################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:41:12 2021
# Report_file: c_1269_112.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00733.pdb
#   2: usage_00900.pdb
#   3: usage_00901.pdb
#   4: usage_00902.pdb
#   5: usage_00903.pdb
#   6: usage_00932.pdb
#   7: usage_00933.pdb
#   8: usage_01066.pdb
#   9: usage_01331.pdb
#  10: usage_01348.pdb
#  11: usage_01398.pdb
#
# Length:         32
# Identity:        3/ 32 (  9.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      5/ 32 ( 15.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            3/ 32 (  9.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00733.pdb         1  GTNTYYTVKSGDTLNKIAAQYGVSVANLRSWN   32
usage_00900.pdb         1  ---TTYTIKSGDTCYAISQARGISLSDFESWN   29
usage_00901.pdb         1  ---TTYTIKSGDTCYAISQARGISLSDFESWN   29
usage_00902.pdb         1  ---TTYTIKSGDTCYAISQARGISLSDFESWN   29
usage_00903.pdb         1  ---TTYTIKSGDTCYAISQARGISLSDFESWN   29
usage_00932.pdb         1  TSNIKYTVVKGDTLTSIAKKFKSGICNIVSVN   32
usage_00933.pdb         1  ---GTYNIVAGDLFVDLAATYHTTIGQIKALN   29
usage_01066.pdb         1  --AQIYTVKAGDSIYSIAKQFRIDAGKIIRAN   30
usage_01331.pdb         1  ---ATVTVQQGDTLRDIGRRFDCDFHEIARRN   29
usage_01348.pdb         1  --LLTYQVKQGDTLNSIAADFRISTAALLQAN   30
usage_01398.pdb         1  ---NNYYVQPGDSLYRISQTYNVPLASLAKVN   29
                                y    GD    i              N


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################