################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:15:46 2021 # Report_file: c_0469_19.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00025.pdb # 2: usage_00126.pdb # 3: usage_00137.pdb # 4: usage_00138.pdb # 5: usage_00139.pdb # # Length: 83 # Identity: 11/ 83 ( 13.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 83 ( 34.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 83 ( 19.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 -KIIGVQGGTTFDSYLQDSFG---N---SITIQRY-PSEEDAL-DLTSGRVDAVVGDTPL 51 usage_00126.pdb 1 GKSTEVVQATTSAKQLEAYNAEHTD--NPTILNYTKADFQQIMVRLSDGQFDYKIFDKIG 58 usage_00137.pdb 1 -KTIGVQNATTGQEAAEKLFG---KGP---HIKKF-ETTVVAIMELLNGGVDAVITDNAV 52 usage_00138.pdb 1 -KTIGVQNATTGQEAAEKLFG---KGP---HIKKF-ETTVVAIMELLNGGVDAVITDNAV 52 usage_00139.pdb 1 -KTIGVQNATTGQEAAEKLFG---KGP---HIKKF-ETTVVAIMELLNGGVDAVITDNAV 52 K igVq aTT e fg i a L G vDavi D usage_00025.pdb 52 IKQWLKQNG-RREYVLIGKPVND 73 usage_00126.pdb 59 VETVIKNQG-LDNLKVIELPSD- 79 usage_00137.pdb 53 ANEYVKNNPN-KKLQVIEDPK-- 72 usage_00138.pdb 53 ANEYVKNNPN-KKLQVIEDPK-- 72 usage_00139.pdb 53 ANEYVKNNPN-KKLQVIEDP--- 71 Knn l vIe P #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################