################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:06 2021 # Report_file: c_0870_25.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00018.pdb # 2: usage_00037.pdb # 3: usage_00046.pdb # 4: usage_00052.pdb # 5: usage_00381.pdb # # Length: 65 # Identity: 4/ 65 ( 6.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 65 ( 36.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 65 ( 13.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 ---LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR 57 usage_00037.pdb 1 ----TPSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR 56 usage_00046.pdb 1 ---LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR 57 usage_00052.pdb 1 ------TTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR 54 usage_00381.pdb 1 KTVRQERLKSIVRILERSK---EPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPR 57 emy r iy l a iAE L s v q va dg va R usage_00018.pdb 58 SLQMT 62 usage_00037.pdb 57 GLVLT 61 usage_00046.pdb 58 SLQMT 62 usage_00052.pdb 55 SLQMT 59 usage_00381.pdb 58 GYVLA 62 l t #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################