################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:04:42 2021
# Report_file: c_1476_62.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00676.pdb
#   2: usage_00677.pdb
#   3: usage_00678.pdb
#   4: usage_00731.pdb
#   5: usage_02426.pdb
#   6: usage_02427.pdb
#   7: usage_02428.pdb
#   8: usage_02429.pdb
#   9: usage_02430.pdb
#  10: usage_02681.pdb
#  11: usage_03019.pdb
#  12: usage_03020.pdb
#  13: usage_03039.pdb
#
# Length:         34
# Identity:        4/ 34 ( 11.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     13/ 34 ( 38.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 34 ( 11.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00676.pdb         1  ---LSEGLLYERRLFHSAFATEDQSEGMAAFIE-   30
usage_00677.pdb         1  --SLSEGLLYERRLFHSAFATEDQSEGMAAFIE-   31
usage_00678.pdb         1  ---LSEGLLYERRLFHSAFATEDQSEGMAAFIEK   31
usage_00731.pdb         1  ---PQTGLLMESLMATVAQSDQEAKTRIRAFLDH   31
usage_02426.pdb         1  --SLSEGLLYERRLFHSAFATEDQSEGMAAFIEK   32
usage_02427.pdb         1  ---LSEGLLYERRLFHSAFATEDQSEGMAAFIE-   30
usage_02428.pdb         1  --SLSEGLLYERRLFHSAFATEDQSEGMAAFIEK   32
usage_02429.pdb         1  ---LSEGLLYERRLFHSAFATEDQSEGMAAFIEK   31
usage_02430.pdb         1  ---LSEGLLYERRLFHSAFATEDQSEGMAAFIEK   31
usage_02681.pdb         1  ---LYEGMQFERKNFYLLFASEDQKEGMAAFLEK   31
usage_03019.pdb         1  SSHYYEGVQREAQIFGEVFTSEDGREGVAAFLEK   34
usage_03020.pdb         1  SSHYYEGVQREAQIFGEVFTSEDGREGVAAFLE-   33
usage_03039.pdb         1  --SLSEGLLYERRLFHSAFATEDQSEGMAAFIE-   31
                                eG   E   f   f  ed  eg aAF e 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################