################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:10 2021 # Report_file: c_1484_171.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_01585.pdb # 2: usage_02557.pdb # 3: usage_02558.pdb # 4: usage_02645.pdb # 5: usage_02818.pdb # 6: usage_02819.pdb # 7: usage_03481.pdb # 8: usage_03482.pdb # # Length: 40 # Identity: 30/ 40 ( 75.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 40 ( 75.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 40 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01585.pdb 1 -VAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRI- 38 usage_02557.pdb 1 -VAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRI- 38 usage_02558.pdb 1 -VAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRIP 39 usage_02645.pdb 1 -VAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRI- 38 usage_02818.pdb 1 --AQIKAGYQSLKKIEDCIRAG---RALMEACNEFYTR-- 33 usage_02819.pdb 1 TVAQIKAGYQSLKKIEDCI------RALMEACNEFYTRI- 33 usage_03481.pdb 1 -VAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRI- 38 usage_03482.pdb 1 -VAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRI- 38 AQIKAGYQSLKKIEDCI RALMEACNEFYTR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################