################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:58 2021 # Report_file: c_0993_49.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00043.pdb # 2: usage_00044.pdb # 3: usage_00045.pdb # 4: usage_00054.pdb # 5: usage_00055.pdb # 6: usage_00152.pdb # 7: usage_00307.pdb # 8: usage_00408.pdb # 9: usage_00626.pdb # 10: usage_00627.pdb # # Length: 55 # Identity: 14/ 55 ( 25.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 55 ( 85.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 55 ( 12.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00043.pdb 1 KVEELGLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDAARELRIRDNVRRVMVVK 54 usage_00044.pdb 1 KVEELGLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDAARELRIRDNVRRVMVV- 53 usage_00045.pdb 1 KVEELGLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDAARELRIRDNVRRVMVVK 54 usage_00054.pdb 1 KVAILGLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDLARELRIRDNVRRVMVV- 53 usage_00055.pdb 1 KVAILGLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDLARELRIRDNVRRVMVVK 54 usage_00152.pdb 1 -----GLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDLARELRIRDNVRRVMVVK 49 usage_00307.pdb 1 YEEDWGMRQLAYPIQKFNNARYFLVQFKTENPQLPNELDFQLKIDEDVIRWLNI- 54 usage_00408.pdb 1 KVEELGLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDLARELRIRDNVRRVMVV- 53 usage_00626.pdb 1 KVAILGLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDLARELRIRDNVRRVMVVK 54 usage_00627.pdb 1 KVAILGLRRLAYPIAKDPQGYFLWYQVEM-PEDRVNDLARELRIRDNVRRVMVVK 54 GlRrLAYPIaKdpqgyflwyQvem pedrvNd areLrIrdnVrRvmvv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################