################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:01 2021 # Report_file: c_1117_55.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00216.pdb # 2: usage_00346.pdb # 3: usage_00347.pdb # 4: usage_00348.pdb # 5: usage_00349.pdb # 6: usage_00353.pdb # 7: usage_00899.pdb # 8: usage_00918.pdb # # Length: 98 # Identity: 39/ 98 ( 39.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 98 ( 39.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 98 ( 20.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00216.pdb 1 AYIFETQAQLNALLALKISITSGIQKAYRNGDKEHLSALAEKDFPQLYQ-VEDFSDQFSR 59 usage_00346.pdb 1 ------------------DVGRRIRQAYQADDKESLQQIARQELPELRSQIEDFHALFSH 42 usage_00347.pdb 1 AYLFETQAQLNAILSSKVDVGRRIRQAYQADDKESLQQIARQELPELRSQIEDFHALFSH 60 usage_00348.pdb 1 AYLFETQAQLNAILSSKVDVGRRIRQAYQADDKESLQQIARQELPELRSQIEDFHALFSH 60 usage_00349.pdb 1 ------------------DVGRRIRQAYQADDKESLQQIARQELPELRSQIEDFHALFSH 42 usage_00353.pdb 1 ------------------DVGRRIRQAYQADDKESLQQIARQELPELRSQIEDFHALFSH 42 usage_00899.pdb 1 AYIFETQAQLNALLALKISITSGIQKAYRNGDKEHLSALAEKDFPQLYQMVEDFSDQFSR 60 usage_00918.pdb 1 ------------------DVGRRIRQAYQADDKESLQQIARQELPELRSQIEDFHALFSH 42 I AY DKE L A P L EDF FS usage_00216.pdb 60 QWQQENKIFGLDTIDIRFGGLLKRIKRAQERLEQFISG 97 usage_00346.pdb 43 QWLKENKVFGLDTVDIRMGGLLQRIKRAESRIEVYLAG 80 usage_00347.pdb 61 QWLKENKVFGLDTVDIRMGGLLQRIKRAESRIEVYLA- 97 usage_00348.pdb 61 QWLKENKVFGLDTVDIRMGGLLQRIKRAESRIEVYLAG 98 usage_00349.pdb 43 QWLKENKVFGLDTVDIRMGGLLQRIKRAESRIEVYLA- 79 usage_00353.pdb 43 QWLKENKVFGLDTVDIRMGGLLQRIKRAESRIEVYLA- 79 usage_00899.pdb 61 QWQQENKIFGLDTIDIRFGGLLKRIKRAQERLEQFISG 98 usage_00918.pdb 43 QWLKENKVFGLDTVDIRMGGLLQRIKRAESRIEVYLA- 79 QW ENK FGLDT DIR GGLL RIKRA R E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################