################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:15 2021 # Report_file: c_0593_20.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00087.pdb # 2: usage_00089.pdb # 3: usage_00116.pdb # 4: usage_00145.pdb # 5: usage_00402.pdb # # Length: 71 # Identity: 21/ 71 ( 29.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 71 ( 49.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 71 ( 8.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00087.pdb 1 NNTLYFYNWTEYVPPGLLEQFTKETGIKVIYSTYESNETMYAKLKTYK--DGAYDLVVPS 58 usage_00089.pdb 1 -NTLYFYNWTEYVPPGLLEQFTKETGIKVIYSTYESNETMYAKLKTYK--DGAYDLVVPS 57 usage_00116.pdb 1 -KVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSG---YDVVVPS 56 usage_00145.pdb 1 -DVLYLYNWTYYTPTSLIKKFEQQYNVQVVYDDYASNEDMFAKLSIGASG---YDLVVPS 56 usage_00402.pdb 1 -KVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSG---YDVVVPS 56 L YNW Y p le FtketgikV Y Y SNE AKL k YD VVPS usage_00087.pdb 59 TYYVDKMRKEG 69 usage_00089.pdb 58 TYYVDKMRKEG 68 usage_00116.pdb 57 NSFLAKQIKAG 67 usage_00145.pdb 57 GDFVSIMKRKH 67 usage_00402.pdb 57 NSFLAKQIKAG 67 k k g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################