################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:57 2021 # Report_file: c_1240_33.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00244.pdb # 2: usage_00245.pdb # 3: usage_01081.pdb # 4: usage_01510.pdb # 5: usage_01511.pdb # 6: usage_01512.pdb # 7: usage_01513.pdb # 8: usage_01542.pdb # 9: usage_01799.pdb # 10: usage_01800.pdb # 11: usage_01821.pdb # # Length: 30 # Identity: 19/ 30 ( 63.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 30 ( 63.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 30 ( 6.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00244.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 usage_00245.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 usage_01081.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 usage_01510.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 usage_01511.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 usage_01512.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 usage_01513.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 usage_01542.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 usage_01799.pdb 1 SSGRDVACVTEVADTLGAANQG-FDFLCP- 28 usage_01800.pdb 1 SSGRDVACVTEVADTLGAANQG-FDFLCP- 28 usage_01821.pdb 1 SSGRDLNCVPEIADTLGAVAKQGFDFLCMP 30 SSGRD CV E ADTLGA FDFLC #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################