################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:19 2021 # Report_file: c_1373_19.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00031.pdb # 2: usage_00350.pdb # 3: usage_00796.pdb # 4: usage_00799.pdb # 5: usage_00800.pdb # 6: usage_00977.pdb # 7: usage_01521.pdb # 8: usage_01522.pdb # 9: usage_01557.pdb # 10: usage_01644.pdb # 11: usage_01645.pdb # # Length: 49 # Identity: 9/ 49 ( 18.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 49 ( 83.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 49 ( 16.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00031.pdb 1 --WYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDE-- 45 usage_00350.pdb 1 DKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDE-- 47 usage_00796.pdb 1 --WYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDEL- 46 usage_00799.pdb 1 --WYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDE-- 45 usage_00800.pdb 1 DKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDE-- 47 usage_00977.pdb 1 DKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDE-- 47 usage_01521.pdb 1 DKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDE-- 47 usage_01522.pdb 1 --WYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDE-- 45 usage_01557.pdb 1 -RYQDLAILWNCLGEF-S-PSLQKRLFQKYGIDNPDNKLQFHLL-D-E- 43 usage_01644.pdb 1 DKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDE-- 47 usage_01645.pdb 1 DKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF 49 wyDiAfcvrsirEd g eqyvelfFdllGIkpdweKikyyiL D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################