################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:24 2021 # Report_file: c_0515_22.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00107.pdb # 2: usage_00110.pdb # 3: usage_00111.pdb # 4: usage_00137.pdb # 5: usage_00224.pdb # 6: usage_00233.pdb # # Length: 149 # Identity: 61/149 ( 40.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 78/149 ( 52.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/149 ( 1.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00107.pdb 1 LDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVML 60 usage_00110.pdb 1 LPYLEELGVTALYFTPIFASPSHHKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIIL 60 usage_00111.pdb 1 LPYLEELGVTALYFTPIFASPSHHKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIIL 60 usage_00137.pdb 1 LPYLEELGVTALYFTPIFASPSHHKYDTADYLAIDPQFGDLPTFRRLVDEAHRRGIKIIL 60 usage_00224.pdb 1 LDHLSKLGVNAVYFTPLFKATTNHKYDTEDYFQIDPQFGDKDTLKKLVDLCHERGIRVLL 60 usage_00233.pdb 1 LDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVML 60 L yL LG t Y TPiF sps HKYDTaDY DP FGD T L D H GI L usage_00107.pdb 61 DAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTF-AFVPQMPKLNT 119 usage_00110.pdb 61 DAVFNHAGDQFFAFRDVLQKGEQSRYKDWFFIEDFPVSKTSRTNYETAAVQVPAMPKLRT 120 usage_00111.pdb 61 DAVFNHAGDQFFAFRDVLQKGEQSRYKDWFFIEDFPVSKTSRTNYETFAVQVPAMPKLRT 120 usage_00137.pdb 61 DAVFNHAGDQFFAFRDVLQKGEQSRYKDWFFIEDFPVSKTSRTNYETFAVQVPAMPKLRT 120 usage_00224.pdb 61 DAVFNHSGRTFPPFVDVLKNGEKSKYKDWFHIRSLPLEVVDGIPTYDTFAFEPLMPKLNT 120 usage_00233.pdb 61 DAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTF-AFVPQMPKLNT 119 DAVFNH G F F DV GE S YKDWF I fP r ny t vP MPKL T usage_00107.pdb 120 ANPEVKRYLLDVATYWIREFDIDGWRLDV 148 usage_00110.pdb 121 ENPEVKEYLFDVARFWMEQGIDGWRLDV- 148 usage_00111.pdb 121 ENPEVKEYLFDVARFWMEQGIDGWRLNV- 148 usage_00137.pdb 121 ENPEVKEYLFDVARFWMEQGIDGWRLDV- 148 usage_00224.pdb 121 EHPDVKEYLLKAAEYWIRETGIDGWRLDV 149 usage_00233.pdb 120 ANPEVKRYLLDVATYWIREFDIDGWRLDV 148 nPeVK YL dvA W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################