################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:31:19 2021 # Report_file: c_1324_29.html ################################################################################################ #==================================== # Aligned_structures: 20 # 1: usage_00134.pdb # 2: usage_00571.pdb # 3: usage_00572.pdb # 4: usage_00573.pdb # 5: usage_00574.pdb # 6: usage_00575.pdb # 7: usage_00576.pdb # 8: usage_00577.pdb # 9: usage_00578.pdb # 10: usage_00579.pdb # 11: usage_00580.pdb # 12: usage_00581.pdb # 13: usage_00582.pdb # 14: usage_00583.pdb # 15: usage_00584.pdb # 16: usage_00585.pdb # 17: usage_00586.pdb # 18: usage_00587.pdb # 19: usage_00588.pdb # 20: usage_00695.pdb # # Length: 30 # Identity: 2/ 30 ( 6.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 30 ( 23.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 30 ( 23.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00134.pdb 1 AEQVMDMLEQTD--GI-ELFRGADFPT--- 24 usage_00571.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00572.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00573.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00574.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00575.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00576.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00577.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00578.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00579.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00580.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00581.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00582.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00583.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00584.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00585.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00586.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00587.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00588.pdb 1 DTGHMNMLRALFEAGV-RLWHKESDM-IN- 27 usage_00695.pdb 1 QKGSHAMAKRLAQAGIDTTVISDATI-FAI 29 g m Ml l G l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################