################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:29:34 2021 # Report_file: c_1380_155.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00245.pdb # 2: usage_00267.pdb # 3: usage_00268.pdb # 4: usage_00269.pdb # 5: usage_00864.pdb # 6: usage_00865.pdb # 7: usage_00898.pdb # 8: usage_01145.pdb # 9: usage_01146.pdb # 10: usage_01193.pdb # 11: usage_01194.pdb # 12: usage_01195.pdb # 13: usage_01196.pdb # 14: usage_01810.pdb # 15: usage_02179.pdb # # Length: 34 # Identity: 32/ 34 ( 94.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 34 ( 94.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 34 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00245.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFD-- 32 usage_00267.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_00268.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_00269.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_00864.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_00865.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_00898.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFD-- 32 usage_01145.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFD-- 32 usage_01146.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFD-- 32 usage_01193.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_01194.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_01195.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_01196.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 usage_01810.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFD-- 32 usage_02179.pdb 1 SRQITQVYGFYDECLRKYGNANVWKYFTDLFDYL 34 SRQITQVYGFYDECLRKYGNANVWKYFTDLFD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################