################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:05 2021 # Report_file: c_1399_86.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00354.pdb # 2: usage_00399.pdb # 3: usage_00914.pdb # 4: usage_01015.pdb # 5: usage_01232.pdb # 6: usage_01571.pdb # # Length: 67 # Identity: 25/ 67 ( 37.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 67 ( 37.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 67 ( 11.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00354.pdb 1 NQRIGHFFFWHLKSEMH-NKTVSQRFGLLLESYCRACG-MYLKHLNRQVEAMEKLINLTD 58 usage_00399.pdb 1 NQRIGHFFFWHLKSEMH-NKTVSQRFGLLLESYCRACG-MYLKHLNRQVEAMEKLINLTD 58 usage_00914.pdb 1 -QRIGHFFFWHLKSEMH-NKTVSQRFGLLLESYCRACG-MYLKHLNRQVEAMEKLINLTD 57 usage_01015.pdb 1 -KRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTL 59 usage_01232.pdb 1 NKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTL 60 usage_01571.pdb 1 -QRIGHFFFWHLKSEMH-NKTVSQRFGLLLESYCRACG-MYLKHLNRQVEAMEKLINLTD 57 RIGHF FW L SE QRF LE Y R CG L QV E L T usage_00354.pdb 59 IL----- 60 usage_00399.pdb 59 ILK---- 61 usage_00914.pdb 58 ILKQEKK 64 usage_01015.pdb 60 DIKSL-- 64 usage_01232.pdb 61 DIKSLS- 66 usage_01571.pdb 58 ILKQEKK 64 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################