################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:08 2021 # Report_file: c_0768_71.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00061.pdb # 2: usage_00323.pdb # 3: usage_00326.pdb # 4: usage_00344.pdb # 5: usage_00434.pdb # 6: usage_00612.pdb # 7: usage_00701.pdb # # Length: 64 # Identity: 8/ 64 ( 12.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 64 ( 25.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 64 ( 12.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00061.pdb 1 --VFLEGGATRQASVARLLEAAS--LPLVLVHDVARPFVSRGLVARVLEAAQRSGAAVPV 56 usage_00323.pdb 1 --EFIEGGDTRAESLKKALELID--SEFVMVSDVARVLVSKNLFDRLIENLDKADCITPA 56 usage_00326.pdb 1 DLSFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLKDGSAVGAAVLG 60 usage_00344.pdb 1 DLSFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLKDGSAVGAAVLG 60 usage_00434.pdb 1 ----VAGGDERQHSVYKGLKAVKQ-EKIVLVHDGARPFIKHEQIDELIAEAEQTGAAILA 55 usage_00612.pdb 1 ----VAGGDERQHSVYKGLKAVKQ-EKIVLVHDGARPFIKHEQIDELIAEAEQTGAAILA 55 usage_00701.pdb 1 DLSFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLKDGSAVGAAVLG 60 G Rq Sv L V hD ARp gaa usage_00061.pdb 57 LP-- 58 usage_00323.pdb 57 LKVA 60 usage_00326.pdb 61 VP-- 62 usage_00344.pdb 61 VP-- 62 usage_00434.pdb 56 VPVK 59 usage_00612.pdb 56 VP-- 57 usage_00701.pdb 61 VP-- 62 p #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################