################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:10 2021 # Report_file: c_0662_17.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00045.pdb # 2: usage_00102.pdb # 3: usage_00147.pdb # 4: usage_00320.pdb # 5: usage_00330.pdb # 6: usage_00527.pdb # # Length: 82 # Identity: 16/ 82 ( 19.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 82 ( 29.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 82 ( 17.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00045.pdb 1 ----GFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDF 56 usage_00102.pdb 1 EKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKV 60 usage_00147.pdb 1 ---VEFSTGPHAPYTHWKQTIFYFPDDLDAETGDTIEGELVCSPNEKNNRDLNIKISYKF 57 usage_00320.pdb 1 -KPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKV 59 usage_00330.pdb 1 EKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKV 60 usage_00527.pdb 1 --PLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKV 58 ST P P THWKQ Yl ve Gei P N R L yk usage_00045.pdb 57 KGQL------CETSVSNDYKMR 72 usage_00102.pdb 61 G---------DQEEKTKDFAM- 72 usage_00147.pdb 58 ESN-GIDGNSRSRKNEGSYLMH 78 usage_00320.pdb 60 G---------DQEEKTKDFAM- 71 usage_00330.pdb 61 G---------DQEEKTKDFAM- 72 usage_00527.pdb 59 G---------DQEEKTKDFAM- 70 d M #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################