################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:18:34 2021 # Report_file: c_1459_156.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00040.pdb # 2: usage_00060.pdb # 3: usage_00061.pdb # 4: usage_00728.pdb # 5: usage_00729.pdb # 6: usage_00730.pdb # 7: usage_00818.pdb # 8: usage_00819.pdb # 9: usage_00820.pdb # 10: usage_00925.pdb # 11: usage_01962.pdb # 12: usage_01963.pdb # 13: usage_02596.pdb # 14: usage_02597.pdb # # Length: 30 # Identity: 9/ 30 ( 30.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 30 ( 33.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 30 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00040.pdb 1 AIERTLSIIKPDGLEKGVIGKIISRFEEKG 30 usage_00060.pdb 1 AIERTLSIIKPDGLEKGVIGKIISRFEEKG 30 usage_00061.pdb 1 ----TLSIIKPDGLEKGVIGKIISRFEEKG 26 usage_00728.pdb 1 DVEETYIMVKPDGIQRGLVGEIISRFEKKG 30 usage_00729.pdb 1 -VEETYIMVKPDGIQRGLVGEIISRFEKKG 29 usage_00730.pdb 1 DVEETYIMVKPDGIQRGLVGEIISRFEKKG 30 usage_00818.pdb 1 --ERTLSIIKPDAVAKNVIGEIESRFEKAG 28 usage_00819.pdb 1 --ERTLSIIKPDAVAKNVIGEIESRFEKAG 28 usage_00820.pdb 1 ATERTLSIIKPDAVAKNVIGEIESRFEKAG 30 usage_00925.pdb 1 AIERTFSIIKPNAVAKNVIGNIFARFEAAG 30 usage_01962.pdb 1 AIERTLSIVKPDAVSKNHIGEIFARFEKAG 30 usage_01963.pdb 1 ----TLSIVKPDAVSKNHIGEIFARFEKAG 26 usage_02596.pdb 1 AIERTLSIIKPDGLEKGVIGKIISRFEEKG 30 usage_02597.pdb 1 AIERTLSIIKPDGLEKGVIGKIISRFEEKG 30 T KPd G I RFE G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################