################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:16:09 2021
# Report_file: c_1226_88.html
################################################################################################
#====================================
# Aligned_structures: 16
#   1: usage_00034.pdb
#   2: usage_00035.pdb
#   3: usage_00249.pdb
#   4: usage_00303.pdb
#   5: usage_00639.pdb
#   6: usage_00839.pdb
#   7: usage_00840.pdb
#   8: usage_00936.pdb
#   9: usage_00937.pdb
#  10: usage_00938.pdb
#  11: usage_00939.pdb
#  12: usage_00998.pdb
#  13: usage_00999.pdb
#  14: usage_01391.pdb
#  15: usage_01392.pdb
#  16: usage_01419.pdb
#
# Length:         30
# Identity:       11/ 30 ( 36.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     16/ 30 ( 53.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            3/ 30 ( 10.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00034.pdb         1  RIEHDTMGEVRVPAEALWRAQTQRAVEN--   28
usage_00035.pdb         1  RIEHDTMGEVRVPAEALWRAQTQRAVE---   27
usage_00249.pdb         1  RIESDSFGEIQIEEKFYWGAQTQRSLN---   27
usage_00303.pdb         1  RMERDTFGEIAVPAARLWGAQTQRSLQN--   28
usage_00639.pdb         1  RIERDTMGEVRVPADKYWGAQTQRSLEN--   28
usage_00839.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVE---   27
usage_00840.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVE---   27
usage_00936.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVEN--   28
usage_00937.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVEN--   28
usage_00938.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVE---   27
usage_00939.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVEN--   28
usage_00998.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVEN--   28
usage_00999.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVENFP   30
usage_01391.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVE---   27
usage_01392.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVE---   27
usage_01419.pdb         1  RIEHDTMGEVRVPAKALWRAQTQRAVE---   27
                           RiE Dt GE  vpa   W AQTQR      


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################