################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:57 2021 # Report_file: c_0786_101.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00231.pdb # 2: usage_00234.pdb # 3: usage_00235.pdb # 4: usage_00236.pdb # 5: usage_00909.pdb # 6: usage_01128.pdb # 7: usage_01137.pdb # # Length: 70 # Identity: 25/ 70 ( 35.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 70 ( 37.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 70 ( 2.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00231.pdb 1 YGGDYNPEQWDKATMEEDMRMFNLAGIDVATVNVFSWAKIQRDEVSYDFTWLDDIIERLT 60 usage_00234.pdb 1 YGGDYNPEQWDKATMEEDMRMFNLAGIDVATVNVFSWAKIQRDEVSYDFTWLDDIIERLT 60 usage_00235.pdb 1 YGGDYNPEQWDKATMEEDMRMFNLAGIDVATVNVFSWAKIQRDEVSYDFTWLDDIIERLT 60 usage_00236.pdb 1 YGGDYNPEQWDKATMEEDMRMFNLAGIDVATVNVFSWAKIQRDEVSYDFTWLDDIIERLT 60 usage_00909.pdb 1 --ADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLY 58 usage_01128.pdb 1 --ADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLY 58 usage_01137.pdb 1 --GDYNPDQWPEEVWDDDIRLMKKAGVNLVSVGIFSWAKIEPEEGKYDFDWLDRAIDKLG 58 DYNP QW eD R AG FSWA I F WLD I L usage_00231.pdb 61 KENIYLCLAT 70 usage_00234.pdb 61 KENIYLCLAT 70 usage_00235.pdb 61 KENIYLCLAT 70 usage_00236.pdb 61 KENIYLCLAT 70 usage_00909.pdb 59 KAGIAVDLAS 68 usage_01128.pdb 59 KAGIAVDLAS 68 usage_01137.pdb 59 KAGIAVDLAS 68 K I LA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################