################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:28:06 2021
# Report_file: c_1292_56.html
################################################################################################
#====================================
# Aligned_structures: 15
#   1: usage_00003.pdb
#   2: usage_00430.pdb
#   3: usage_00431.pdb
#   4: usage_00432.pdb
#   5: usage_00695.pdb
#   6: usage_00741.pdb
#   7: usage_00996.pdb
#   8: usage_00997.pdb
#   9: usage_00998.pdb
#  10: usage_00999.pdb
#  11: usage_01005.pdb
#  12: usage_01071.pdb
#  13: usage_01072.pdb
#  14: usage_01158.pdb
#  15: usage_01159.pdb
#
# Length:         30
# Identity:        2/ 30 (  6.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     22/ 30 ( 73.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            8/ 30 ( 26.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00003.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_00430.pdb         1  SFLGRYMSALNH-TKKWKFPQVGGLTSIKW   29
usage_00431.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_00432.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_00695.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_00741.pdb         1  SFLGRYMSALNH-TKKWKFPQVGGLTSIK-   28
usage_00996.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_00997.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_00998.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_00999.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_01005.pdb         1  ----GRYFARFEE-SPTRKVTINGSVMK--   23
usage_01071.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIK-   27
usage_01072.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIK-   27
usage_01158.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIKW   28
usage_01159.pdb         1  -FLGRYMSALNH-TKKWKFPQVGGLTSIK-   27
                               rymsAlnh  kkwkfpqvgGltsi  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################