################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:10:34 2021
# Report_file: c_1056_36.html
################################################################################################
#====================================
# Aligned_structures: 9
#   1: usage_00004.pdb
#   2: usage_00005.pdb
#   3: usage_00055.pdb
#   4: usage_00258.pdb
#   5: usage_00348.pdb
#   6: usage_00560.pdb
#   7: usage_00615.pdb
#   8: usage_00678.pdb
#   9: usage_00701.pdb
#
# Length:         51
# Identity:       27/ 51 ( 52.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     27/ 51 ( 52.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           24/ 51 ( 47.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00004.pdb         1  ------------------KRLSPHRKTRVKVI------REIITLFGISVLD   27
usage_00005.pdb         1  ------------------KRLSPHRKTRVKVIENMYGSREIITLFGISVLD   33
usage_00055.pdb         1  ------------------KRLSPHRKTRVKVIENMYGSREIITLFGISVLD   33
usage_00258.pdb         1  ------------------KRLSPHRKTRVKVIENMYGSREIITLFGISVLD   33
usage_00348.pdb         1  --------------ESTAKRLSPHRKTRVKVIENMYGSREIITLFGISVLD   37
usage_00560.pdb         1  --------------ESTAKRLSPHRKTRVKVIENMYGSREIITLFGISVLD   37
usage_00615.pdb         1  AIPYVYNRIKNIFGESTAKRLSPHRKTRVKVIENMYGSREIITLFGISVLD   51
usage_00678.pdb         1  ------------------KRLSPHRKTRVKVIENMYGSREIITLFGISVLD   33
usage_00701.pdb         1  --------------ESTAKRLSPHRKTRVKVIENMYGSREIITLFGISVLD   37
                                             KRLSPHRKTRVKVI      REIITLFGISVLD


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################