################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:36:19 2021 # Report_file: c_0390_5.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00063.pdb # 2: usage_00092.pdb # 3: usage_00161.pdb # 4: usage_00209.pdb # 5: usage_00210.pdb # 6: usage_00211.pdb # 7: usage_00212.pdb # # Length: 91 # Identity: 4/ 91 ( 4.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 91 ( 20.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 91 ( 19.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00063.pdb 1 -HLGFSDVSHDAARVFWEGAPRPVRLVRVTYVSSEG--GHSGQTEAPGNATSAMLGPLSS 57 usage_00092.pdb 1 SQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGD-RTTIDLTEDENQYSIGNLKP 59 usage_00161.pdb 1 -DPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVE--GSSTELNLPETANSVTLSDLQP 57 usage_00209.pdb 1 FNIKVTNITLTTAVVTWQPPILPIEGILVTFGRKNDPSD-ETTVDLTSSITSLTLTNLEP 59 usage_00210.pdb 1 -NIKVTNITLTTAVVTWQPPILPIEGILVTFGRKNDPSD-ETTVDLTSSITSLTLTNLEP 58 usage_00211.pdb 1 FNIKVTNITLTTAVVTWQPPILPIEGILVTFGRKNDPSD-ETTVDLTSSITSLTLTNLEP 59 usage_00212.pdb 1 FNIKVTNITLTTAVVTWQPPILPIEGILVTFGRKNDPSD-ETTVDLTSSITSLTLTNLEP 59 v t a v W p pi g t t l s l L p usage_00063.pdb 58 STTYTVRVTCLYPGGGSSTLTGRVTTKKA-P 87 usage_00092.pdb 60 DTEYEVSLISRRGDMSS-------------- 76 usage_00161.pdb 58 GVQYNITIYAVEENQESTPVVIQ-------- 80 usage_00209.pdb 60 NTTYEIRIVARNGQQYSPPVSTTFTTGSLEH 90 usage_00210.pdb 59 NTTYEIRIVARNGQQYSPPVSTTFTTGSL-- 87 usage_00211.pdb 60 NTTYEIRIVARNGQQYSPPVSTTFTTGSLEH 90 usage_00212.pdb 60 NTTYEIRIVARNGQQYSPPVSTTFT------ 84 t Y S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################