################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:43:03 2021
# Report_file: c_1052_22.html
################################################################################################
#====================================
# Aligned_structures: 7
#   1: usage_00112.pdb
#   2: usage_00212.pdb
#   3: usage_00269.pdb
#   4: usage_00344.pdb
#   5: usage_00443.pdb
#   6: usage_00479.pdb
#   7: usage_00563.pdb
#
# Length:         78
# Identity:       17/ 78 ( 21.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     19/ 78 ( 24.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           20/ 78 ( 25.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00112.pdb         1  --CVLVHCLAGISRSATIAIAYIMKRMD--------------MSLDEAYRFVKEKRPTIS   44
usage_00212.pdb         1  -CGVLVHSLAGVSRSVTVTVAYLMQKLH--------------LSLNDAYDLVKRKKSNIS   45
usage_00269.pdb         1  HSKILVHCVMGRSRSATLVLAYLMIHKD--------------MTLVDAIQQVAKNRC-VL   45
usage_00344.pdb         1  -CGVLVHSLAGISRSVTVTVAYLMQKLN--------------LSMNDAYDIVKMKKSNIS   45
usage_00443.pdb         1  GGKILVHSAVGVSRSATLVLAYLMLYHH--------------LTLVEAIKKVKDHRG-II   45
usage_00479.pdb         1  --VVLVHCAMGKSRSVTAIIAYLLWKYPYRFGKSDPNISAKE-AVSRALEWVRETRPIAG   57
usage_00563.pdb         1  -CGVLVHCLAGVSRSVTVTVAYLMQKLH--------------LSLNDAYDLVKRKKSNIS   45
                               LVH   G SRS T   AYlm                       A   V        

usage_00112.pdb        45  PNFNFLGQLLDYEKKI--   60
usage_00212.pdb        46  PNFNFMGQLLDFERSLR-   62
usage_00269.pdb        46  PNRGFLKQLRELDKQLV-   62
usage_00344.pdb        46  PNFNFMGQLLDFERTL--   61
usage_00443.pdb        46  PNRGFLRQLLALDRRLR-   62
usage_00479.pdb        58  PNDGFMRQLEMWWDMG--   73
usage_00563.pdb        46  PNFNFMGQLLDFERSLRL   63
                           PN  F  QL         


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################