################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:15:52 2021 # Report_file: c_0929_90.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00050.pdb # 2: usage_00051.pdb # 3: usage_00052.pdb # 4: usage_00251.pdb # 5: usage_00252.pdb # 6: usage_00267.pdb # 7: usage_00315.pdb # 8: usage_00419.pdb # 9: usage_00420.pdb # 10: usage_00473.pdb # 11: usage_00474.pdb # 12: usage_00475.pdb # 13: usage_00478.pdb # 14: usage_00496.pdb # # Length: 45 # Identity: 44/ 45 ( 97.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 44/ 45 ( 97.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 45 ( 2.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00050.pdb 1 RGANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 45 usage_00051.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00052.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00251.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00252.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00267.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00315.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00419.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00420.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00473.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00474.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00475.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00478.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 usage_00496.pdb 1 -GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF 44 GANFVHPTFGPVWATSHMGDDSVALIGTDPEGHPDNAWKILDSF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################