################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:06 2021 # Report_file: c_1320_12.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00030.pdb # 2: usage_00031.pdb # 3: usage_00033.pdb # 4: usage_00111.pdb # 5: usage_00142.pdb # 6: usage_00210.pdb # 7: usage_00232.pdb # 8: usage_00233.pdb # 9: usage_00234.pdb # 10: usage_00580.pdb # 11: usage_00581.pdb # # Length: 31 # Identity: 1/ 31 ( 3.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 31 ( 80.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 31 ( 19.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00030.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00031.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00033.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00111.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00142.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00210.pdb 1 DGHLCIQEALIHFK---ELSGAGVCSLWK-- 26 usage_00232.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00233.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00234.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00580.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 usage_00581.pdb 1 EAEI-SGSVAVFDIKAMTGDGSDPEFKTLPI 30 eaei sgsvavfdi tgdGsdpefktl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################