################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:37 2021 # Report_file: c_1026_31.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00028.pdb # 2: usage_00029.pdb # 3: usage_00030.pdb # 4: usage_00134.pdb # 5: usage_00140.pdb # 6: usage_00141.pdb # 7: usage_00155.pdb # 8: usage_00201.pdb # # Length: 51 # Identity: 17/ 51 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 51 ( 54.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 51 ( 9.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00028.pdb 1 VWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLK 51 usage_00029.pdb 1 VWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLK 51 usage_00030.pdb 1 VWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRT-- 49 usage_00134.pdb 1 VWLVLDAVTGQ--LEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTL- 48 usage_00140.pdb 1 TLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELG 51 usage_00141.pdb 1 TLLVIDATTGQNGLVQAKIFKEAVNVTGIILTKLDGTAKGGITLAIARELG 51 usage_00155.pdb 1 VMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVAD--- 48 usage_00201.pdb 1 VLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLN 51 Lv DA TGQ QAk F eav tG i TKlDgTaKGG i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################