################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:19 2021 # Report_file: c_1219_32.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00520.pdb # 2: usage_01002.pdb # 3: usage_01208.pdb # 4: usage_01365.pdb # 5: usage_01369.pdb # 6: usage_01370.pdb # 7: usage_01385.pdb # 8: usage_01400.pdb # 9: usage_01852.pdb # # Length: 34 # Identity: 3/ 34 ( 8.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 34 ( 23.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 34 ( 17.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00520.pdb 1 EVRYTRPKGGMFVWMELPKGLSAEGLFRRALEEN 34 usage_01002.pdb 1 GVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKG 34 usage_01208.pdb 1 -AEFTKPIAGMFVMFFLPEGADGISFANELME-- 31 usage_01365.pdb 1 GVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKG 34 usage_01369.pdb 1 GVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKG 34 usage_01370.pdb 1 GVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKG 34 usage_01385.pdb 1 GVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKG 34 usage_01400.pdb 1 -VKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKG 33 usage_01852.pdb 1 --SSFTK--DEFDCHILDEGFTAKDILDQKIN-- 28 t p gmF Lp G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################