################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:05 2021 # Report_file: c_1297_132.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_02240.pdb # 2: usage_02242.pdb # 3: usage_02244.pdb # 4: usage_02247.pdb # 5: usage_02249.pdb # 6: usage_02252.pdb # 7: usage_02516.pdb # 8: usage_02517.pdb # 9: usage_02518.pdb # 10: usage_02844.pdb # 11: usage_02846.pdb # # Length: 45 # Identity: 11/ 45 ( 24.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 45 ( 35.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 45 ( 15.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02240.pdb 1 -EATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTR 44 usage_02242.pdb 1 -EATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTR 44 usage_02244.pdb 1 -EATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTR 44 usage_02247.pdb 1 -EATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTR 44 usage_02249.pdb 1 -EATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTR 44 usage_02252.pdb 1 -EATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTR 44 usage_02516.pdb 1 -EKTRTRLHETAIKAAKAIGYEGAGTFEFLVDKNLDFYFIENTR- 43 usage_02517.pdb 1 -EKTRTRLHETAIKAAKAIGYEGAGTFEFLVDKNLDFYF------ 38 usage_02518.pdb 1 -EKTRTRLHETAIKAAKAIGYEGAGTFEFLVDKNLDFYFIENTR- 43 usage_02844.pdb 1 PLAIFEFMEQCAIRLAKTVGYVSAGTVEYLYSQDGSFHFLELNPR 45 usage_02846.pdb 1 SKAQREYIGNLAVKAAKAVGYKNAGTVEFLLDSDNNFYF------ 39 r A AKa GY AGT Ef d FyF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################