################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:02 2021 # Report_file: c_0385_26.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00246.pdb # 2: usage_00248.pdb # 3: usage_00314.pdb # 4: usage_00373.pdb # 5: usage_00455.pdb # 6: usage_00456.pdb # 7: usage_00459.pdb # 8: usage_00468.pdb # # Length: 72 # Identity: 26/ 72 ( 36.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 72 ( 51.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 72 ( 2.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00246.pdb 1 RYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQ 60 usage_00248.pdb 1 RYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQ 60 usage_00314.pdb 1 KHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQ 60 usage_00373.pdb 1 KHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIAYYNGEERAKGNILERFSAQQ 60 usage_00455.pdb 1 KHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQ 60 usage_00456.pdb 1 KHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQ 60 usage_00459.pdb 1 KHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIQYYNGEERAKGNILERFSAQQ 60 usage_00468.pdb 1 RHIIKEKGGRSVLTCIPISGHSNVVWYQQTLGKELKFLIQHYEKVERDKGFLPSRFSVQQ 60 lI Gq vtL CsP SG sV WYQQ qgLqFL y R KGn RFS Q usage_00246.pdb 61 FSNSRSEMNV-- 70 usage_00248.pdb 61 FSNSRSEMNV-- 70 usage_00314.pdb 61 FPDLHSELNLS- 71 usage_00373.pdb 61 FPDLHSELNLSS 72 usage_00455.pdb 61 FPDLHSELNL-- 70 usage_00456.pdb 61 FPDLHSELNL-- 70 usage_00459.pdb 61 FPDLHSELNL-- 70 usage_00468.pdb 61 FDDYHSEMNMSA 72 F SE N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################