################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:19 2021 # Report_file: c_0821_48.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00138.pdb # 2: usage_00263.pdb # 3: usage_00265.pdb # 4: usage_00266.pdb # 5: usage_00267.pdb # 6: usage_01217.pdb # 7: usage_01245.pdb # # Length: 70 # Identity: 2/ 70 ( 2.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 70 ( 12.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 70 ( 32.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00138.pdb 1 DPEVLKRPEYFGKF-GKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVV 59 usage_00263.pdb 1 -NQEVHD--LL-SD-YELKYCFVDKY---------KGTAFVTLLNGEQAEAAINAFHQSR 46 usage_00265.pdb 1 -NQEVHD--LL-SD-YELKYCFVDKY---------KGTAFVTLLNGEQAEAAINAFHQSR 46 usage_00266.pdb 1 -NQEVHD--LL-SD-YELKYCFVDKY---------KGTAFVTLLNGEQAEAAINAFHQSR 46 usage_00267.pdb 1 --QEVHD--LL-SD-YELKYCFVDKY---------KGTAFVTLLNGEQAEAAINAFHQSR 45 usage_01217.pdb 1 TEDEFKR--LF-AKYGEPGEVFINKG---------KGFGFIKLESRALAEIAKAELDDTP 48 usage_01245.pdb 1 ----------FSEF-GKLERVKKLK-----------DYAFVHFEDRGAAVKAMDEMNGKE 38 k afv A A usage_00138.pdb 60 VDGRTLKASL 69 usage_00263.pdb 47 LRERELSVQL 56 usage_00265.pdb 47 LRERELSVQL 56 usage_00266.pdb 47 LRERELSVQL 56 usage_00267.pdb 46 LRERELSVQL 55 usage_01217.pdb 49 MRGRQLRVRF 58 usage_01245.pdb 39 IEGEEIEIVL 48 r l l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################