################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:12:21 2021 # Report_file: c_1329_9.html ################################################################################################ #==================================== # Aligned_structures: 19 # 1: usage_00083.pdb # 2: usage_00084.pdb # 3: usage_00085.pdb # 4: usage_00086.pdb # 5: usage_00087.pdb # 6: usage_00088.pdb # 7: usage_00118.pdb # 8: usage_00119.pdb # 9: usage_00129.pdb # 10: usage_00130.pdb # 11: usage_00131.pdb # 12: usage_00132.pdb # 13: usage_00133.pdb # 14: usage_00134.pdb # 15: usage_00135.pdb # 16: usage_00136.pdb # 17: usage_00137.pdb # 18: usage_00138.pdb # 19: usage_00139.pdb # # Length: 50 # Identity: 41/ 50 ( 82.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 50 ( 82.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 50 ( 18.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00083.pdb 1 --EIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIH--- 45 usage_00084.pdb 1 -NEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQ-- 47 usage_00085.pdb 1 ---IQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQ-- 45 usage_00086.pdb 1 ---IQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 47 usage_00087.pdb 1 -NEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIH--- 46 usage_00088.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIH--- 47 usage_00118.pdb 1 -----RQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 45 usage_00119.pdb 1 ------QKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 44 usage_00129.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00130.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00131.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00132.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00133.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00134.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00135.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00136.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00137.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00138.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 usage_00139.pdb 1 INEIQRQKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIHQFG 50 QKRNRWFIHYLNYLQSLAYQLFEWENLPPTINPSFLEKSIH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################