################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:10 2021 # Report_file: c_1081_18.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00012.pdb # 2: usage_00013.pdb # 3: usage_00014.pdb # 4: usage_00119.pdb # 5: usage_00120.pdb # 6: usage_00180.pdb # 7: usage_00281.pdb # 8: usage_00469.pdb # 9: usage_00632.pdb # 10: usage_00671.pdb # # Length: 64 # Identity: 7/ 64 ( 10.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 64 ( 26.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 64 ( 35.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 LEGAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGP--PGTGKSYLAKAVATEANST-F 57 usage_00013.pdb 1 LEGAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGP--PGTGKSYLAKAVATEANST-F 57 usage_00014.pdb 1 --GAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGP--PGTGKSYLAKAVATEANST-F 55 usage_00119.pdb 1 ---AKEALKEAVILPVKFPHLFKGNRKPTSGILLYGP--PGTGKSYLAKAVATEANST-F 54 usage_00120.pdb 1 LEGAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGP--PGTGKSYLAKAVATEANST-F 57 usage_00180.pdb 1 --FDKETFKSITSK-G-----------KI-PHIILHSPSPGTGKTTVAKALCHDVNAD-M 44 usage_00281.pdb 1 LDDVKEALREAIIYPTKRPDLFP--LGWPRGILLYGP--PGCGKTMIAAAVANEIDSI-F 55 usage_00469.pdb 1 LEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGP--PGTGKSYLAKAVATEANNSTF 58 usage_00632.pdb 1 LEDVKEALKEAVVYPSKRPDLFP--LGWPRGILLYGP--PGCGKTMIAAAVANELDSE-F 55 usage_00671.pdb 1 LEDVKRELQELV-Q---------------KGVLFYGP--PGCGKTLLAKAIANECQAN-F 41 Ke l e g l gp PG GK A A a e f usage_00012.pdb 58 FSVS 61 usage_00013.pdb 58 FSVS 61 usage_00014.pdb 56 FSVS 59 usage_00119.pdb 55 FSVS 58 usage_00120.pdb 58 FSVS 61 usage_00180.pdb 45 MFVN 48 usage_00281.pdb 56 MQLD 59 usage_00469.pdb 59 FSIS 62 usage_00632.pdb 56 IHVD 59 usage_00671.pdb 42 ISIK 45 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################