################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:48 2021 # Report_file: c_1437_52.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00189.pdb # 2: usage_00296.pdb # 3: usage_00297.pdb # 4: usage_00298.pdb # 5: usage_00370.pdb # 6: usage_00636.pdb # 7: usage_00637.pdb # 8: usage_00720.pdb # 9: usage_00842.pdb # 10: usage_00857.pdb # 11: usage_00864.pdb # # Length: 51 # Identity: 1/ 51 ( 2.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 2/ 51 ( 3.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 51 ( 25.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00189.pdb 1 -PLERAELVLSHAER-MNCKRYLTAEEIV-E--GSSTLNLAFVAQIFHER- 45 usage_00296.pdb 1 -VLQRAEQVLQNAEK-LDCRKYLTPTAMV-A--GNPKLNLAFVAHLFNT-- 44 usage_00297.pdb 1 -PVTNAREAMQQADDWLGIPQVITPEEIV-DPNVDKHSVMTYLSQFP---- 45 usage_00298.pdb 1 -PVTNAREAMQQADDWLGIPQVITPEEIV-DPNVDEHSVMTYL-------- 41 usage_00370.pdb 1 -PVDNAREAVQQADDWLGVPQVITPEEII-HPDVDEHSVMTYL-------- 41 usage_00636.pdb 1 -PVDNAREAMQQADDWLGVPQVITPEEII-HPDVDEHSVMTYLSQFPK--- 46 usage_00637.pdb 1 -PVDNAREAMQQADDWLGVPQVITPEEII-HPDVDEHSVMTYLSQFPK--- 46 usage_00720.pdb 1 -ALEATTWALRVAEHELGITPVLSAQAVM-A-GSDPLGLIAYLSHFHSAF- 47 usage_00842.pdb 1 -PVTNAREAMQQADDWLGIPQVITPEEIV-DPNVDEHSVMTYL-------- 41 usage_00857.pdb 1 -PVDNAREAMQQADDWLGVPQVITPEEII-HPDVDEHSVMTYLSQFPKA-- 47 usage_00864.pdb 1 DPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFA 51 A l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################