################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:53 2021 # Report_file: c_1028_9.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00076.pdb # 2: usage_00286.pdb # 3: usage_00287.pdb # 4: usage_00618.pdb # 5: usage_00620.pdb # 6: usage_00639.pdb # 7: usage_00640.pdb # 8: usage_00702.pdb # # Length: 63 # Identity: 5/ 63 ( 7.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 63 ( 31.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 63 ( 20.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00076.pdb 1 QRELIIGDRQTGKTAVALDTILNQKRWNN-GSDESKKLYCVYVAVGQKRSTVAQLVQTLE 59 usage_00286.pdb 1 GKIGLFGGAGVGKTVFIQELINNIA---KA----H-GGFSVFTGVGERTREGNDLYREMK 52 usage_00287.pdb 1 GKIGLFGGAGVGKTVFIQELINNIA---KA----H-GGFSVFTGVGERTREGNDLYREMK 52 usage_00618.pdb 1 GKIGLFGGAGVGKTVFIQELINNIA---KA----H-GGFSVFTGVGERTREGNDLYREMK 52 usage_00620.pdb 1 GKIGLFGGAGVGKTVFIQELINNIA---KA----H-GGFSVFTGVGERTREGNDLYREMK 52 usage_00639.pdb 1 GKIGLFGGAGVGKTVLIQELINNVA---QE----H-GGLSVFAGVGERTREGNDLYHEMK 52 usage_00640.pdb 1 GKIGLFGGAGVGKTVLIQELINNVA---QE----H-GGLSVFAGVGERTREGNDLYHEMK 52 usage_00702.pdb 1 -RMGIFASAGCGATFLMNMLIEHSG-----------ADIYVIGLIGERGREVTETVDYLK 48 g fg ag GkT lI n V vGer re l k usage_00076.pdb 60 QHD 62 usage_00286.pdb 53 ETG 55 usage_00287.pdb 53 ETG 55 usage_00618.pdb 53 ETG 55 usage_00620.pdb 53 ETG 55 usage_00639.pdb 53 DSG 55 usage_00640.pdb 53 DSG 55 usage_00702.pdb 49 NS- 50 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################