################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:36 2021 # Report_file: c_1384_29.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00005.pdb # 2: usage_00068.pdb # 3: usage_00069.pdb # 4: usage_00080.pdb # 5: usage_00106.pdb # 6: usage_00117.pdb # 7: usage_00188.pdb # 8: usage_00195.pdb # 9: usage_00282.pdb # 10: usage_00316.pdb # 11: usage_00327.pdb # 12: usage_00328.pdb # 13: usage_00409.pdb # 14: usage_00410.pdb # # Length: 45 # Identity: 2/ 45 ( 4.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 45 ( 37.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 45 ( 24.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 KSGYLSSERLIPQRVMDQHKL------TRDQWEDRIQVWHAEH-- 37 usage_00068.pdb 1 --GYLANDRLLPQRVLEQHKL------TKEQWEERIQNWHEEHR- 36 usage_00069.pdb 1 --GYLANDRLLPQRVLEQHKL------TKEQWEERIQNWHEEHR- 36 usage_00080.pdb 1 --GYLAGDKLLPQRVLEQHKL------NKDQWEERIQVWHEEH-- 35 usage_00106.pdb 1 --GYLAGDKLLPQRVLEQHKL------NKDQWEERIQVWHEEHR- 36 usage_00117.pdb 1 KPGYLANDRLLPQRVLEQHKL------TKEQWEERIQNWHEEH-- 37 usage_00188.pdb 1 --GFLANDRLLPQRVTDQHKM------SREEWEQSITNWWQEHR- 36 usage_00195.pdb 1 --GYLANDRLLPQRVLEQHKL------TKEQWEERIQNWHEEHR- 36 usage_00282.pdb 1 --GYLANDRLLPQRVLEQHKL------TKEQWEERIQNWHEEHR- 36 usage_00316.pdb 1 PPLAFERI-DLPEQLAAQLLEPREQSKQCFQYKLEVWNRAHAEMG 44 usage_00327.pdb 1 --GYLSSERLIPQRVMDQHKL------TRDQWEDRIQVWHAEH-- 35 usage_00328.pdb 1 --GYLSSERLIPQRVMDQHKL------TRDQWEDRIQVWHAEHR- 36 usage_00409.pdb 1 --GYLANDRLLPQRVLEQHKL------TKEQWEERIQNWHEEHR- 36 usage_00410.pdb 1 --GYLANDRLLPQRVLEQHKL------TKEQWEERIQNWHEEHR- 36 g l l Pqrv Qhk qwe i w eh #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################