################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:40:55 2021
# Report_file: c_1127_22.html
################################################################################################
#====================================
# Aligned_structures: 16
#   1: usage_00154.pdb
#   2: usage_00155.pdb
#   3: usage_00156.pdb
#   4: usage_00157.pdb
#   5: usage_00218.pdb
#   6: usage_00219.pdb
#   7: usage_00220.pdb
#   8: usage_00221.pdb
#   9: usage_00222.pdb
#  10: usage_00223.pdb
#  11: usage_00535.pdb
#  12: usage_00536.pdb
#  13: usage_00537.pdb
#  14: usage_00538.pdb
#  15: usage_00548.pdb
#  16: usage_00549.pdb
#
# Length:         30
# Identity:       23/ 30 ( 76.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     23/ 30 ( 76.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 30 (  6.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00154.pdb         1  FDEANHHRSLFHWLNQGSGELFRRPQVLP-   29
usage_00155.pdb         1  FDEANHHRSLFHWLNQGSGELFRRPQVLP-   29
usage_00156.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00157.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00218.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00219.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00220.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00221.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00222.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00223.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00535.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00536.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00537.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00538.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00548.pdb         1  FDEANHHRSLFHWLNQGSGELFRRMPQVLP   30
usage_00549.pdb         1  -DEANHHRSLFHWLNQGSGELFRRMPQVLP   29
                            DEANHHRSLFHWLNQGSGELFRR      


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################