################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:46 2021 # Report_file: c_0941_76.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00052.pdb # 2: usage_00149.pdb # 3: usage_00852.pdb # 4: usage_00853.pdb # 5: usage_00854.pdb # 6: usage_00855.pdb # 7: usage_00883.pdb # 8: usage_02035.pdb # 9: usage_02036.pdb # # Length: 38 # Identity: 10/ 38 ( 26.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 38 ( 42.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 38 ( 2.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00052.pdb 1 SSSCHDGKAWLHVCITGDDKNATASFIYNGRLVDSVV- 37 usage_00149.pdb 1 GSACHDGREWTYIGVDGPDNDALVKIKYGEAYTDTYHS 38 usage_00852.pdb 1 SSSCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIGS 38 usage_00853.pdb 1 SSSCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIGS 38 usage_00854.pdb 1 SSSCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIG- 37 usage_00855.pdb 1 SSSCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIG- 37 usage_00883.pdb 1 ATACHDGKKWMTVGVTGPDSKAVAVIHYGGVPTDVINS 38 usage_02035.pdb 1 SSSCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIG- 37 usage_02036.pdb 1 SSSCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIG- 37 s CHDGk W v tG D A a Y g D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################