################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:52:18 2021
# Report_file: c_0996_31.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00099.pdb
#   2: usage_00100.pdb
#   3: usage_00101.pdb
#   4: usage_00102.pdb
#   5: usage_00103.pdb
#   6: usage_00105.pdb
#   7: usage_00106.pdb
#   8: usage_00107.pdb
#   9: usage_00222.pdb
#  10: usage_00348.pdb
#  11: usage_00349.pdb
#  12: usage_00350.pdb
#
# Length:         31
# Identity:        0/ 31 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      1/ 31 (  3.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            7/ 31 ( 22.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00099.pdb         1  ---KAIIN-KKTETIIAVGAAMAEIPLVEVR   27
usage_00100.pdb         1  ---NVLFCQKGIDDLAQHYLAKEGIVAA---   25
usage_00101.pdb         1  ---NVLFCQKGIDDLAQHYLAKEGIVAA---   25
usage_00102.pdb         1  ---NVLFCQKGIDDLAQHYLAKEGIVAA---   25
usage_00103.pdb         1  ---NVLFCQKGIDDLAQHYLAKEGIVAA---   25
usage_00105.pdb         1  ---NVIICQKGIDEVAQSYLAKKGVLAVRR-   27
usage_00106.pdb         1  ---NVIICQKGIDEVAQSYLAKKGVLAVRR-   27
usage_00107.pdb         1  ---NVIICQKGIDEVAQSYLAKKGVLAVRR-   27
usage_00222.pdb         1  ---RGILVAPSLTSGAKRLLEKEGLEFRK--   26
usage_00348.pdb         1  ---NIVLSKLPIGDLATQFFADRNIFCAGR-   27
usage_00349.pdb         1  DKGFVIINQKGIDPMSLDVFAKHNILALRR-   30
usage_00350.pdb         1  --GFVIINQKGIDPMSLDVFAKHNILALRR-   28
                                               a          


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################