################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:18 2021 # Report_file: c_0735_33.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00015.pdb # 2: usage_00016.pdb # 3: usage_00023.pdb # 4: usage_00048.pdb # 5: usage_00069.pdb # 6: usage_00070.pdb # 7: usage_00071.pdb # 8: usage_00072.pdb # 9: usage_00073.pdb # 10: usage_00242.pdb # # Length: 58 # Identity: 9/ 58 ( 15.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 58 ( 36.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 58 ( 29.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 -----------LFKNQYGHIRVLQRFDQQSKRLQNLEDYRLVEFRSKPETLLLPQQAD 47 usage_00016.pdb 1 -----------LFKNQYGHIRVLQRFDQQSKRLQNLEDYRLVEFRSKPETLLLPQQAD 47 usage_00023.pdb 1 -----------LFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLL----- 42 usage_00048.pdb 1 -----------LFRNQFGHLRVLQRFDQRSKQMQNLENYRVVEFNSKPNTLLLPHHAD 47 usage_00069.pdb 1 -----------LYRNEWGHIRVLQRFDQRSKQMQNLENYRVVEFKSKPNTLLL----- 42 usage_00070.pdb 1 -----------LYRNEWGHIRVLQRFDQRSKQMQNLENYRVVEFKSKPNTLLL----- 42 usage_00071.pdb 1 -----------LFTNQYGHLRILHRFDQRSKQIQNLENYRVVEFKSKPNTLLL----- 42 usage_00072.pdb 1 -----------LFTNQYGHLRILHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHAD 47 usage_00073.pdb 1 -----------LFTNQYGHLRILHRFDQRSKQIQNLENYRVVEFKSKPNTLLL----- 42 usage_00242.pdb 1 YYFHSQGLRSRHE-SGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKD 57 l n G r L RF nle YR ve skP TllL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################