################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:35 2021 # Report_file: c_1024_61.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00165.pdb # 2: usage_00207.pdb # 3: usage_00227.pdb # 4: usage_00253.pdb # 5: usage_00261.pdb # # Length: 66 # Identity: 2/ 66 ( 3.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 66 ( 4.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 33/ 66 ( 50.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00165.pdb 1 KYNLKMGMTAGTSQNEYKAAEVFAKELKKRSNGEIELKLYPNAQLGKD--DLAMMQQLEG 58 usage_00207.pdb 1 -VVIKFSHVVSDDTPKGKGALLFKKLAEERLPGKVKVEVYPNSTLFGD--A--------- 48 usage_00227.pdb 1 -IKFSHVV--AENTPKGQ-ALKFKQLVEERLPGEYQVNVFPNSQLFGD--N--------- 45 usage_00253.pdb 1 --NVRMLS--DVC----MQSRLLKEALESKL--PLALEITPFSELW-------------- 36 usage_00261.pdb 1 ----YKSLVLGPAFPWGKGGEIWADLVKQRTNGRINIKLYPGTSLVAGDQT--------- 47 r P L usage_00165.pdb 59 G----- 59 usage_00207.pdb 49 -DE--- 50 usage_00227.pdb 46 -NE--- 47 usage_00253.pdb 37 ---LEE 39 usage_00261.pdb 48 -RE--- 49 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################