################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:37:51 2021 # Report_file: c_0715_11.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00307.pdb # 2: usage_00308.pdb # 3: usage_00309.pdb # 4: usage_00315.pdb # 5: usage_00370.pdb # 6: usage_00371.pdb # 7: usage_00630.pdb # 8: usage_00631.pdb # 9: usage_00632.pdb # 10: usage_00633.pdb # 11: usage_00639.pdb # # Length: 66 # Identity: 43/ 66 ( 65.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 66 ( 65.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 66 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00307.pdb 1 GLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGY 60 usage_00308.pdb 1 GLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGY 60 usage_00309.pdb 1 GLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGY 60 usage_00315.pdb 1 GLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGY 60 usage_00370.pdb 1 GLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGY 60 usage_00371.pdb 1 GLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGY 60 usage_00630.pdb 1 GLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGY 60 usage_00631.pdb 1 GLNTDFPSDGKKRAFVVVPPKDSAGGAPVWVPMVGTVEATNWNLNVPRSGNNAKLAEHGY 60 usage_00632.pdb 1 GLNTDFPSDGKKRAFVVVPPKDSAGGAPVWVPMVGTVEATNWNLNVPRSGNNAKLAEHGY 60 usage_00633.pdb 1 GLNTDFPSDGKKRAFVVVPPKDSAGGAPVWVPMVGTVEATNWNLNVPRSGNNAKLAEHGY 60 usage_00639.pdb 1 GLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGY 60 GLN DFP G KRAF V P K G APVWVPM G VE TN NL V RSG N LA HGY usage_00307.pdb 61 TVIAPV 66 usage_00308.pdb 61 TVIAPV 66 usage_00309.pdb 61 TVIAPV 66 usage_00315.pdb 61 TVIAPV 66 usage_00370.pdb 61 TVIAPV 66 usage_00371.pdb 61 TVIAPV 66 usage_00630.pdb 61 TVIAPV 66 usage_00631.pdb 61 MVISPV 66 usage_00632.pdb 61 MVISPV 66 usage_00633.pdb 61 MVISPV 66 usage_00639.pdb 61 TVIAPV 66 VI PV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################