################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:46 2021 # Report_file: c_1369_15.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00229.pdb # 2: usage_00230.pdb # 3: usage_00231.pdb # 4: usage_00232.pdb # 5: usage_01027.pdb # 6: usage_01355.pdb # # Length: 100 # Identity: 24/100 ( 24.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/100 ( 35.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 39/100 ( 39.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00229.pdb 1 FYDKMFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGR-IESRIDINWS--ES 57 usage_00230.pdb 1 --DKMFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGR-IESRIDINWS--ES 55 usage_00231.pdb 1 --DKMFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGR-IESRIDINWS--ES 55 usage_00232.pdb 1 ----------------------------NGRLFRLVNKLNCIFGR-IESRIDINWS--ES 29 usage_01027.pdb 1 ---------------------------ENGRIARLMFKLSVVNER-GD--HNWSE----T 26 usage_01355.pdb 1 ---RFYTQLDALQSKIDMQEDELAKEMENGRLYRILVKLNSINERPDFNLD--C-TWSET 54 NGRl Rl KLn i R usage_00229.pdb 58 GTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDA- 96 usage_00230.pdb 56 GTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDA- 94 usage_00231.pdb 56 GTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDA- 94 usage_00232.pdb 30 GTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDAG 69 usage_01027.pdb 27 GERLLLKLFRDYVFHQVDADGKARLDTNHYLNCLSKLDA- 65 usage_01355.pdb 55 GDRYMLKLFRDYLFHSVTEDGRPWLDHAHIVQCLNKLDAG 94 G LF DYvFHqVd Gkp D H l CLnKLDA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################