################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:47:53 2021 # Report_file: c_1148_6.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00936.pdb # 2: usage_00937.pdb # 3: usage_01161.pdb # 4: usage_01559.pdb # 5: usage_01616.pdb # 6: usage_01876.pdb # 7: usage_01879.pdb # 8: usage_03149.pdb # 9: usage_03150.pdb # 10: usage_03151.pdb # 11: usage_03152.pdb # 12: usage_03153.pdb # # Length: 33 # Identity: 10/ 33 ( 30.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 33 ( 39.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 33 ( 15.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00936.pdb 1 SVTNIELEPPFGDSYIVIGVGNSALTLHWFRKG 33 usage_00937.pdb 1 SVTNIELEPPFGDSYIVIGVGNSALTLHWFRKG 33 usage_01161.pdb 1 ----IELEPPFGDSYIVVGRGEQQINHHWHKS- 28 usage_01559.pdb 1 -PVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK- 31 usage_01616.pdb 1 EPVNIEAEPPFGESNIVIGIGDKALKINWYRK- 32 usage_01876.pdb 1 ----IEVNPPFGDSYIIVGTGDSRLTYQWHKEG 29 usage_01879.pdb 1 ----IEVNPPFGDSYIIVGTGDSRLTYQWHKE- 28 usage_03149.pdb 1 SPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRP- 32 usage_03150.pdb 1 SPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRP- 32 usage_03151.pdb 1 SPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRP- 32 usage_03152.pdb 1 SPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRP- 32 usage_03153.pdb 1 SPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRP- 32 IE PPFGdSyI G l W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################