################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:23:13 2021
# Report_file: c_0577_8.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00020.pdb
#   2: usage_00064.pdb
#   3: usage_00121.pdb
#   4: usage_00122.pdb
#   5: usage_00123.pdb
#   6: usage_00124.pdb
#
# Length:         85
# Identity:       19/ 85 ( 22.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     39/ 85 ( 45.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           30/ 85 ( 35.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00020.pdb         1  -IQLYS-LPTPNGVKVSI-LEEIGLPYEAHR-VSFETQDQ-TPEFLSVSPNNKIPAILDP   55
usage_00064.pdb         1  QFSLFLHKASAHGWKVAFVLEELSLSYEIVL-VDVAKNEQKSPEFMKLNPNGRTPALIDH   59
usage_00121.pdb         1  QFTLYTHKGGPNGWKVTIVLEELGLTYESIF-L-------------------RIPALIDH   40
usage_00122.pdb         1  QFTLYTHKGGPNGWKVTIVLEELGLTYESIF-LD------------------RIPALIDH   41
usage_00123.pdb         1  QFTLYTHKGGPNGWKVTIVLEELGLTYESIF-L--------------------IPALIDH   39
usage_00124.pdb         1  QFTLYTHKGGPNGWKVTIVLEELGLTYESIFP------------------NGRIPALIDH   42
                            f Ly  k  pnGwKV i LEElgL YE                         iPAliDh

usage_00020.pdb        56  HGPGDQPLALFESGAILIYLADK--   78
usage_00064.pdb        60  GN---SDFVIWESNAMVQYVADKYD   81
usage_00121.pdb        41  KN---NDYTVWESNAIIQYLVDKYD   62
usage_00122.pdb        42  KN---NDYTVWESNAIIQYLVDKYD   63
usage_00123.pdb        40  KN---NDYTVWESNAIIQYLVDKYD   61
usage_00124.pdb        43  KN---NDYTVWESNAIIQYLVDKYD   64
                            n    d   wESnAi qYl DK  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################