################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:23:57 2021 # Report_file: c_0557_17.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00023.pdb # 2: usage_00039.pdb # 3: usage_00045.pdb # 4: usage_00046.pdb # 5: usage_00076.pdb # 6: usage_00078.pdb # 7: usage_00115.pdb # 8: usage_00156.pdb # 9: usage_00167.pdb # 10: usage_00216.pdb # # Length: 52 # Identity: 8/ 52 ( 15.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 52 ( 40.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 52 ( 13.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 ---LTQSPGTLSLSPGETASLSCTAASYG---HMTWYQKKPGQPPKLLIFA- 45 usage_00039.pdb 1 DILLTQSPAILSVSPGERVSFSCRASQSIGT-DIHWYQQRTNGSPRLLIKY- 50 usage_00045.pdb 1 EIVLTQSPGTLSLSPGERATLSCRASQSVSSTYLAWYQQKPGQAPRLLIYG- 51 usage_00046.pdb 1 EIVLTQSPGTLSLSPGERATLSCRASQSVSSTYLAWYQQKPGQAPRLLIYG- 51 usage_00076.pdb 1 EIVLTQSPGTLSLSPGERATLSCRASQSVTSSQLAWYQQKPGQAPRLLISG- 51 usage_00078.pdb 1 -IVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYG- 50 usage_00115.pdb 1 --QMTQSPATLSLSPGERATLSCRASQSVSS-YLAWYQQKPGQAPRLLIYD- 48 usage_00156.pdb 1 -VVLTQSPGTLALPPGERATLSCRASHRVGSTYIAWYQQKSGQAPRRLIYG- 50 usage_00167.pdb 1 EIVLTQSPATLSLSPGERATLSCRASQSVSS-YLAWYQQKPGQAPRLLIYD- 50 usage_00216.pdb 1 GIQVEQSPPDLILQEGANSTLRCNFSDSVN--NLQWFHQNPWGQLINLFYIP 50 tQSP L l pGe lsC as Wyqq p Li #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################