################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:05 2021 # Report_file: c_1297_197.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00319.pdb # 2: usage_00357.pdb # 3: usage_00359.pdb # 4: usage_00361.pdb # 5: usage_00362.pdb # 6: usage_02437.pdb # 7: usage_02439.pdb # 8: usage_02440.pdb # 9: usage_02492.pdb # 10: usage_02604.pdb # 11: usage_03294.pdb # # Length: 44 # Identity: 5/ 44 ( 11.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 44 ( 27.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 44 ( 45.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00319.pdb 1 -------------------DECASSPCLHNGRCVDKINEFLCQC 25 usage_00357.pdb 1 -------------------DECASSPCLHNGRCVDKINEFLCQ- 24 usage_00359.pdb 1 -------------------DECASSPCLHNGRCVDKINEFLCQ- 24 usage_00361.pdb 1 -------------------DECASSPCLHNGRCVDKINEFLCQ- 24 usage_00362.pdb 1 -------------------DECASSPCLHNGRCVDKINEFLCQ- 24 usage_02437.pdb 1 -------------------DECASSPCLHNGRCLDKINEFQCE- 24 usage_02439.pdb 1 -------------------DECASSPCLHNGRCLDKINEFQCE- 24 usage_02440.pdb 1 -------------------DECASSPCLHNGRCLDKINEFQCE- 24 usage_02492.pdb 1 -------------------NECEVEPCKNGGICTDLVANYSCE- 24 usage_02604.pdb 1 AVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVC 44 usage_03294.pdb 1 -------------------DECASSPCLHNGRCLDKINEFQCE- 24 deC PC nGrc d e C #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################