################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:31 2021 # Report_file: c_0731_31.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00064.pdb # 2: usage_00065.pdb # 3: usage_00310.pdb # 4: usage_00311.pdb # 5: usage_00312.pdb # 6: usage_00313.pdb # 7: usage_00314.pdb # 8: usage_00315.pdb # # Length: 65 # Identity: 56/ 65 ( 86.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 65 ( 86.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 65 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00064.pdb 1 FETRFVG---SQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTML 57 usage_00065.pdb 1 FETRFVGP---QGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTML 57 usage_00310.pdb 1 FETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTML 60 usage_00311.pdb 1 FETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTML 60 usage_00312.pdb 1 FETRFVGP----GMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTML 56 usage_00313.pdb 1 FETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTML 60 usage_00314.pdb 1 FETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTML 60 usage_00315.pdb 1 FETRFVGP-G-QGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTML 58 FETRFVG G NL LMTSPEYHMKRLL AGCGPVFQLCRSFRNEEMGR HNPEFTML usage_00064.pdb 58 EWYRP 62 usage_00065.pdb 58 EWYRP 62 usage_00310.pdb 61 EWYRP 65 usage_00311.pdb 61 EWYRP 65 usage_00312.pdb 57 EWYRP 61 usage_00313.pdb 61 EWYRP 65 usage_00314.pdb 61 EWYRP 65 usage_00315.pdb 59 EWYRP 63 EWYRP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################