################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:41 2021 # Report_file: c_0673_199.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00652.pdb # 2: usage_00653.pdb # 3: usage_00943.pdb # 4: usage_00944.pdb # 5: usage_01026.pdb # 6: usage_01376.pdb # # Length: 78 # Identity: 3/ 78 ( 3.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 78 ( 37.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 30/ 78 ( 38.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00652.pdb 1 -SIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKL 59 usage_00653.pdb 1 -SIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKL 59 usage_00943.pdb 1 -------------TIKKLTLIEGGETKYVLHKIEAVDEANLRYNYSIVGGVGLPDTIEKI 47 usage_00944.pdb 1 ------------GTIKKLTLIEGGETKYVLHKIEAVDEANLRYNYSIVGGVGLPDTIEKI 48 usage_01026.pdb 1 KRCRLISGDGDVGSVREVTVISGLPASTSTERLEFVDDDHRVLSFRVVGGEH---RLKNY 57 usage_01376.pdb 1 -SVEIVEGNGGPGTIKKIIAIHDGHTSFVLHKLDAIDEANLTYNYSIIGGEGLDESLEKI 59 tikk t g t vl k a Deanl y ysivGG g ek usage_00652.pdb 60 SFETKV------------ 65 usage_00653.pdb 60 SFETKVVA---------- 67 usage_00943.pdb 48 SFETKLVEGANGGSIGKV 65 usage_00944.pdb 49 SFETKLVEGANGGSIGKV 66 usage_01026.pdb 58 KSVT-------------- 61 usage_01376.pdb 60 SYESKILP---------- 67 s et #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################