGNEFTFDVDVSNIGCGLNGALYF   46
                                        TNvGSR YLM   g dkYq F L gnE aFDVD S   CG N ALYF

usage_00142.pdb        47  VA   48
usage_00143.pdb        59  VA   60
usage_00310.pdb        48  VE   49
usage_00582.pdb        47  VA   48
usage_00644.pdb        47  VS   48
                           V 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################