################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:46 2021 # Report_file: c_0784_45.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00137.pdb # 2: usage_00138.pdb # 3: usage_00349.pdb # 4: usage_00586.pdb # 5: usage_00592.pdb # 6: usage_00599.pdb # 7: usage_00936.pdb # 8: usage_00937.pdb # # Length: 70 # Identity: 7/ 70 ( 10.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 70 ( 71.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 70 ( 28.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00137.pdb 1 -LILLTGDLLHSRNNPSVVA-LHDLLDYLKR--RT-APVVVLPG------LKLFGNFVTS 49 usage_00138.pdb 1 -LILLTGDLLHSRNNPSVVA-LHDLLDYLKR--RT-APVVVLPG-N--H-LKLFGNFVTS 51 usage_00349.pdb 1 -LIAFIGRLE-------EQKGPDVMAAAIPELMQEDVQIVLLGTGK--KKFEKLLKSMEE 50 usage_00586.pdb 1 -LILLTGDLLHSRNNPSVVA-LHDLLDYLKRMMRT-APVVVLPGNHDWKGLKLFGNFVTS 57 usage_00592.pdb 1 -LILLTGDLLHSRNNPSVVA-LHDLLDYLKRMMRT-APVVVLPGNHDWKGLKLFGNFVTS 57 usage_00599.pdb 1 -LILLTGDLLHSRNNPSVVA-LHDLLDYLKRMMRT-APVVVLPGNHDWKGLKLFGNFVTS 57 usage_00936.pdb 1 DLILLTGDLLHSRNNPSVVA-LHDLLDYLKR--RT-APVVVLPGNHDWKGLKLFGNFVTS 56 usage_00937.pdb 1 DLILLTGDLLHSRNNPSVVA-LHDLLDYLKR--RT-APVVVLPGNHDWKGLKLFGNFVTS 56 LIlltGdLl vva lhdlldylkr rt apvVvLpg lklfgnfvts usage_00137.pdb 50 ISS-DITFV- 57 usage_00138.pdb 52 ISS-DITFV- 59 usage_00349.pdb 51 KYPGKVRAVV 60 usage_00586.pdb 58 ISS-DITFVM 66 usage_00592.pdb 58 ISS-DITFVM 66 usage_00599.pdb 58 ISS-DITFVM 66 usage_00936.pdb 57 ISS-DITFV- 64 usage_00937.pdb 57 ISS-DITFV- 64 iss ditfV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################