################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:39 2021 # Report_file: c_1407_73.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00159.pdb # 2: usage_01030.pdb # 3: usage_01049.pdb # 4: usage_01097.pdb # 5: usage_01098.pdb # # Length: 72 # Identity: 23/ 72 ( 31.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 72 ( 33.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 72 ( 15.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00159.pdb 1 TAQEAYDVFNKHVESAWKDLNQEFLKP-TEMPTEVLNRSLNLARVMDVLYRE-----YVG 54 usage_01030.pdb 1 -EEYAKNLLYKQVEDLWKDINREYLI-TKTIPRPLLVAVINLVHFLDVLYAEKDNFTRMG 58 usage_01049.pdb 1 -EEYAKNLLYKQVEDLWKDINREYLI-TKTIPRPLLVAVINLVHFLDVLYAAKDAFTAMG 58 usage_01097.pdb 1 TAQEAYDVFNKHVESAWKDLNQEFLKP-TEMPTEVLNRSLNLARVMDVLYRE-----YVG 54 usage_01098.pdb 1 TAQEAYDVFNKHVESAWKDLNQEFLKP-TEMPTEVLNRSLNLARVMDVLYREGDG----G 55 A K VE WKD N E L P L NL DVLY e G usage_00159.pdb 55 KAAKGGITSLLI 66 usage_01030.pdb 59 EEYKNLVKSLLV 70 usage_01049.pdb 59 EEYKNLVKSLL- 69 usage_01097.pdb 55 KAAKGGITSLLI 66 usage_01098.pdb 56 KAAKGGITSLLI 67 K SLL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################