################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:05 2021 # Report_file: c_0686_52.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00089.pdb # 2: usage_00124.pdb # 3: usage_00228.pdb # 4: usage_00482.pdb # 5: usage_00487.pdb # 6: usage_00488.pdb # 7: usage_00504.pdb # 8: usage_00649.pdb # 9: usage_00840.pdb # # Length: 49 # Identity: 36/ 49 ( 73.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 49 ( 77.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 49 ( 16.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00089.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCRLL-YYVN-LLLI 47 usage_00124.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGQLLYYVN-LLLI 48 usage_00228.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCVRL-LY------- 41 usage_00482.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGQL-LYYV-NLL- 46 usage_00487.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCQLL-YYVN-LL-- 45 usage_00488.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCQLL-YYVN-LL-- 45 usage_00504.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCVRL-LYYVNLLLI 48 usage_00649.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCLLY-YVNL-L--- 44 usage_00840.pdb 1 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCQLL-YYVN-LL-- 45 SPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYC l y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################