################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:39 2021 # Report_file: c_0787_46.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00092.pdb # 2: usage_00598.pdb # 3: usage_00599.pdb # 4: usage_00600.pdb # 5: usage_00656.pdb # 6: usage_01006.pdb # # Length: 63 # Identity: 14/ 63 ( 22.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 63 ( 63.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 63 ( 12.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00092.pdb 1 DESYLVGSDLGPA--ESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKF 58 usage_00598.pdb 1 DQYIEVP---GGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKV 57 usage_00599.pdb 1 DQYIEVP---GGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKV 57 usage_00600.pdb 1 DQYIEVP---GGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKV 57 usage_00656.pdb 1 DQYIEVP---GGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKV 57 usage_01006.pdb 1 -HYVPVP---GGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKLPELLCKNGVAF 56 y Vp Gg nnYaNv lIvDiA ra VdAvwaGwGhaSENp lpe l k usage_00092.pdb 59 I-- 59 usage_00598.pdb 58 IFI 60 usage_00599.pdb 58 IFI 60 usage_00600.pdb 58 IFI 60 usage_00656.pdb 58 IFI 60 usage_01006.pdb 57 L-- 57 i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################