################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:47 2021 # Report_file: c_1370_9.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00179.pdb # 2: usage_00216.pdb # 3: usage_00504.pdb # 4: usage_00745.pdb # 5: usage_00784.pdb # 6: usage_00864.pdb # 7: usage_00976.pdb # 8: usage_01021.pdb # 9: usage_01039.pdb # 10: usage_01662.pdb # # Length: 88 # Identity: 12/ 88 ( 13.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 88 ( 30.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/ 88 ( 33.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00179.pdb 1 TAD--QMVSALLDAEPPILYSE-----PF-SEASMMGLLTNLADRELVHMINWAKRVPGF 52 usage_00216.pdb 1 TAD--QMVSALLDAEPPILYSEYDPTRPF-SEASMMGLLTNLADRELVHMINWAKRVPGF 57 usage_00504.pdb 1 -----KIVSHLLVAEPEKIYAMPDPTVPD-SDIKALTTLCDLADRELVVIIGWAKHIPGF 54 usage_00745.pdb 1 SPE--QLVLTLLEAEPPNVLVS----MPF-TEASMMMSLTKLADKELVHMIGWAKKIPGF 53 usage_00784.pdb 1 TAD--QMVSALLDAEPPILYSEYDPTRPF-SEASMMGLLTNLADRELVHMINWAKRVPGF 57 usage_00864.pdb 1 TAD--QMVSALLDAEPPILYSEYDPTRPF-SEASMMGLLTNLADRELVHMINWAKRVPGF 57 usage_00976.pdb 1 TAD--QMVSALLDAEPPILYSEYDPTRPF-SEASMMGLLTNLADRELVHMINWAKRVPGF 57 usage_01021.pdb 1 ---LQ------------------EQ--SKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGF 37 usage_01039.pdb 1 TAD--QMVSALLDAEPPILYSEY-----F-SEASMMGLLTNLADRELVHMINWAKRVPGF 52 usage_01662.pdb 1 -----KIVSHLLVAEPEKIYAMPDPTVPD-SDIKALTTLCDLADRELVVIIGWAKHIPGF 54 l lad elv i wAK PGF usage_00179.pdb 53 VDLTLHDQVHLLESAWLEILMIGLVWRS 80 usage_00216.pdb 58 VDLTLHDQVHLLECAWLEILMIGLVWRS 85 usage_00504.pdb 55 STLSLADQMSLLQSAWMEILILGVVYRS 82 usage_00745.pdb 54 VELSLLDQVRLLESCWMEVLMVGLMWRS 81 usage_00784.pdb 58 VDLTLHDQVHLLECAWLEILMIGLVWRS 85 usage_00864.pdb 58 VDLTLHDQVHLLECAWLEILMIGLVWRS 85 usage_00976.pdb 58 VDLTLHDQVHLLECAWLEILMIGLVWRS 85 usage_01021.pdb 38 VNLDLNDQVTLLKYGVHEIIYTMLASLM 65 usage_01039.pdb 53 VDLTLHDQVHLLECAWLEILMIGLVWRS 80 usage_01662.pdb 55 STLSLADQMSLLQSAWMEILILGVVYRS 82 L L DQ LL w Eil g rs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################