################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:37 2021 # Report_file: c_1172_441.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_01517.pdb # 2: usage_02283.pdb # 3: usage_04362.pdb # 4: usage_04363.pdb # 5: usage_04364.pdb # 6: usage_04365.pdb # 7: usage_04366.pdb # 8: usage_04367.pdb # # Length: 34 # Identity: 3/ 34 ( 8.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 34 ( 32.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 34 ( 17.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01517.pdb 1 APDIYQHKGLFYLYYSVS-AFGKNTSAIGVTVNK 33 usage_02283.pdb 1 DPSVVYHDGRWHVFASTAKTE--G---YNLVYIS 29 usage_04362.pdb 1 GPHIYKKDGWYYLLISEG-GTELG---HKVTIAR 30 usage_04363.pdb 1 GPHIYKKDGWYYLLISEG-GTELG---HKVTIAR 30 usage_04364.pdb 1 GPHIYKKDGWYYLLISEG-GTELG---HKVTIAR 30 usage_04365.pdb 1 GPHIYKKDGWYYLLISEG-GTELG---HKVTIAR 30 usage_04366.pdb 1 GPHIYKKDGWYYLLISEG-GTELG---HKVTIAR 30 usage_04367.pdb 1 GPHIYKKDGWYYLLISEG-GTELG---HKVTIAR 30 P iy dG yl S g vt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################