################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:22 2021 # Report_file: c_0651_43.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00149.pdb # 2: usage_00329.pdb # 3: usage_00330.pdb # 4: usage_00331.pdb # 5: usage_00332.pdb # # Length: 69 # Identity: 27/ 69 ( 39.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 69 ( 43.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 69 ( 8.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00149.pdb 1 VKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDAKVEEVKAGLENG 60 usage_00329.pdb 1 IKVQVEDENVLLISGERKREE-KEGVKYLKMERRIGKLMRKFVLPENANIEAISAISQDG 59 usage_00330.pdb 1 IKVQVEDENVLLISGERKR-E-KEGVKYLKMERRIGKLMRKFVLPEN-NIEAISAISQDG 57 usage_00331.pdb 1 VKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENG 60 usage_00332.pdb 1 VKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENG 60 KV VED VL iSGER ER GK R F LpEn A G usage_00149.pdb 61 VLTVTVPKA 69 usage_00329.pdb 60 VLTVTVN-- 66 usage_00330.pdb 58 VLTVTVN-- 64 usage_00331.pdb 61 VLTVTV--- 66 usage_00332.pdb 61 VLTVTVPK- 68 VLTVTV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################