################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:43 2021 # Report_file: c_1480_112.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00503.pdb # 2: usage_00747.pdb # 3: usage_01324.pdb # 4: usage_02193.pdb # 5: usage_02399.pdb # 6: usage_02410.pdb # 7: usage_02479.pdb # 8: usage_02481.pdb # 9: usage_02482.pdb # 10: usage_02516.pdb # 11: usage_03106.pdb # 12: usage_03305.pdb # # Length: 47 # Identity: 30/ 47 ( 63.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 47 ( 63.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 47 ( 12.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00503.pdb 1 DWFQLSLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 47 usage_00747.pdb 1 -----SLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 42 usage_01324.pdb 1 DWFQLSLKEGLTVFRDQEFSGDRASRAVRRIENIRLLRQHQFPEDAG 47 usage_02193.pdb 1 DWFQLSLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 47 usage_02399.pdb 1 DWFQLSLKEGLTVFRDQEFSGDRASRAVRRIENIRLLRQHQFPEDAG 47 usage_02410.pdb 1 -----SLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 42 usage_02479.pdb 1 DWFQLSLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 47 usage_02481.pdb 1 DWFQLSLKEGLTVFRDQEFSGDRASRAVRRIENIRLLRQHQFPEDAG 47 usage_02482.pdb 1 DWFQLSLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 47 usage_02516.pdb 1 DWFQLSLKEGLTVFRDQEFSGDRASRAVRRIENIRLLRQHQFPEDA- 46 usage_03106.pdb 1 DWFQLSLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 47 usage_03305.pdb 1 DWFQLSLKEGLTVFRDQEFSSDLGSRAVNRINNVRTMRGLQFAEDAS 47 SLKEGLTVFRDQEFS D SRAV RI N R R QF EDA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################