################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:24:39 2021 # Report_file: c_0662_13.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00205.pdb # 2: usage_00206.pdb # 3: usage_00231.pdb # 4: usage_00232.pdb # 5: usage_00233.pdb # 6: usage_00234.pdb # 7: usage_00235.pdb # 8: usage_00236.pdb # 9: usage_00237.pdb # 10: usage_00382.pdb # # Length: 57 # Identity: 36/ 57 ( 63.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/ 57 ( 96.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 57 ( 3.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00205.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFV-- 55 usage_00206.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFV-- 55 usage_00231.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGD 57 usage_00232.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGD 57 usage_00233.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFV-- 55 usage_00234.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFV-- 55 usage_00235.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFV-- 55 usage_00236.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFV-- 55 usage_00237.pdb 1 EWEFLPPILSANCVTDQTERPQIYFKDGKSYLFTISHRGTFAAGLDGPEGVYGFVGD 57 usage_00382.pdb 1 EWQILPPLITAVGVNDQTERPHFVFQDGKYYLFTISHKYTFADNLTGPDGVYGFVSD 57 EWefLPPilsAncVtDQTERPqiyFkDGKsYLFTISHrgTFAagLdGPeGVYGFV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################