################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:23 2021 # Report_file: c_1332_51.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00247.pdb # 2: usage_00253.pdb # 3: usage_00326.pdb # 4: usage_00327.pdb # 5: usage_00494.pdb # 6: usage_00495.pdb # 7: usage_00544.pdb # 8: usage_00545.pdb # 9: usage_00546.pdb # 10: usage_00547.pdb # 11: usage_00636.pdb # 12: usage_00671.pdb # 13: usage_00939.pdb # 14: usage_00940.pdb # # Length: 39 # Identity: 0/ 39 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 39 ( 12.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 39 ( 33.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00247.pdb 1 -----EEANRTLTGH-LAYHFSPTETSRQNLLR------ 27 usage_00253.pdb 1 -----GADVHCKVS-GVADHYAEDDDHALAIARRCVANL 33 usage_00326.pdb 1 FEELGGARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL 38 usage_00327.pdb 1 -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL 33 usage_00494.pdb 1 -----GAVVHATKS-GVVHFMVDSEQEAINLTKRLLSY- 32 usage_00495.pdb 1 -----GAVVHATKS-GVVHFMVDSEQEAINLTKRLLSYL 33 usage_00544.pdb 1 -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL 33 usage_00545.pdb 1 -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLS-- 31 usage_00546.pdb 1 -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL 33 usage_00547.pdb 1 -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLS-- 31 usage_00636.pdb 1 -----GGDLHSRTS-GVTDHLADDDEDALRIVRAIADTF 33 usage_00671.pdb 1 -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSY- 32 usage_00939.pdb 1 -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL 33 usage_00940.pdb 1 -----GARTHNSTS-GVAHHMAGDEKDAVEYVKQLLSYL 33 g h s v a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################