################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:48 2021 # Report_file: c_0839_44.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00030.pdb # 2: usage_00095.pdb # 3: usage_00097.pdb # 4: usage_00159.pdb # 5: usage_00160.pdb # 6: usage_00245.pdb # 7: usage_00287.pdb # 8: usage_00309.pdb # 9: usage_00338.pdb # # Length: 71 # Identity: 4/ 71 ( 5.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 71 ( 19.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 71 ( 15.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00030.pdb 1 SAGQSVLVRTSLALASQP---EIVGLDEPFENVDAARRHVISRYIKEY----GKEGILVT 53 usage_00095.pdb 1 SGGQKQRVAIARALASNP---KVLLCDQATSALDPATTRSILELLKDINRRLGLTILLIT 57 usage_00097.pdb 1 SGGQQQRVAIARALANNP---PIILADEPTGALDSKTGEKI-QLLKKLNEEDGKTVVVVT 56 usage_00159.pdb 1 SGGQKRRVAIAGILAMRP---KILILDEPTAGLDPKGKQEILNKIKEIHDKYKMITILVS 57 usage_00160.pdb 1 SGGQKRRVAIAGILAMRP---KILILDEPTAGLDPKGKQEILNKIKEIHDKYKMITILVS 57 usage_00245.pdb 1 SGGQQQRVALARALAPRP---QVLLFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVT 57 usage_00287.pdb 1 SGGQKQRVALAGIVAIAP---KILILDEATSMLDPQGRIEMLAIVRQLRQQQNLTVISIT 57 usage_00309.pdb 1 SGGQKQRVAIARALASNP---KVLLCDEATSALDPATTRSILELLKDINRRLGLTILLIT 57 usage_00338.pdb 1 SGGEAQRIKLASELRKRDTGRTLYILDEPTVGLHFEDVRKLVEVLHRLVDR-GNTVIVIE 59 SgGq rv a la p De d usage_00030.pdb 54 HELDMLNLY-K 63 usage_00095.pdb 58 HED-VVKRI-- 65 usage_00097.pdb 57 HDINVARFGE- 66 usage_00159.pdb 58 HNMEDIARI-- 66 usage_00160.pdb 58 HNMEDIARI-- 66 usage_00245.pdb 58 HDQEEALEV-- 66 usage_00287.pdb 58 HDIDEAASA-- 66 usage_00309.pdb 58 HEMDVVKRI-- 66 usage_00338.pdb 60 HNLDVIKNA-- 68 H #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################