################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:53:16 2021
# Report_file: c_1198_64.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00100.pdb
#   2: usage_00243.pdb
#   3: usage_00339.pdb
#   4: usage_00340.pdb
#   5: usage_00653.pdb
#   6: usage_00727.pdb
#   7: usage_01218.pdb
#   8: usage_02022.pdb
#   9: usage_02023.pdb
#  10: usage_02304.pdb
#  11: usage_02345.pdb
#  12: usage_02355.pdb
#
# Length:         32
# Identity:       10/ 32 ( 31.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     19/ 32 ( 59.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            8/ 32 ( 25.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00100.pdb         1  KKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYP   32
usage_00243.pdb         1  -RQVKPEAWLSHGPSPGPGHLQLVCHVSGFYP   31
usage_00339.pdb         1  -RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP   31
usage_00340.pdb         1  QRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP   32
usage_00653.pdb         1  -KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYP   31
usage_00727.pdb         1  QRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP   32
usage_01218.pdb         1  ERQVPPMAVVFARTA----QLLLVCRVTSFYP   28
usage_02022.pdb         1  -RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP   31
usage_02023.pdb         1  QRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYP   32
usage_02304.pdb         1  ----KPEAWLSSGPSPGPGRLQLVCHVSGFYP   28
usage_02345.pdb         1  -RQVKPEAWLSSGPTPGPGRLLLVCHVSGFYP   31
usage_02355.pdb         1  -KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYP   31
                               kP Awls gp      L LVChVsgFYP


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################