################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:16 2021 # Report_file: c_1489_122.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00529.pdb # 2: usage_00625.pdb # 3: usage_00632.pdb # 4: usage_00877.pdb # 5: usage_00879.pdb # 6: usage_01566.pdb # 7: usage_01706.pdb # 8: usage_01871.pdb # 9: usage_02546.pdb # 10: usage_03686.pdb # # Length: 58 # Identity: 41/ 58 ( 70.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/ 58 ( 72.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 58 ( 3.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00529.pdb 1 PFHGLSIAFLYGSANLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWRWT-- 56 usage_00625.pdb 1 PWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIG 58 usage_00632.pdb 1 PFHDLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWRWTMG 58 usage_00877.pdb 1 PFHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWRWTMG 58 usage_00879.pdb 1 PFHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWRWTMG 58 usage_01566.pdb 1 PWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIG 58 usage_01706.pdb 1 PFHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWRWTMG 58 usage_01871.pdb 1 PFHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWRWT-- 56 usage_02546.pdb 1 PFHDLSIAFLFGSAHLFAMHGATILAVSRFGGERELEQIADRGTAAERAALFWRWTMG 58 usage_03686.pdb 1 PWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIG 58 P H SI F yG LFA HGATILAV RFGG RE EQI DRGTA ERAALFWRWT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################