################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:37:39 2021 # Report_file: c_0671_24.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00035.pdb # 2: usage_00288.pdb # 3: usage_00289.pdb # 4: usage_00321.pdb # 5: usage_00322.pdb # 6: usage_00323.pdb # 7: usage_00326.pdb # 8: usage_00557.pdb # 9: usage_00770.pdb # 10: usage_00778.pdb # 11: usage_00779.pdb # # Length: 54 # Identity: 7/ 54 ( 13.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 54 ( 59.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 54 ( 13.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00035.pdb 1 -DWRGNVVLPAERNIEFKAFIKSKDGTVKSWQTIQQSWNPVPLKTTSHTSS--- 50 usage_00288.pdb 1 PTWYYDVSVPAGQTIEFKFLKKQGST-VTWEGGANRTFTTPTSGTATVN----- 48 usage_00289.pdb 1 PTWYYDVSVPAGQTIEFKFLKKQGST-VTWEGGANRTFTTPTSGTATVN----- 48 usage_00321.pdb 1 PTWYYDVSVPAGQTIEFKFLKKQGST-VTWEGGANRTFTTPTSGTATVN----- 48 usage_00322.pdb 1 PTWYYDVSVPAGQTIEFKFLKKQGST-VTWEGGANRTFTTPTSGTATVN----- 48 usage_00323.pdb 1 PTWYYDVSVPAGQTIEFKFLKKQGST-VTWEGGANRTFTTPTSGTATVN----- 48 usage_00326.pdb 1 PSWYYDVSVPAGTKLDFKFIKKGGGT-VTWEGGGNHTYTTPASSVGTVTV---- 49 usage_00557.pdb 1 PTWYYDVSVPAGTTIQFKFIKKNGNT-ITWEGGSNHTYTVPSSSTGTVIVN--- 50 usage_00770.pdb 1 PTWYYDVSVPAGQTIEFKFLKKQGST-VTWEGGANRTFTTPTSGTATVN----- 48 usage_00778.pdb 1 PTWYYDVSVPAGQTIEFKFLKKQGST-VTWEGGANRTFTTPTSGTATVNVNWQP 53 usage_00779.pdb 1 PTWYYDVSVPAGQTIEFKFLKKQGST-VTWEGGANRTFTTPTSGTATVN----- 48 WyydVsvPAg i FKf kK g t vtwegg n t t p s t tv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################