################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:50 2021 # Report_file: c_0791_61.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00324.pdb # 2: usage_00757.pdb # 3: usage_00758.pdb # 4: usage_00759.pdb # 5: usage_01040.pdb # 6: usage_01239.pdb # 7: usage_01240.pdb # 8: usage_01241.pdb # # Length: 74 # Identity: 11/ 74 ( 14.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 74 ( 27.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 74 ( 16.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00324.pdb 1 MTGAVCPGSFDPVTLGHVDIFERAAAQF-D-EVVVAILVNPAKT--GMFDLDERIAMVKE 56 usage_00757.pdb 1 -RIGLFGGTFDPVHIGHR-SAV-EAEQFALDELRLLPNARPPHRETPQVSAAQRLAVERA 57 usage_00758.pdb 1 -RIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVER 59 usage_00759.pdb 1 -RIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVER 59 usage_01040.pdb 1 -KRAIYPGTFDPITNGHIDIVTRATQMF-D-HVILAIAASPSKK--PMFTLEERVALAQQ 55 usage_01239.pdb 1 -RIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVER 59 usage_01240.pdb 1 -RIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVER 59 usage_01241.pdb 1 -RIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVER 59 GtFDPv GH a qF e l a P p R A usage_00324.pdb 57 STTHLPNLRV---- 66 usage_00757.pdb 58 VAGV-ERLTVD-P- 68 usage_00758.pdb 60 AVAGVERLTVD-P- 71 usage_00759.pdb 60 AVAGVERLTVD-P- 71 usage_01040.pdb 56 ATAHLGNVEVVGFS 69 usage_01239.pdb 60 AVAGVERLTVD-P- 71 usage_01240.pdb 60 AVAGVERLTVD-P- 71 usage_01241.pdb 60 AVAGVERLTVD-P- 71 l V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################