################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:39 2021 # Report_file: c_1432_100.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00253.pdb # 2: usage_00304.pdb # 3: usage_00361.pdb # 4: usage_01088.pdb # 5: usage_01666.pdb # 6: usage_01674.pdb # 7: usage_01721.pdb # # Length: 38 # Identity: 12/ 38 ( 31.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 38 ( 65.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 38 ( 26.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00253.pdb 1 -PVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNK 37 usage_00304.pdb 1 YPVFQILRVVPNKLLGVLLMAAVPAGLITV-------- 30 usage_00361.pdb 1 YPVFQILRSVPNKLLGVLLMASVPLGLILVPFIEN--- 35 usage_01088.pdb 1 YPVFQILRSVPNKLLGVLLMASVPLGLILVPFIEN--- 35 usage_01666.pdb 1 YPVFQILRSLPNKLLGVLAMASVPLGLILVPFIEN--- 35 usage_01674.pdb 1 YPVFQILRSLPNKLLGVLAMASVPLGLILVPFIEN--- 35 usage_01721.pdb 1 -FAYAILRSIPNKLGGVLALAASVLILFL--------- 28 pvfqILRs PNKLlGVL mA vplgLil #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################