################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:24 2021 # Report_file: c_1370_161.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00112.pdb # 2: usage_00369.pdb # 3: usage_00370.pdb # 4: usage_00457.pdb # 5: usage_00507.pdb # 6: usage_01519.pdb # 7: usage_01575.pdb # # Length: 97 # Identity: 5/ 97 ( 5.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 97 ( 14.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 66/ 97 ( 68.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00112.pdb 1 SP------------------------EELKGIFEKYDK-----------EGDGQLSKEEL 25 usage_00369.pdb 1 --------------------------VELNKIFQRMDK-----------NGDGQLDKQEL 23 usage_00370.pdb 1 --------------------------VELNKIFQRMDK-----------NGDGQLDKQEL 23 usage_00457.pdb 1 -T------------------------KELTAIFHKMDK-----------NGDGQLDRAEL 24 usage_00507.pdb 1 ----------------------------LTEIFRKLDT-----------NNDGMLDRDEL 21 usage_01519.pdb 1 ---DNAILNIRQFQGTQKLAQAALLYMGSKLTSQDETKELTAIFHKMDKNGDGQLDRAEL 57 usage_01575.pdb 1 --LDNAILNIRQFQGTQKLAQAALLYMGSKLTSQDETKELTAIFHKMDKNGDGQLDRAEL 58 k ngDGqLd EL usage_00112.pdb 26 KLLLQTEFPSLLKG---MS-----TLDELFEELDK-- 52 usage_00369.pdb 24 MEGYVEL--MKLKGEDVS-ALDQSAIEFEVEQVLDA- 56 usage_00370.pdb 24 MEGYVEL--MKLKGEDVS-ALDQSAIEFEVEQVLDA- 56 usage_00457.pdb 25 IEGYKEL--MRMKGQDAS-MLDASAVEHEVDQVLDA- 57 usage_00507.pdb 22 VRGYHEF--MRLKGVDSN-SLI--------------Q 41 usage_01519.pdb 58 IEGYKEL--MRMKGQDAS-MLDASAVEHEVDQVLD-- 89 usage_01575.pdb 59 IEGYKEL--MR----DAS-MLDASAVEHEVDQVL--- 85 gy e m #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################