################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:11 2021 # Report_file: c_1261_344.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00106.pdb # 2: usage_00463.pdb # 3: usage_00464.pdb # 4: usage_01582.pdb # 5: usage_03848.pdb # 6: usage_03849.pdb # 7: usage_03867.pdb # 8: usage_03868.pdb # 9: usage_03869.pdb # 10: usage_03870.pdb # 11: usage_04737.pdb # # Length: 31 # Identity: 1/ 31 ( 3.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 31 ( 22.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 31 ( 29.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00106.pdb 1 V-MIQS-FSDESLKKIHRQNKH-VPLVKLV- 27 usage_00463.pdb 1 PVTAWDVRQAPEALRHLSQARHVGKLVLTM- 30 usage_00464.pdb 1 PVTAWDVRQAPEALRHLSQARHVGKLVL--- 28 usage_01582.pdb 1 --TVFPRTKVEAAFRYMAQGKHIGKVVIQV- 28 usage_03848.pdb 1 --TVFHGAQVEDAFRYMAQGKHIGKVVVQV- 28 usage_03849.pdb 1 --TVFHGAQVEDAFRYMAQGKHIGKVVVQV- 28 usage_03867.pdb 1 --TVFHGAQVEDAFRYMAQGKHIGKVVVQV- 28 usage_03868.pdb 1 --TVFHGAQVEDAFRYMAQGKHIGKVVVQVL 29 usage_03869.pdb 1 --TVFHGAQVEDAFRYMAQGKHIGKVVVQV- 28 usage_03870.pdb 1 --TVFHGAQVEDAFRYMAQ--HIGKVVVQV- 26 usage_04737.pdb 1 --KVFAFEDVADAHRLLEEGSHVGKVLTV-- 27 a r q H gk v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################