################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:07:43 2021 # Report_file: c_0407_15.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00020.pdb # 2: usage_00041.pdb # 3: usage_00042.pdb # 4: usage_00050.pdb # 5: usage_00052.pdb # 6: usage_00075.pdb # 7: usage_00077.pdb # 8: usage_00157.pdb # 9: usage_00158.pdb # # Length: 75 # Identity: 15/ 75 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 75 ( 28.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 75 ( 9.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00020.pdb 1 RVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVE--GPSESKINCRDNKDGSCSAEY 58 usage_00041.pdb 1 KVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVE--GPSKAEITFDDHKNGSCGVSY 58 usage_00042.pdb 1 -VSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIE--GPSKAEISCIDNKDGTCTVTY 57 usage_00050.pdb 1 -VRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVE--GPSKAEISFEDRKDGSCGVAY 57 usage_00052.pdb 1 KVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVE--GPSKAEISFEDRKDGSCGVAY 58 usage_00075.pdb 1 -VRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVE--GPSKAEISFEDRKDGSCGVAY 57 usage_00077.pdb 1 -VRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVE--GPSKAEISFEDRKDGSCGVAY 57 usage_00157.pdb 1 -VKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEISEA-GLPAEVYIQDHGDGTHTITY 58 usage_00158.pdb 1 -VKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEISEA-GLPAEVYIQDHGDGTHTITY 58 V GPGL a F AG L i ae D dG Y usage_00020.pdb 59 IPFAPGDYDVNITY- 72 usage_00041.pdb 59 IAQEPGNYEVSIKFN 73 usage_00042.pdb 58 LPTLPGDYSILVKYN 72 usage_00050.pdb 58 VVQEPGDYEVSVKF- 71 usage_00052.pdb 59 VVQEPGDYEVSVK-- 71 usage_00075.pdb 58 VVQEPGDYEVSV--- 69 usage_00077.pdb 58 VVQEPGDYEVSV--- 69 usage_00157.pdb 59 IPLCPGAYTVTIKY- 72 usage_00158.pdb 59 IPLCPGAYTVTIKY- 72 PG Y v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################