################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:24:40 2021 # Report_file: c_0666_35.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00084.pdb # 2: usage_00088.pdb # 3: usage_00148.pdb # 4: usage_00196.pdb # 5: usage_00232.pdb # 6: usage_00234.pdb # 7: usage_00263.pdb # 8: usage_00304.pdb # 9: usage_00312.pdb # 10: usage_00368.pdb # # Length: 54 # Identity: 6/ 54 ( 11.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 54 ( 24.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 54 ( 25.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00084.pdb 1 -FSGSGSGTSYSLTISRMEAEDAATYYCQQRS-S---YPITFGSGTKLEIKRA- 48 usage_00088.pdb 1 RFSGSGSGTSYSLTINTMEAEDAATYYCQQWS-S---HPQTFGGGTKLEI---- 46 usage_00148.pdb 1 -FSGRRWGQEYNLTINNLQPEDIATYFCQVY--------EFVVPGTRLDL---- 41 usage_00196.pdb 1 -FSGSGSGTSYSLTISRMEAEDAATYYCQQRS-T---YPFTFGGGTKLEL---- 45 usage_00232.pdb 1 -FSGSKSGNTASLTVSGLQAEDEADYYCSSYE-G--SDNFVFGTGTKVTVL-G- 48 usage_00234.pdb 1 RFSGSGSGTSYSLTISSMEAEDAATYYCQQYH-S---YPPTFGGGTKLEI---- 46 usage_00263.pdb 1 FCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVI-D- 52 usage_00304.pdb 1 -FSGSRWGPDYNLTISNLESGDFGVYYCQQY--------EFFGQGTKVQ----- 40 usage_00312.pdb 1 -FSGSGSGTDYSLTISNLEQEDIATYFCQQGN-T---LPWTFGGGSKLEI---- 45 usage_00368.pdb 1 -FSGSGSGRDYSFSISNVESEDIASYYCLQYD-N---LPYMFGAGTKLELK-RA 48 fSG g lti D Y C g Gt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################