################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:28 2021 # Report_file: c_0740_48.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00016.pdb # 2: usage_00018.pdb # 3: usage_00020.pdb # 4: usage_00126.pdb # 5: usage_00563.pdb # 6: usage_00565.pdb # # Length: 64 # Identity: 16/ 64 ( 25.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 64 ( 25.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 64 ( 35.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00016.pdb 1 EGCFSVYKLNKDDD--YLIASFDIAQ-RDGDILISAIRKYLSFTTKVYLDKTNCSKLKVT 57 usage_00018.pdb 1 EGCFSVYKLNKDDD--YLIASFDIAQ-RDGDILISAIRKYLSFTTKVYLDKTNCSKLKVT 57 usage_00020.pdb 1 EGCFSVYKLNKDDD--YLIASFDIAQ-RDGDILISAIRKYLSFTTKVYLDKTNCSKLKVT 57 usage_00126.pdb 1 EGCFSVYKLNKDDD--YLIASFDIAQ-RDGDILISAIRKYLSFTTKVYLDKTNCSKLKVT 57 usage_00563.pdb 1 KSCFSIYKP-----NKKKTASFEVSNNNE----VLAIKSYLKINNNIY-NEFNNSK---- 46 usage_00565.pdb 1 KSCFSIYK---------KTASFEVSNNNE----VLAIKSYLKINNNIY-NEFNNSK---- 42 CFS YK ASF AI YL Y N SK usage_00016.pdb ---- usage_00018.pdb ---- usage_00020.pdb ---- usage_00126.pdb ---- usage_00563.pdb 47 TTKS 50 usage_00565.pdb 43 TTKS 46 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################