################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:59 2021 # Report_file: c_1381_10.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00188.pdb # 2: usage_00189.pdb # 3: usage_00210.pdb # 4: usage_00211.pdb # 5: usage_00212.pdb # 6: usage_00213.pdb # 7: usage_00292.pdb # 8: usage_00293.pdb # # Length: 70 # Identity: 51/ 70 ( 72.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 70 ( 72.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 70 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00188.pdb 1 RRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDE---IRPPTPQDEM 57 usage_00189.pdb 1 RRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDE---IRPPTPQDEM 57 usage_00210.pdb 1 -RSLLQKNARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTD-EIRRAQPTPQDEM 58 usage_00211.pdb 1 RRSLLQKNARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTD-EIRRAQPTPQDEM 59 usage_00212.pdb 1 RRSLLQKNARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTD-EIRRAQPTPQDEM 59 usage_00213.pdb 1 -RSLLQKNARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTD-EIRRAQPTPQDEM 58 usage_00292.pdb 1 -RSLLQKNARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTD-EIRRAQPTPQAEM 58 usage_00293.pdb 1 RRSLLQKNARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTD-EIRRAQPTPQAEM 59 RSLLQK RIRNCL QL AKDIT DDKQELDEAL REIQAAFRTD PTPQ EM usage_00188.pdb 58 RAGMSYFHE- 66 usage_00189.pdb 58 RAGMSYFHET 67 usage_00210.pdb 59 RYGMSYIH-- 66 usage_00211.pdb 60 RYGMSYIHE- 68 usage_00212.pdb 60 RYGMSYIHE- 68 usage_00213.pdb 59 RYGMSYIHE- 67 usage_00292.pdb 59 RYGMSYIHE- 67 usage_00293.pdb 60 RYGMSYIHET 69 R GMSY H #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################