################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 22:59:46 2021
# Report_file: c_0707_117.html
################################################################################################
#====================================
# Aligned_structures: 4
#   1: usage_00126.pdb
#   2: usage_00127.pdb
#   3: usage_00459.pdb
#   4: usage_00460.pdb
#
# Length:         89
# Identity:       24/ 89 ( 27.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     26/ 89 ( 29.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           22/ 89 ( 24.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00126.pdb         1  ----YTTRQIGAKNTLEYKVYIEKD------GKPVSAFHDIPLYA--DKE-------DNI   41
usage_00127.pdb         1  ----YTTRQIGAKNTLEYKVYIEKD------GKPVSAFHDIPLYA--DKE-------DNI   41
usage_00459.pdb         1  HQQQLLTRETGELYTPSYRVLYYFRD-ETGKELQVSPWHDIPLYVRDLVRTKPASL-PNR   58
usage_00460.pdb         1  ---QLVVHEKGEMYTPSYRVLYFFRDLETGRERQVSPWHDIPLYVRDLVRTKPEATPMNR   57
                                 tr  G   T  Y V              VS  HDIPLY              N 

usage_00126.pdb        42  FNMVVEIPRWTNAKLEITKEE-TLNPI--   67
usage_00127.pdb        42  FNMVVEIPRWTNAKLEITKEE-TLNPI--   67
usage_00459.pdb        59  YNFICEIPKWTRAKFEIATGEPFNPIKQD   87
usage_00460.pdb        58  YNFICEIPKWTRAKFEIATGESFNPIKQD   86
                            N   EIP WT AK EI   E        


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################