################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:08 2021 # Report_file: c_0768_50.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00240.pdb # 2: usage_00241.pdb # 3: usage_00242.pdb # 4: usage_00243.pdb # 5: usage_00491.pdb # 6: usage_00669.pdb # 7: usage_00670.pdb # # Length: 65 # Identity: 29/ 65 ( 44.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 65 ( 49.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 65 ( 9.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00240.pdb 1 IAQSQSG--TGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQ 58 usage_00241.pdb 1 IAQSQSG--TGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQ 58 usage_00242.pdb 1 IAQSQSG--TGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQ 58 usage_00243.pdb 1 IAQSQSG--TGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQ 58 usage_00491.pdb 1 DVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGAT 60 usage_00669.pdb 1 DVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQAL-LAPTRELALQIQKVVA-LAFH-DIK 57 usage_00670.pdb 1 DVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQAL-LAPTRELALQIQKVVA-LAFH-DIK 57 Q TGKT TFsI LQ d v QAL LAPTRELA QIQK L usage_00240.pdb 59 CHAC- 62 usage_00241.pdb 59 CHAC- 62 usage_00242.pdb 59 CHAC- 62 usage_00243.pdb 59 CHAC- 62 usage_00491.pdb 61 CHACI 65 usage_00669.pdb 58 VHACI 62 usage_00670.pdb 58 VHACI 62 HAC #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################