################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:22:45 2021 # Report_file: c_0946_3.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00291.pdb # 2: usage_00292.pdb # 3: usage_00293.pdb # 4: usage_00294.pdb # 5: usage_00295.pdb # 6: usage_00296.pdb # 7: usage_00465.pdb # 8: usage_00466.pdb # 9: usage_00775.pdb # 10: usage_00776.pdb # 11: usage_00777.pdb # 12: usage_00779.pdb # 13: usage_00780.pdb # 14: usage_01588.pdb # 15: usage_01589.pdb # # Length: 54 # Identity: 43/ 54 ( 79.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 54 ( 79.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 54 ( 1.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00291.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGVIRRSEDNGKT-WGDRVTIT 53 usage_00292.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGVIRRSEDNGKT-WGDRVTIT 53 usage_00293.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00294.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00295.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00296.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00465.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00466.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00775.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00776.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00777.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00779.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_00780.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_01588.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 usage_01589.pdb 1 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTIT 54 KSYRIPALLKTDKGTLIAGADERRLHSSDWGDIG R WGDRVTIT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################