################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:02:04 2021 # Report_file: c_0768_80.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00010.pdb # 2: usage_00011.pdb # 3: usage_00013.pdb # 4: usage_00014.pdb # 5: usage_00385.pdb # 6: usage_00386.pdb # 7: usage_00387.pdb # 8: usage_00388.pdb # 9: usage_00504.pdb # 10: usage_00506.pdb # 11: usage_00507.pdb # 12: usage_00727.pdb # 13: usage_00728.pdb # # Length: 41 # Identity: 16/ 41 ( 39.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 41 ( 41.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 41 ( 2.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 KIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELP 41 usage_00011.pdb 1 KIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELP 41 usage_00013.pdb 1 -IMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELP 40 usage_00014.pdb 1 -IMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELP 40 usage_00385.pdb 1 -IMLRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALP 40 usage_00386.pdb 1 -IMLRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALP 40 usage_00387.pdb 1 -IMLRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALP 40 usage_00388.pdb 1 -IMLRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALP 40 usage_00504.pdb 1 -VIMRPKETDLVGLVESGSLDYIFIYKSVAKQHHLSYITLP 40 usage_00506.pdb 1 -IMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELP 40 usage_00507.pdb 1 -IMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELP 40 usage_00727.pdb 1 -IVIRPKETDLLGLVESGSIDYIFIYKSVAKQHNLSYITLP 40 usage_00728.pdb 1 -IVIRPKETDLLGLVESGSIDYIFIYKSVAKQHNLSYITLP 40 i R E L E G DY IY SVA QH LP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################