################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:59:08 2021
# Report_file: c_1342_9.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00005.pdb
#   2: usage_00006.pdb
#   3: usage_00007.pdb
#   4: usage_00008.pdb
#   5: usage_00127.pdb
#   6: usage_00147.pdb
#   7: usage_00210.pdb
#   8: usage_00216.pdb
#   9: usage_00217.pdb
#  10: usage_00218.pdb
#  11: usage_00412.pdb
#  12: usage_00539.pdb
#  13: usage_00575.pdb
#
# Length:         38
# Identity:        1/ 38 (  2.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      3/ 38 (  7.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           13/ 38 ( 34.2%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00005.pdb         1  -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG--   34
usage_00006.pdb         1  -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG--   34
usage_00007.pdb         1  -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG--   34
usage_00008.pdb         1  PTKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG--   35
usage_00127.pdb         1  PKAYAQHVFRSF-DANSDGTLDFKEYVIALHMTS----   33
usage_00147.pdb         1  --AYAQHVFRS--F----GTLDFKEYVIALHMTS----   26
usage_00210.pdb         1  IDDKIHFSFQLY-DLKQQGFIERQEVKQMVVATLAESG   37
usage_00216.pdb         1  -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG--   34
usage_00217.pdb         1  -TKFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG--   34
usage_00218.pdb         1  --KFATFVFNVF-DENKDGRIEFSEFIQALSVTSRG--   33
usage_00412.pdb         1  -SKFASLVFRVF-DENNDGAIEFEEFIRALSIT-----   31
usage_00539.pdb         1  -STYAHYLFNAF-DTTQTGSVKFEDFVTALSIL-----   31
usage_00575.pdb         1  -GSYCRNLERIGYL--RKGRLEPLEAAYQASRG-----   30
                                   f         G     e             


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################