################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:59 2021 # Report_file: c_1026_1.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00017.pdb # 2: usage_00031.pdb # 3: usage_00032.pdb # 4: usage_00036.pdb # 5: usage_00097.pdb # 6: usage_00126.pdb # 7: usage_00127.pdb # 8: usage_00128.pdb # 9: usage_00289.pdb # # Length: 80 # Identity: 48/ 80 ( 60.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 77/ 80 ( 96.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 80 ( 2.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00017.pdb 1 PIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATS 60 usage_00031.pdb 1 PIHLSFAVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKT 60 usage_00032.pdb 1 PIHLSFAVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKT 60 usage_00036.pdb 1 --HLSFCVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKT 58 usage_00097.pdb 1 PIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKT 60 usage_00126.pdb 1 PIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKT 60 usage_00127.pdb 1 PIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKT 60 usage_00128.pdb 1 PIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKT 60 usage_00289.pdb 1 PIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKT 60 HLSF vDglDPvftPATGTPVVGGLsYREGlYItEEIykTGLLSgLDimEVNPtLgkt usage_00017.pdb 61 EEEAKTTANLAVDVIASSFG 80 usage_00031.pdb 61 PEEVTRTVNTAVALTLSCFG 80 usage_00032.pdb 61 PEEVTRTVNTAVALTLSCFG 80 usage_00036.pdb 59 PEEVTRTVNTAVALTLSCFG 78 usage_00097.pdb 61 PEEVTRTVNTAVALTLSCFG 80 usage_00126.pdb 61 PEEVTRTVNTAVALTLSCFG 80 usage_00127.pdb 61 PEEVTRTVNTAVALTLSCFG 80 usage_00128.pdb 61 PEEVTRTVNTAVALTLSCFG 80 usage_00289.pdb 61 PEEVTRTVNTAVALTLSCFG 80 pEEvtrTvNtAValtlScFG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################