################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:06 2021 # Report_file: c_1336_38.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00241.pdb # 2: usage_00242.pdb # 3: usage_00243.pdb # 4: usage_00299.pdb # 5: usage_00300.pdb # 6: usage_00301.pdb # 7: usage_00558.pdb # 8: usage_00559.pdb # 9: usage_00587.pdb # 10: usage_00600.pdb # 11: usage_00949.pdb # 12: usage_00969.pdb # 13: usage_01061.pdb # # Length: 47 # Identity: 0/ 47 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 47 ( 23.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 47 ( 27.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00241.pdb 1 SEEQIQEKVLELGAIIAEDYKNT--VPLAIGVLKGAMPFMADLLKRT 45 usage_00242.pdb 1 SEEQIQEKVLELGAIIAEDYKNT--VPLAIGVLKGAMPFMADLLKRT 45 usage_00243.pdb 1 SEEQIQEKVLELGAIIAEDYKNT--VPLAIGVLKGAMPFMADLLKRT 45 usage_00299.pdb 1 SEEQIQEKVLELGAIIAEDYKNT--VPLAIGVLKGAMPFMADLLKRT 45 usage_00300.pdb 1 SEEQIQEKVLELGAIIAEDYKNT--VPLAIGVLKGAMPFMADLLKRT 45 usage_00301.pdb 1 SEEQIQEKVLELGAIIAEDYKNT--VPLAIGVLKGAMPFMADLLKRT 45 usage_00558.pdb 1 SEEQIQEKVLELGAIIAEDYKNT--VPLAIGVLKGAMPFMADLLKRT 45 usage_00559.pdb 1 SEEQIQEKVLELGAIIAEDYKNT--VPLAIGVLKGAMPFMADLLKRT 45 usage_00587.pdb 1 TEEQLKAKVKELGEMITRDYEGK--DLVLIGVLKGAIMFMSGLSRAI 45 usage_00600.pdb 1 SAEAIKKRVEELGGEIARDYQGK--TPHLICVLNGAFIFMADLVRAI 45 usage_00949.pdb 1 TEEQLKAKVKELGEMITRDYEGK--DLVLIGVLKGAIMFMSGLSRAI 45 usage_00969.pdb 1 NQDDIQKRIRELAAELTEFYEDK--NPVMICVLTGAVFFYTDLLKHL 45 usage_01061.pdb 1 -------TPEQIAERILAFEKVGVTLLLLQFSPQLEEKRFSEK---- 36 el i y i vl ga f l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################