################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:54:39 2021 # Report_file: c_1289_22.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00026.pdb # 2: usage_00027.pdb # 3: usage_00033.pdb # 4: usage_00043.pdb # 5: usage_00045.pdb # 6: usage_00048.pdb # 7: usage_00049.pdb # 8: usage_00112.pdb # 9: usage_00126.pdb # 10: usage_00127.pdb # 11: usage_00145.pdb # 12: usage_00146.pdb # 13: usage_00147.pdb # 14: usage_00148.pdb # 15: usage_00149.pdb # 16: usage_00208.pdb # 17: usage_00463.pdb # # Length: 31 # Identity: 28/ 31 ( 90.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 31 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 31 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00026.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREMLRV 31 usage_00027.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00033.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00043.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00045.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00048.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00049.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00112.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00126.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00127.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00145.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00146.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00147.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00148.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00149.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILHV 31 usage_00208.pdb 1 PHILIVPGKLHIVEAEYLVEIAGAPREILRV 31 usage_00463.pdb 1 PHILIVPGKLHIVEAEYLVEMAGAPREILRV 31 PHILIVPGKLHIVEAEYLVEiAGAPREiLrV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################