################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:51 2021 # Report_file: c_1209_44.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00134.pdb # 2: usage_00135.pdb # 3: usage_00421.pdb # 4: usage_00486.pdb # 5: usage_00487.pdb # 6: usage_00519.pdb # 7: usage_00520.pdb # 8: usage_00538.pdb # 9: usage_01068.pdb # 10: usage_01301.pdb # # Length: 59 # Identity: 14/ 59 ( 23.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 59 ( 35.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 59 ( 10.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00134.pdb 1 -----TSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADG 54 usage_00135.pdb 1 -----TSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADG 54 usage_00421.pdb 1 -TVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASG 58 usage_00486.pdb 1 ----GTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADG 55 usage_00487.pdb 1 DEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADG 59 usage_00519.pdb 1 ----GTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADG 55 usage_00520.pdb 1 ----GTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADG 55 usage_00538.pdb 1 ----GTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADG 55 usage_01068.pdb 1 ----GCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASG 55 usage_01301.pdb 1 -KVTGATVHLVDAGTDTGPILAQQPVPVLDGDDEETLHERIKVTERRLLVAAVAALAT- 57 VHfV D G ilQ VPV GD Rv Eh i p A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################