################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 03:05:31 2021 # Report_file: c_0960_97.html ################################################################################################ #==================================== # Aligned_structures: 24 # 1: usage_00145.pdb # 2: usage_00146.pdb # 3: usage_00147.pdb # 4: usage_00193.pdb # 5: usage_00197.pdb # 6: usage_00286.pdb # 7: usage_00287.pdb # 8: usage_00288.pdb # 9: usage_00419.pdb # 10: usage_00587.pdb # 11: usage_00588.pdb # 12: usage_00597.pdb # 13: usage_00605.pdb # 14: usage_00606.pdb # 15: usage_00819.pdb # 16: usage_00820.pdb # 17: usage_00821.pdb # 18: usage_00863.pdb # 19: usage_00864.pdb # 20: usage_00865.pdb # 21: usage_00872.pdb # 22: usage_00873.pdb # 23: usage_00892.pdb # 24: usage_00949.pdb # # Length: 31 # Identity: 1/ 31 ( 3.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 31 ( 45.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 31 ( 19.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00145.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00146.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00147.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00193.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00197.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00286.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00287.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00288.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00419.pdb 1 DKLALCREKLTVNRIMSFRVVRLGKEILIEP 31 usage_00587.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00588.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00597.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00605.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00606.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00819.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00820.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00821.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00863.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00864.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00865.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 usage_00872.pdb 1 -GRIYIDD---G-LISLVVQKIGPEGLVTQ- 25 usage_00873.pdb 1 -GRIYIDD---G-LISLVVQKIGPEGLVTQ- 25 usage_00892.pdb 1 -GRIYIDD---G-LISLVVQKIGPEGLVTQ- 25 usage_00949.pdb 1 -SKIYVDD---G-LISLQVKQKGADFLVTE- 25 iy dd g lIsl v g lvt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################