################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:29 2021 # Report_file: c_1120_42.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00097.pdb # 2: usage_00098.pdb # 3: usage_00231.pdb # 4: usage_00232.pdb # 5: usage_00654.pdb # 6: usage_00655.pdb # 7: usage_00656.pdb # 8: usage_00657.pdb # 9: usage_00658.pdb # 10: usage_00862.pdb # # Length: 53 # Identity: 3/ 53 ( 5.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 53 ( 52.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 53 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00097.pdb 1 GSHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALL 53 usage_00098.pdb 1 GSHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALL 53 usage_00231.pdb 1 ---SRILASLLKNEHPQTIALFLSQLSPKKSAEIIQNLPEELKKEVVKRIATL 50 usage_00232.pdb 1 --SDRDIIEILKVVDKNTLMIALLGAPEDIKQKFLSNMSKRAAKLFLEDMEAL 51 usage_00654.pdb 1 -SHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALL 52 usage_00655.pdb 1 --HMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIAL- 50 usage_00656.pdb 1 GSHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALL 53 usage_00657.pdb 1 GSHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALL 53 usage_00658.pdb 1 GSHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALL 53 usage_00862.pdb 1 ---PVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIAL- 49 l L ehpqTia Ls l p a il lpeel evlkria #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################