################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:42:55 2021
# Report_file: c_1153_222.html
################################################################################################
#====================================
# Aligned_structures: 16
#   1: usage_00137.pdb
#   2: usage_00268.pdb
#   3: usage_00394.pdb
#   4: usage_00395.pdb
#   5: usage_00826.pdb
#   6: usage_01349.pdb
#   7: usage_01441.pdb
#   8: usage_01510.pdb
#   9: usage_01523.pdb
#  10: usage_01524.pdb
#  11: usage_02120.pdb
#  12: usage_02295.pdb
#  13: usage_02441.pdb
#  14: usage_02455.pdb
#  15: usage_02529.pdb
#  16: usage_02530.pdb
#
# Length:         32
# Identity:        8/ 32 ( 25.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     24/ 32 ( 75.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            8/ 32 ( 25.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00137.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_00268.pdb         1  -GYYVEMTVGSPPQTLNILVDTGSSNFAVG--   29
usage_00394.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_00395.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_00826.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_01349.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_01441.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_01510.pdb         1  -GYYVEMTVGSPPQTLNILVDTGSSNFAVGAA   31
usage_01523.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_01524.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_02120.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_02295.pdb         1  -GYYVEMTVGSPPQTLNILVDTGSSNFAVG--   29
usage_02441.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_02455.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_02529.pdb         1  ------MTVGSPPQTLNILVDTGSSNFAVG--   24
usage_02530.pdb         1  LMFYGEGQIGTNKQPFMFIFDTGSANLWVP--   30
                                 mtvGsppQtlnilvDTGSsNfaVg  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################