################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:16:57 2021
# Report_file: c_1168_32.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_01363.pdb
#   2: usage_01364.pdb
#   3: usage_01365.pdb
#   4: usage_01366.pdb
#   5: usage_01367.pdb
#   6: usage_01376.pdb
#   7: usage_01377.pdb
#   8: usage_01378.pdb
#   9: usage_01379.pdb
#  10: usage_01380.pdb
#  11: usage_01381.pdb
#  12: usage_01382.pdb
#  13: usage_01383.pdb
#  14: usage_01507.pdb
#
# Length:         30
# Identity:       25/ 30 ( 83.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     25/ 30 ( 83.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            5/ 30 ( 16.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_01363.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIEN   30
usage_01364.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIEN   30
usage_01365.pdb         1  -QIFNANRPFIFFIEDETLGTMLFAGKIE-   28
usage_01366.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIEN   30
usage_01367.pdb         1  -QIFNANRPFIFFIEDETLGTMLFAGKIE-   28
usage_01376.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIE-   29
usage_01377.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIE-   29
usage_01378.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIE-   29
usage_01379.pdb         1  -QIFNANRPFIFFIEDETLGTMLFAG----   25
usage_01380.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIEN   30
usage_01381.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIEN   30
usage_01382.pdb         1  -QIFNANRPFIFFIEDETLGTMLFAG----   25
usage_01383.pdb         1  VQIFNANRPFIFFIEDETLGTMLFAGKIEN   30
usage_01507.pdb         1  -QIFNANRPFIFFIEDETLGTMLFAGKIEN   29
                            QIFNANRPFIFFIEDETLGTMLFAG    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################