################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:32 2021 # Report_file: c_1376_68.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00013.pdb # 2: usage_00093.pdb # 3: usage_00237.pdb # 4: usage_00280.pdb # 5: usage_00281.pdb # 6: usage_00282.pdb # 7: usage_00453.pdb # 8: usage_00592.pdb # 9: usage_00593.pdb # 10: usage_00594.pdb # 11: usage_00595.pdb # 12: usage_00769.pdb # 13: usage_01044.pdb # 14: usage_01212.pdb # # Length: 33 # Identity: 0/ 33 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 33 ( 15.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 33 ( 27.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00013.pdb 1 TDDQRNRLQEACKDILLFKNLDPEQMSQVLDAM 33 usage_00093.pdb 1 TDDQRNRLQEACKDILLFKNLDPEQMSQVLDAM 33 usage_00237.pdb 1 TDEQRCRLQEACKDILLFKNLDQEQLSQVLDAM 33 usage_00280.pdb 1 TDDQRNRLQEACKDILLFKNLDPEQMSQVLDAM 33 usage_00281.pdb 1 TDDQRNRLQEACKDILLFKNLDPEQMSQVLDAM 33 usage_00282.pdb 1 TDDQRNRLQEACKDILLFKNLDPEQMSQVLDAM 33 usage_00453.pdb 1 TDDQRNRLQEACKDILLFKNLDPEQMSQVLDAM 33 usage_00592.pdb 1 TDEQRCRLQEACKDILLFKNLDQEQLSQVLDAM 33 usage_00593.pdb 1 TDEQRCRLQEACKDILLFKNLDQEQLSQVLDAM 33 usage_00594.pdb 1 TDEQRCRLQEACKDILLFKNLDQEQLSQVLDAM 33 usage_00595.pdb 1 TDEQRCRLQEACKDILLFKNLDQEQLSQVLDAM 33 usage_00769.pdb 1 --------QQLLQSHHLFEPLSPVQLQELLASS 25 usage_01044.pdb 1 ----LQRLEKSIRNNFLFNKLDSDSKRLVINC- 28 usage_01212.pdb 1 -AKKRKMYEDILSHVNILKDMDPYERCKVADCL 32 lf ld v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################