################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:27:53 2021 # Report_file: c_0395_89.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00076.pdb # 2: usage_00130.pdb # 3: usage_00139.pdb # 4: usage_00533.pdb # 5: usage_00534.pdb # 6: usage_00535.pdb # # Length: 72 # Identity: 12/ 72 ( 16.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 72 ( 34.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 72 ( 18.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00076.pdb 1 DATTLDDNGTMLFFKDEFVWKS-----HR-GIRELISERWKNFIGPVDAAFRH-GHTSVY 53 usage_00130.pdb 1 DGIA-QIRGEIFFFKDRFIWRTVT-PRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAV 58 usage_00139.pdb 1 DGIA-QIRGEIFFFKDRFIWRTVT-PRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAV 58 usage_00533.pdb 1 DAIT-SLRGETMIFKDRFFWRLHPQQ-VD-AELFLTKSFWPELPNRIDAAYEHPSHDLIF 57 usage_00534.pdb 1 ---T-SLRGETMIFKDRFFWRLHPQQ-VD-AELFLTKSFWPELPNRIDAAYEHPSHDLIF 54 usage_00535.pdb 1 ---T-SLRGETMIFKDRFFWRLHPQQ-VD-AELFLTKSFWPELPNRIDAAYEHPSHDLIF 54 rGe FKDrF Wr L fWpelp iDA ye usage_00076.pdb 54 LIKGDKVWVYTS 65 usage_00130.pdb 59 FFAGNEYWIYS- 69 usage_00139.pdb 59 FFAGNEYWIY-- 68 usage_00533.pdb 58 IFRGRKFWAL-- 67 usage_00534.pdb 55 IFRGRKFWAL-- 64 usage_00535.pdb 55 IFRGRKFWAL-- 64 f G W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################