################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:17 2021 # Report_file: c_1261_189.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_01067.pdb # 2: usage_01068.pdb # 3: usage_01816.pdb # 4: usage_01817.pdb # 5: usage_01958.pdb # 6: usage_02747.pdb # 7: usage_02748.pdb # 8: usage_04405.pdb # 9: usage_04406.pdb # 10: usage_04407.pdb # # Length: 39 # Identity: 31/ 39 ( 79.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 39 ( 82.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 39 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01067.pdb 1 ---KVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDM 36 usage_01068.pdb 1 ---KVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDM 36 usage_01816.pdb 1 ---KVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDM 36 usage_01817.pdb 1 ---KVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDM 36 usage_01958.pdb 1 ---KVGINGFGRIGRMVFQALCDDGLLGNEIDVVAVVDM 36 usage_02747.pdb 1 ---KVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDM 36 usage_02748.pdb 1 MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDM 39 usage_04405.pdb 1 ---KVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDM 36 usage_04406.pdb 1 ---KVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDM 36 usage_04407.pdb 1 ---KVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDM 36 KVGINGFGRIGRMVFQA C GL GtEIDVVAVVDM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################