################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:37 2021 # Report_file: c_0925_72.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00527.pdb # 2: usage_00582.pdb # 3: usage_00586.pdb # 4: usage_00587.pdb # 5: usage_00643.pdb # 6: usage_00654.pdb # 7: usage_00655.pdb # 8: usage_00681.pdb # 9: usage_01096.pdb # 10: usage_01223.pdb # 11: usage_01224.pdb # # Length: 38 # Identity: 6/ 38 ( 15.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 38 ( 42.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 38 ( 15.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00527.pdb 1 KYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILK---- 34 usage_00582.pdb 1 YYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIK---- 34 usage_00586.pdb 1 -YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIK---- 33 usage_00587.pdb 1 -YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRT 37 usage_00643.pdb 1 -YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIK---- 33 usage_00654.pdb 1 -YDIGEELGSGQFAIVKKCREKSTGLEYAAKFIK---- 33 usage_00655.pdb 1 -YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIK---- 33 usage_00681.pdb 1 --DTGEELGSGQFAVVKKCREKSTGLQYAAKFIK---- 32 usage_01096.pdb 1 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR---- 34 usage_01223.pdb 1 -YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRT 37 usage_01224.pdb 1 -YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIK---- 33 ge lG G Vkk r k Tg A K ik #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################