################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:20 2021 # Report_file: c_1423_43.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00503.pdb # 2: usage_00801.pdb # 3: usage_00869.pdb # 4: usage_00870.pdb # 5: usage_00903.pdb # 6: usage_00909.pdb # 7: usage_00929.pdb # 8: usage_01048.pdb # 9: usage_01049.pdb # # Length: 62 # Identity: 12/ 62 ( 19.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 54/ 62 ( 87.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 62 ( 12.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00503.pdb 1 --LAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYL-- 56 usage_00801.pdb 1 ----IEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSIICLVFSFLHM 56 usage_00869.pdb 1 NRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIH 60 usage_00870.pdb 1 --LAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYL-- 56 usage_00903.pdb 1 --LAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYL-- 56 usage_00909.pdb 1 -RLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYL-- 57 usage_00929.pdb 1 --LAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIH 58 usage_01048.pdb 1 --LAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIH 58 usage_01049.pdb 1 -RLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYL-- 57 IhntlLlssytkldarLkpmVLlVKhwakrkqiNspyfGtLssygyvlmVlyyL usage_00503.pdb -- usage_00801.pdb -- usage_00869.pdb 61 VI 62 usage_00870.pdb -- usage_00903.pdb -- usage_00909.pdb -- usage_00929.pdb 59 VI 60 usage_01048.pdb 59 VI 60 usage_01049.pdb -- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################