################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:12 2021 # Report_file: c_1373_81.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00658.pdb # 2: usage_00677.pdb # 3: usage_01359.pdb # 4: usage_01360.pdb # 5: usage_01361.pdb # 6: usage_01374.pdb # 7: usage_01375.pdb # 8: usage_01376.pdb # 9: usage_01377.pdb # 10: usage_01378.pdb # 11: usage_01379.pdb # 12: usage_01680.pdb # 13: usage_01718.pdb # # Length: 32 # Identity: 12/ 32 ( 37.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 32 ( 43.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 32 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00658.pdb 1 -SEEKDF-DLDDDVFIAKYSLQDYAFEHVVYG 30 usage_00677.pdb 1 SQMETDFLELAMDEFIQRYKLEGYAFEHIVYG 32 usage_01359.pdb 1 STMEEDFLNMDMGVFIQKYGLEDFNFEHVVYG 32 usage_01360.pdb 1 STMEEDFLNMDMGVFIQKYGLEDFNFEHVVYG 32 usage_01361.pdb 1 STMEEDFLNMDMGVFIQKYGLEDFNFEHVVYG 32 usage_01374.pdb 1 STMEEDFLNMDIGVFIQKYGLEDFNFEHVVYG 32 usage_01375.pdb 1 STMEEDFLNMDIGVFIQKYGLEDFNFEHVVYG 32 usage_01376.pdb 1 STMEEDFLNMDIGVFIQKYGLEDFNFEHVVYG 32 usage_01377.pdb 1 STMEEDFLNMDIGVFIQKYGLEDFNFEHVVYG 32 usage_01378.pdb 1 STMEEDFLNMDIGVFIQKYGLEDFNFEHVVYG 32 usage_01379.pdb 1 STMEEDFLNMDIGVFIQKYGLEDFNFEHVVYG 32 usage_01680.pdb 1 SQMETDFLELAMDEFIQRYKLEGYAFEAIVYG 32 usage_01718.pdb 1 -EMEKDFMDLDDDVFIAKYSLQDYAFEHVVYG 31 mE DF FI Y L FEh VYG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################