################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:12:20 2021 # Report_file: c_0650_2.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00324.pdb # 2: usage_00429.pdb # 3: usage_00430.pdb # 4: usage_00467.pdb # 5: usage_01004.pdb # # Length: 68 # Identity: 19/ 68 ( 27.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/ 68 ( 85.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 68 ( 14.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00324.pdb 1 --NVYLTGSVSELGNADPAKA-IGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGST 57 usage_00429.pdb 1 GDTVYITGNRAELGSWDTKQYPIQLYYDSHSN---DWRGNVVLPAERNIEFKAFIKSKDG 57 usage_00430.pdb 1 GDTVYITGNRAELGSWDTKQYPIQLYYDSHSN---DWRGNVVLPAERNIEFKAFIKSKDG 57 usage_00467.pdb 1 -DTVYITGNRAELGSWDTKQYPIQLYYDSHSN---DWRGNVVLPAERNIEFKAFIKSKDG 56 usage_01004.pdb 1 -DTVYITGNRAELGSWDTKQYPIQLYYDSHSN---DWRGNVVLPAERNIEFKAFIKSKDG 56 tVYiTGnraELGswDtkqy IqlyYdshsn dWrgnVvlPAernIEFKafiKskdg usage_00324.pdb 58 VT-WE--- 61 usage_00429.pdb 58 TVKSWQTI 65 usage_00430.pdb 58 TVKSWQTI 65 usage_00467.pdb 57 TVKSWQTI 64 usage_01004.pdb 57 TVKSWQTI 64 tv sw #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################