################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:55 2021 # Report_file: c_1256_58.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_03053.pdb # 2: usage_03054.pdb # 3: usage_03055.pdb # 4: usage_03056.pdb # 5: usage_03057.pdb # 6: usage_03058.pdb # 7: usage_03059.pdb # 8: usage_03060.pdb # 9: usage_03062.pdb # 10: usage_03063.pdb # 11: usage_03064.pdb # 12: usage_03065.pdb # 13: usage_03066.pdb # # Length: 40 # Identity: 38/ 40 ( 95.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 40 ( 95.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 40 ( 5.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_03053.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03054.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03055.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03056.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03057.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03058.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03059.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03060.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03062.pdb 1 -DFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFY- 38 usage_03063.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03064.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03065.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 usage_03066.pdb 1 CDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYL 40 DFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################