################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:31 2021 # Report_file: c_0732_11.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00001.pdb # 2: usage_00151.pdb # 3: usage_00225.pdb # 4: usage_00431.pdb # 5: usage_00450.pdb # 6: usage_00484.pdb # 7: usage_00540.pdb # 8: usage_00640.pdb # # Length: 67 # Identity: 22/ 67 ( 32.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 59/ 67 ( 88.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 67 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 PRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQLLQDESSYIFVSVTQEA 60 usage_00151.pdb 1 ----VECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQLLQDESSYIFVSVTQEA 56 usage_00225.pdb 1 PRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQLLQDESSYIFVSVTQEA 60 usage_00431.pdb 1 ----VECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQLLQDETSYIFVSVTQEA 56 usage_00450.pdb 1 --ILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQLLQDESSYIFVSVTQEA 58 usage_00484.pdb 1 QSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTA 60 usage_00540.pdb 1 PRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQLLQDESSYIFVSVTQEA 60 usage_00640.pdb 1 PRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQLLQDESSYIFVSVTQEA 60 VecLLPnGmivtleclReAtL TIKheLf eArkyPLhqlLqde sYiFvsvtQeA usage_00001.pdb 61 EREEFF- 66 usage_00151.pdb 57 EREEFFD 63 usage_00225.pdb 61 EREEFF- 66 usage_00431.pdb 57 EREEFF- 62 usage_00450.pdb 59 EREEFFD 65 usage_00484.pdb 61 EQQELED 67 usage_00540.pdb 61 EREEFF- 66 usage_00640.pdb 61 EREEFF- 66 EreEff #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################