################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:15:47 2021 # Report_file: c_0478_31.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00022.pdb # 2: usage_00060.pdb # 3: usage_00078.pdb # 4: usage_00091.pdb # 5: usage_00179.pdb # # Length: 84 # Identity: 33/ 84 ( 39.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 84 ( 54.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 84 ( 11.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 NKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLK 60 usage_00060.pdb 1 TKLTLVFEHVDQDLTTYLDKVP----EPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLK 56 usage_00078.pdb 1 --LTLVFEFMDNDLKKYMDSRR------GLELNLVKYFQWQLLQGLAFCHENKILHRDLK 52 usage_00091.pdb 1 --LYLVFEFLHQDLKKFMDASA----LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLK 54 usage_00179.pdb 1 --LTLVFEYLDKDLKQYLDDCG-----NIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLK 53 LtLVFE d DLk y D g K QLL GLafcH lHRDLK usage_00022.pdb 61 PQNLLINKRGQLKLGDFGLARAFG 84 usage_00060.pdb 57 PQNILVTSSGQIKLADFGLARI-- 78 usage_00078.pdb 53 PQNLLINKRGQLKLGDFGLARAF- 75 usage_00091.pdb 55 PQNLLINTEGAIKLADFGLARAFG 78 usage_00179.pdb 54 PQNLLINERGELKLADFGLARA-- 75 PQNlLin G KL DFGLARa #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################