################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:09:07 2021
# Report_file: c_0645_131.html
################################################################################################
#====================================
# Aligned_structures: 4
#   1: usage_00144.pdb
#   2: usage_00398.pdb
#   3: usage_00550.pdb
#   4: usage_00659.pdb
#
# Length:         76
# Identity:        8/ 76 ( 10.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     15/ 76 ( 19.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           38/ 76 ( 50.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00144.pdb         1  G-WT----PNL-----------------------------DSNKEYLQVDLRFLTMLTAI   26
usage_00398.pdb         1  A-WC----PEIPVEPD-------------------------DLKEFLQIDLHTLHFITLV   30
usage_00550.pdb         1  -QMSASSSYKTWNL-RAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGI   58
usage_00659.pdb         1  A-WC----PAGSVF-P-------------------------KEEEYLQVDLQRLHLVALV   29
                             w     p                                  kE LQvDL  l   t  

usage_00144.pdb        27  ATQGAISRETQNGYYV   42
usage_00398.pdb        31  GTQGRHAG-GHGIEFA   45
usage_00550.pdb        59  ITQGARDF-GHI-QYV   72
usage_00659.pdb        30  GTQGRHAG-GLGKEFS   44
                            TQG     g      


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################