################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 22:53:30 2021
# Report_file: c_0591_39.html
################################################################################################
#====================================
# Aligned_structures: 2
#   1: usage_00013.pdb
#   2: usage_00058.pdb
#
# Length:         84
# Identity:       44/ 84 ( 52.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     44/ 84 ( 52.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            0/ 84 (  0.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00013.pdb         1  PVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILE   60
usage_00058.pdb         1  EVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSV   60
                            V  Y Y DAE    DF      L  A  GD VL HGCCHNPTG   TL QW   A    

usage_00013.pdb        61  KTGALPLIDLAYQGFGDGLEEDAA   84
usage_00058.pdb        61  EKGWLPLFDFAYQGFARGLEEDAE   84
                             G LPL D AYQGF  GLEEDA 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################