################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:30:32 2021 # Report_file: c_1032_22.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00127.pdb # 2: usage_00281.pdb # 3: usage_00282.pdb # 4: usage_00455.pdb # 5: usage_00464.pdb # 6: usage_00609.pdb # # Length: 77 # Identity: 5/ 77 ( 6.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 77 ( 27.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 77 ( 28.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00127.pdb 1 G-RHFIAVCQMT-SDN--------------DLEKNFQAAKNMIERAGEKKCEMVFLPECF 44 usage_00281.pdb 1 --VKVAYVQMN-PQIL--------------EPDKNYSKAEKLIKEASKQGAQLVVLPELF 43 usage_00282.pdb 1 --VKVAYVQMN-PQIL--------------EPDKNYSKAEKLIKEASKQGAQLVVLPELF 43 usage_00455.pdb 1 --VKVAYVQMN-PQIL--------------EPDKNYSKAEKLIKEASKQGAQLVVLPELF 43 usage_00464.pdb 1 --VKVAYVQMN-PQIL--------------EPDKNYSKAEKLIKEASKQGAQLVVLPELF 43 usage_00609.pdb 1 DTFIAAVYEHA-AILPNATLTPVSREEALALMNRNLDILEGAITSAADQGAHIIVTPEDA 59 a v kN ae I A qga vvlPE f usage_00127.pdb 45 DFI--GL-NKNEQIDLA 58 usage_00281.pdb 44 DTGYNFETREEVFEIA- 59 usage_00282.pdb 44 DTGYNFETREEVFEIA- 59 usage_00455.pdb 44 DTGYNFETREEVFEIA- 59 usage_00464.pdb 44 DTGYNFETREEVFEIA- 59 usage_00609.pdb 60 IYGWNFN-RDSLYPYL- 74 d g f r #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################