################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:01 2021 # Report_file: c_1292_44.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00307.pdb # 2: usage_00386.pdb # 3: usage_00395.pdb # 4: usage_00435.pdb # 5: usage_00490.pdb # 6: usage_00491.pdb # 7: usage_00828.pdb # 8: usage_01036.pdb # 9: usage_01184.pdb # 10: usage_01866.pdb # # Length: 31 # Identity: 28/ 31 ( 90.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 31 ( 90.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 31 ( 9.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00307.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 usage_00386.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 usage_00395.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADA--- 28 usage_00435.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 usage_00490.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 usage_00491.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 usage_00828.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 usage_01036.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 usage_01184.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 usage_01866.pdb 1 AWSEVTDPEKGFIDDDKVTFEVFVQADAPHG 31 AWSEVTDPEKGFIDDDKVTFEVFVQADA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################