################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:48 2021 # Report_file: c_0787_33.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00089.pdb # 2: usage_00090.pdb # 3: usage_00091.pdb # 4: usage_00167.pdb # 5: usage_00662.pdb # 6: usage_00755.pdb # 7: usage_01218.pdb # 8: usage_01219.pdb # # Length: 82 # Identity: 14/ 82 ( 17.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 82 ( 26.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 82 ( 7.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00089.pdb 1 PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRA 60 usage_00090.pdb 1 PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRA 60 usage_00091.pdb 1 -KLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRA 59 usage_00167.pdb 1 -KLILVRHAESEWNPVGRYQGLLDPDLSERGKKQAKLLAQELSREHLD-VIYSSPL-KRT 57 usage_00662.pdb 1 -TLVLLRHGESTWNKENKFTGWTDVPLSEKGEEEAIAAGKYLKEKNFKFDVVYTSVLKRA 59 usage_00755.pdb 1 RRLVMLRHGQTDYNVGSRMQGQLDTELSELGRTQAVAAAEVLGKRQPL-LIVSSDL-RRA 58 usage_01218.pdb 1 PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRA 60 usage_01219.pdb 1 PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRA 60 Lvl RHg s wN G D LS G A a L Ra usage_00089.pdb 61 IQTANIALEKADRLWIPVNRSW 82 usage_00090.pdb 61 IQTANIALEKADRLWIPVNRSW 82 usage_00091.pdb 60 IQTANIALEKADRLWIPVNRSW 81 usage_00167.pdb 58 YLTALEIAEAKN--LEVIKED- 76 usage_00662.pdb 60 ICTAWNVLKTADLLHVPVVKTW 81 usage_00755.pdb 59 YDTAVKLGERTG--LVVRVDT- 77 usage_01218.pdb 61 IQTANIALEKADRLWIPVNRSW 82 usage_01219.pdb 61 IQTANIALEKADRLWIPVNRSW 82 TA e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################