################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:11 2021 # Report_file: c_1340_14.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00260.pdb # 2: usage_00261.pdb # 3: usage_00262.pdb # 4: usage_00264.pdb # 5: usage_00399.pdb # 6: usage_00400.pdb # 7: usage_00401.pdb # 8: usage_00402.pdb # 9: usage_00406.pdb # 10: usage_00465.pdb # 11: usage_00478.pdb # # Length: 31 # Identity: 30/ 31 ( 96.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 31 ( 96.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 31 ( 3.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00260.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTH- 30 usage_00261.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTH- 30 usage_00262.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTH- 30 usage_00264.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTH- 30 usage_00399.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTH- 30 usage_00400.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTHS 31 usage_00401.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTHS 31 usage_00402.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTHS 31 usage_00406.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTHS 31 usage_00465.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTH- 30 usage_00478.pdb 1 KAVELFSLMMQERASTGRIYIQNVDHCNTHS 31 KAVELFSLMMQERASTGRIYIQNVDHCNTH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################