################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:24 2021 # Report_file: c_1487_354.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00929.pdb # 2: usage_01057.pdb # 3: usage_01058.pdb # 4: usage_01895.pdb # 5: usage_02074.pdb # 6: usage_02076.pdb # 7: usage_02077.pdb # 8: usage_02768.pdb # 9: usage_04921.pdb # # Length: 37 # Identity: 18/ 37 ( 48.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 37 ( 48.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 37 ( 51.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00929.pdb 1 NSSLDIVLHDTYYVVAHF------------------- 18 usage_01057.pdb 1 NSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHW 37 usage_01058.pdb 1 NSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHW 37 usage_01895.pdb 1 NSSLDIVLHDTYYVVAHF------------------- 18 usage_02074.pdb 1 NSSLDIVLHDTYYVVAHF------------------- 18 usage_02076.pdb 1 NSSLDIVLHDTYYVVAHF------------------- 18 usage_02077.pdb 1 NSSLDIVLHDTYYVVAHF------------------- 18 usage_02768.pdb 1 NSSLDIVLHDTYYVVAHF------------------- 18 usage_04921.pdb 1 NSSLDIVLHDTYYVVAHF------------------- 18 NSSLDIVLHDTYYVVAHF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################