################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:31 2021 # Report_file: c_1304_131.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00257.pdb # 2: usage_00258.pdb # 3: usage_00355.pdb # 4: usage_00596.pdb # 5: usage_00660.pdb # 6: usage_00818.pdb # 7: usage_00896.pdb # 8: usage_00911.pdb # 9: usage_00912.pdb # 10: usage_00929.pdb # 11: usage_01058.pdb # 12: usage_01097.pdb # # Length: 47 # Identity: 0/ 47 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 2/ 47 ( 4.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 47 ( 42.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00257.pdb 1 ----HMRVEREISYLKLLRHPHIIKLYDVITTP--TDIVMVIEYAGG 41 usage_00258.pdb 1 -SDMHMRVEREISYLKLLRHPHIIKLYDVITTP--TDIVMVIE---- 40 usage_00355.pdb 1 KPAIRNQIIRELQVLHECNSPYIVGFYGAFYSD--GEISICMEHMDG 45 usage_00596.pdb 1 -----SSIENEIAVLRKIKHENIVALEDIYESP--NHLYLVMQLVSG 40 usage_00660.pdb 1 ------------AVL--GQHSHVVRYFSAWAED--DHMLIQNEYCNG 31 usage_00818.pdb 1 ----------EAEVMMKLSHPKLVQLYGVCLEQ--APICLVFE---- 31 usage_00896.pdb 1 -----------AKVMMNLSHEKLVQLYGVCTKQ--RPIFIITE---- 30 usage_00911.pdb 1 ---MVDQIKREISIMKIVRHPNIVRLYEVLASK--SKIYIVLEFVTG 42 usage_00912.pdb 1 ---MVDQIKREISIMKIVRHPNIVRLYEVLASK--SKIYIVLEFVTG 42 usage_00929.pdb 1 ----------EAEILSVLSHRNIIQFYGVILEP--PNYGIVTEYASL 35 usage_01058.pdb 1 TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEG 47 usage_01097.pdb 1 ------NVKREIINHRSLRHPNIVRFKEVILTP--THLAIVMEYASG 39 h e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################