################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:15:47 2021 # Report_file: c_0658_8.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00200.pdb # 2: usage_00202.pdb # 3: usage_00204.pdb # 4: usage_00206.pdb # 5: usage_00208.pdb # 6: usage_00210.pdb # 7: usage_00212.pdb # 8: usage_00215.pdb # 9: usage_00217.pdb # 10: usage_00219.pdb # 11: usage_00221.pdb # 12: usage_00728.pdb # 13: usage_01150.pdb # 14: usage_01202.pdb # 15: usage_01204.pdb # 16: usage_01245.pdb # # Length: 45 # Identity: 15/ 45 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 45 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 45 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00200.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00202.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00204.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00206.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00208.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00210.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00212.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00215.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00217.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00219.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00221.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_00728.pdb 1 NLIKGEYNGGNYFRIIDMTPNALIGYDVNVDSKGKITKVALLMGR 45 usage_01150.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_01202.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_01204.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 usage_01245.pdb 1 NTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGK 45 NtydvnYaGnNkFvvsyasetALIisniNVDeeGdkTimtgLlGk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################