################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:16:08 2021 # Report_file: c_1214_54.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00049.pdb # 2: usage_00050.pdb # 3: usage_00186.pdb # 4: usage_00187.pdb # 5: usage_00188.pdb # 6: usage_00189.pdb # 7: usage_00191.pdb # 8: usage_00192.pdb # 9: usage_00193.pdb # 10: usage_00194.pdb # 11: usage_00317.pdb # 12: usage_00587.pdb # 13: usage_00604.pdb # 14: usage_00605.pdb # 15: usage_00679.pdb # 16: usage_00680.pdb # # Length: 30 # Identity: 10/ 30 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 30 ( 83.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 30 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00049.pdb 1 TPLVRKEGRLVEATWEEAFLALKEGL---- 26 usage_00050.pdb 1 TPLVRKEGRLVEATWEEAFLALKEGL---- 26 usage_00186.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00187.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00188.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00189.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00191.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00192.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00193.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00194.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00317.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00587.pdb 1 KPLIRKNGEFVEVSYDEAIDKAAKILAES- 29 usage_00604.pdb 1 TPLVRKEGRLVEATWEEAFLALKEGLKEAR 30 usage_00605.pdb 1 TPLVRKEGRLVEATWEEAFLALKEGL---- 26 usage_00679.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 usage_00680.pdb 1 -PLVRKEGRLVEATWEEAFLALKEGL---- 25 PLvRKeGrlVEatweEAflalkegL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################