################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:06 2021 # Report_file: c_0756_23.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00096.pdb # 2: usage_00108.pdb # 3: usage_00122.pdb # 4: usage_00123.pdb # 5: usage_00270.pdb # 6: usage_00271.pdb # 7: usage_00274.pdb # # Length: 77 # Identity: 4/ 77 ( 5.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 77 ( 23.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 77 ( 24.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00096.pdb 1 KIV--AMVHGETSTGRIHPLKAIGEACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGG 58 usage_00108.pdb 1 --I--LLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEVKADFIVAS 56 usage_00122.pdb 1 RMV--ALVHGETSTGVLNPAEAIGALAKEAGALFFLDAVTTLGMLPFSMRAMGVDYAFTG 58 usage_00123.pdb 1 --------------GVLNPAEAIGALAKEAGALFFLDAVTTLGMLPFSMRAMGVDYAFTG 46 usage_00270.pdb 1 RMV--ALVHGETSTGVLNPAEAIGALAKEAGALFFLDAVTTLGMLPFSMRAMGVDYAFTG 58 usage_00271.pdb 1 RMV--ALVHGETSTGVLNPAEAIGALAKEAGALFFLDAVTTLGMLPFSMRAMGVDYAFTG 58 usage_00274.pdb 1 ---SHIAVHSETTTG-LNPIDEVGALAHRYGKTYIVDASSF-GGI-PDIAALHIDYLISS 54 G lnp G a g f da t G D usage_00096.pdb 59 TQKCLSVPSGMAPIT-- 73 usage_00108.pdb 57 GHSMAASAPCGILAF-S 72 usage_00122.pdb 59 SQKCLSAPPGLAPIAAS 75 usage_00123.pdb 47 SQKCLSAPPGLAPIAAS 63 usage_00270.pdb 59 SQKCLSAPPGLAPIAAS 75 usage_00271.pdb 59 SQKCLSAPPGLAPIAAS 75 usage_00274.pdb 55 ANKCIQGVPGFAFVIAR 71 kc pg a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################