################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:25:33 2021
# Report_file: c_0850_28.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00197.pdb
#   2: usage_00457.pdb
#   3: usage_00835.pdb
#   4: usage_00836.pdb
#   5: usage_00837.pdb
#   6: usage_00838.pdb
#   7: usage_00839.pdb
#   8: usage_00840.pdb
#   9: usage_00854.pdb
#  10: usage_00855.pdb
#
# Length:         81
# Identity:       23/ 81 ( 28.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     38/ 81 ( 46.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           17/ 81 ( 21.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00197.pdb         1  ---TEDEKLNIAKRHLLPKQIERNALKKGELTVDDSAIIGIIRYYTREAGVRGLEREISK   57
usage_00457.pdb         1  EIEKLEIVKDHL----LPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAA   56
usage_00835.pdb         1  ----------------LPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAA   44
usage_00836.pdb         1  ----------------LPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAA   44
usage_00837.pdb         1  ----------------LPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAA   44
usage_00838.pdb         1  ----------------LPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAA   44
usage_00839.pdb         1  ----------------LPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAA   44
usage_00840.pdb         1  ----------------LPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAA   44
usage_00854.pdb         1  ----------------LPKQMEEHGLGRDKLQMNEEAMLKVIRQYTREAGVRNLNREAAN   44
usage_00855.pdb         1  ---TELEKLHIMRDYLLPKQMEEHGLGRDKLQMNEEAMLKVIRQYTREAGVRNLNREAAN   57
                                           LPKQ  ehgL    Lq    A l  IR YTREAGVR L R  a 

usage_00197.pdb        58  LCRKAVKQLLLDKSLKHIEIN   78
usage_00457.pdb        57  ICRKAAKAIVAEERKRITVT-   76
usage_00835.pdb        45  ICRKAAKAIVAEERKRITVT-   64
usage_00836.pdb        45  ICRKAAKAIVAEERKRITVT-   64
usage_00837.pdb        45  ICRKAAKAIVAEERKRITVT-   64
usage_00838.pdb        45  ICRKAAKAIVAEERKRITVT-   64
usage_00839.pdb        45  ICRKAAKAIVAEERKRITVT-   64
usage_00840.pdb        45  ICRKAAKAIVAEERKRITVT-   64
usage_00854.pdb        45  ICRKAARLIVSGEKKRVVVT-   64
usage_00855.pdb        58  ICRKAARLIVSGEKKRVVVT-   77
                           iCRKAa  iv  e kr  vt 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################