################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:49 2021 # Report_file: c_1228_46.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00001.pdb # 2: usage_00135.pdb # 3: usage_00162.pdb # 4: usage_00326.pdb # 5: usage_00327.pdb # 6: usage_00328.pdb # 7: usage_00786.pdb # # Length: 63 # Identity: 8/ 63 ( 12.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 63 ( 34.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 36/ 63 ( 57.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 DKIIKFEGCYHGHADMFLVKAGSGVAT-LGLPSSPGVPKKTTANTLTTPYNDLEAVKALF 59 usage_00135.pdb 1 EKVIKFEGCYHGH-----------------------------AATLTAPYNDLEAVSRLF 31 usage_00162.pdb 1 RMILRFEG--------------------------------TTANTLLIRPDDIEGMREVF 28 usage_00326.pdb 1 DKIIKFEGCYHGHADM--------------------------ANTLTTPYNDLEAVKALF 34 usage_00327.pdb 1 DKIIKFEG-----------------------------------NTLTTPYNDLEAVKALF 25 usage_00328.pdb 1 DKIIKFEGCYHGH------------------------------NTLTTPYNDLEAVKALF 30 usage_00786.pdb 1 DKIIKFEGCYHGHADMFLVK-------AG-LPSSPGVPKKTTANTLTTPYNDLEAVKALF 52 kiikFEG nTLt pynDlEav lF usage_00001.pdb 60 AE- 61 usage_00135.pdb 32 EQY 34 usage_00162.pdb 29 AN- 30 usage_00326.pdb 35 AEN 37 usage_00327.pdb 26 AEN 28 usage_00328.pdb 31 AEN 33 usage_00786.pdb 53 AEN 55 a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################