################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:06:09 2021 # Report_file: c_1292_59.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00305.pdb # 2: usage_00743.pdb # 3: usage_00744.pdb # 4: usage_00745.pdb # 5: usage_00746.pdb # 6: usage_00912.pdb # 7: usage_00913.pdb # 8: usage_01336.pdb # 9: usage_01539.pdb # 10: usage_01540.pdb # 11: usage_01541.pdb # 12: usage_01572.pdb # 13: usage_01748.pdb # 14: usage_01749.pdb # 15: usage_01750.pdb # 16: usage_01774.pdb # 17: usage_01931.pdb # 18: usage_01932.pdb # # Length: 32 # Identity: 8/ 32 ( 25.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 32 ( 65.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 32 ( 31.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00305.pdb 1 -VQIVRQQSYSIMSIIKEEVLAYVVQLP---- 27 usage_00743.pdb 1 -VQIVRQQSYSIMSIIKEEVLAYVVQLPLYGV 31 usage_00744.pdb 1 -VQIVRQQSYSIMSIIKEEVLAYVVQLPLYGV 31 usage_00745.pdb 1 -VQIVRQQSYSIMSIIKEEVLAYVVQLPLYGV 31 usage_00746.pdb 1 -VQIVRQQSYSIMSIIKEEVLAYVVQLP---- 27 usage_00912.pdb 1 NVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGV 32 usage_00913.pdb 1 -VQIVRQQSYSIMSIIKEEVLAYVVQLPLYGV 31 usage_01336.pdb 1 NVQIVRQQSYSIMS-----VLAYVVQLPLYGV 27 usage_01539.pdb 1 -VQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 31 usage_01540.pdb 1 -VQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 31 usage_01541.pdb 1 -VQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 31 usage_01572.pdb 1 -RAMVRRKGFGILIGVYGSSVIYMVQLP---- 27 usage_01748.pdb 1 NVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 32 usage_01749.pdb 1 NVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 32 usage_01750.pdb 1 NVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 32 usage_01774.pdb 1 -VQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 31 usage_01931.pdb 1 -VQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 31 usage_01932.pdb 1 NVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGV 32 vqiVRqqsysIm vlaYvVQLP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################