################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:01 2021 # Report_file: c_0709_18.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00036.pdb # 2: usage_00037.pdb # 3: usage_00038.pdb # 4: usage_00039.pdb # 5: usage_00661.pdb # 6: usage_00666.pdb # 7: usage_00667.pdb # # Length: 80 # Identity: 43/ 80 ( 53.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 80 ( 62.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 80 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00036.pdb 1 DNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKY 60 usage_00037.pdb 1 DNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKY 60 usage_00038.pdb 1 DNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKY 60 usage_00039.pdb 1 DNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKY 60 usage_00661.pdb 1 ----FRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKM 56 usage_00666.pdb 1 DSHWFHLESNPQGTRWYGTCWTYYKNEKYEFE-NFDIPVTYPQAPPEIALPELEGKTVKY 59 usage_00667.pdb 1 DSHWFHLESNPQGTRWYGTCWTYYKNEKYEFE-NFDIPVTYPQAPPEIALPELEGKTVKY 59 F LESN GTRW G CW KYEF FDIP TYP PEIA PEL GKT Ky usage_00036.pdb 61 RGGKICLTD-HFKPLWARNV 79 usage_00037.pdb 61 RGGKICLTD-HFKPLWARNV 79 usage_00038.pdb 61 RGGKICLTD-HFKPLWARNV 79 usage_00039.pdb 61 RGGKICLTD-HFKPLWARNV 79 usage_00661.pdb 57 YRGGKICLTDHFKPLWARN- 75 usage_00666.pdb 60 RGGKIC-TT-HFFPLWARNV 77 usage_00667.pdb 60 RGGKIC-TT-HFFPLWARNV 77 rgGkic t HF PLWARN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################