################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:32 2021 # Report_file: c_1417_32.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00519.pdb # 2: usage_00520.pdb # 3: usage_00521.pdb # 4: usage_00522.pdb # 5: usage_00523.pdb # 6: usage_01096.pdb # 7: usage_01411.pdb # # Length: 77 # Identity: 10/ 77 ( 13.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 77 ( 44.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 77 ( 7.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00519.pdb 1 -ESMRITLRDGSDGIIERLVGCLGQGRDDGSLA-PCDARHMASALYQLWLGASLLSKLHR 58 usage_00520.pdb 1 -ESMRITLRDGSDGIIERLVGCLGQGRDDGSLA-PCDARHMASALYQLWLGASLLSKLHR 58 usage_00521.pdb 1 -ESMRITLRDGSDGIIERLVGCLGQGRDDGSLA-PCDARHMASALYQLWLGASLLSKLHR 58 usage_00522.pdb 1 ----RITLRDGSDGIIERLVGCLGQGRDDGSLA-PCDARHMASALYQLWLGASLLSKLHR 55 usage_00523.pdb 1 -ESMRITLRDGSDGIIERLVGCLGQGRDDGSLA-PCDARHMASALYQLWLGASLLSKLHR 58 usage_01096.pdb 1 ---FRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLEL 57 usage_01411.pdb 1 SEDMRSAMDKGARGVIALLSQALENGRENHSLTFSGEPLQQAQVLYALWLGANLQAKISR 60 R l g g i rl l gr gsL d A aly lWlGA L Kl r usage_00519.pdb 59 SPGPLETAMQTTRSLL- 74 usage_00520.pdb 59 SPGPLETAMQTTRSLL- 74 usage_00521.pdb 59 SPGPLETAMQTTRSLL- 74 usage_00522.pdb 56 SPGPLETAMQTTRSLL- 71 usage_00523.pdb 59 SPGPLETAMQTTRSLL- 74 usage_01096.pdb 58 RPDPLHSFTRTFGRHFV 74 usage_01411.pdb 61 SFEPLENALAHVKNIIA 77 sp PLe a t #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################