################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:36 2021 # Report_file: c_0677_127.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01051.pdb # 2: usage_01194.pdb # 3: usage_01210.pdb # 4: usage_01211.pdb # 5: usage_01413.pdb # 6: usage_01575.pdb # # Length: 92 # Identity: 17/ 92 ( 18.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 92 ( 18.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 69/ 92 ( 75.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01051.pdb 1 ----------------------------KESLKWLCVKGIP-P--VGVFVQFAINNCIKL 29 usage_01194.pdb 1 ----------------------------KESLKWLCVKGIP-PKDVGVFVQFAINNCIKL 31 usage_01210.pdb 1 ----------------------------RESLQWICVKGIP-P-VSLN-VQLSVSSCIKL 29 usage_01211.pdb 1 ----------------------------RESLQWICVKGIP-P-VSLN-VQLSVSSCIKL 29 usage_01413.pdb 1 ----------------------------KESLKWLCVKGIPK--DVGVFVQFAINNCIKL 30 usage_01575.pdb 1 PFVVTPPLFRLDAKQQNSLRIAQAFPRDKESLKWLCVKGIP-P-----------NNCIKL 48 ESL W CVKGIP CIKL usage_01051.pdb 30 LVRPNELKGTPIQFAENLSWKVDGKLIAENP- 60 usage_01194.pdb 32 LVRPNELKGTPIQFAENLSWKVDGGKLIAENP 63 usage_01210.pdb 30 FVRPPAVKGRPDDVAGKVEWQRAGNRLKGVN- 60 usage_01211.pdb 30 FVRPPAVKGRPDDVAGKVEWQRAGNRLKGVN- 60 usage_01413.pdb 31 LVRPNELKGTPIQFAENLSWKVDGGKLIAENP 62 usage_01575.pdb 49 LVRP---------------------------- 52 VRP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################