################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:11 2021 # Report_file: c_1092_29.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00080.pdb # 2: usage_00081.pdb # 3: usage_00082.pdb # 4: usage_00093.pdb # 5: usage_00139.pdb # 6: usage_00140.pdb # 7: usage_00172.pdb # # Length: 66 # Identity: 8/ 66 ( 12.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 66 ( 31.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 66 ( 19.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00080.pdb 1 S--LTDVVTET---------CMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGM 49 usage_00081.pdb 1 S--LTDVVTET---------CMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGM 49 usage_00082.pdb 1 S--LTDVVTET---------CMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGM 49 usage_00093.pdb 1 -DL-AALRRQG---------PLAPPRAVAIVRQIGSALDAAHAAGATHRDVKPENILVSA 49 usage_00139.pdb 1 S--ALDLLEPG---------PLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSE 49 usage_00140.pdb 1 S--ALDLLEPG---------PLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSE 49 usage_00172.pdb 1 ---MLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILLGE 57 d e ia re l L lH iHRD K N Ll usage_00080.pdb 50 DGSVKL 55 usage_00081.pdb 50 DGSVKL 55 usage_00082.pdb 50 DGSVKL 55 usage_00093.pdb 50 DDFAYL 55 usage_00139.pdb 50 HGEVKL 55 usage_00140.pdb 50 HGEVKL 55 usage_00172.pdb 58 DGSVQI 63 g v l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################