################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:14:09 2021 # Report_file: c_1393_134.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00054.pdb # 2: usage_00055.pdb # 3: usage_00121.pdb # 4: usage_00122.pdb # 5: usage_00123.pdb # 6: usage_00126.pdb # 7: usage_00627.pdb # 8: usage_00629.pdb # 9: usage_00631.pdb # 10: usage_00632.pdb # 11: usage_00914.pdb # 12: usage_01219.pdb # 13: usage_01222.pdb # 14: usage_01223.pdb # # Length: 30 # Identity: 0/ 30 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 30 ( 16.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 30 ( 46.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00054.pdb 1 -NECMESVKNGTYDYPKYQKESKLNR---- 25 usage_00055.pdb 1 -NECMESVKNGTYDYPKYQKESKLNR---- 25 usage_00121.pdb 1 -NECMESVKNGTYDYPKYQKESKLNRQGI- 28 usage_00122.pdb 1 DNECMESVKNGTYDYPKYQKESKLNRQG-- 28 usage_00123.pdb 1 -NECMESVKNGTYDYPKYQKESKLNRQGI- 28 usage_00126.pdb 1 NDECMESVKNGTYDYPKYSEESKLNREKI- 29 usage_00627.pdb 1 -NECMESVKNGTYDYPKYQKESRLNRQKIE 29 usage_00629.pdb 1 NNECMESVKNGTYDYPKYQKESRLNRQKIE 30 usage_00631.pdb 1 -NECMESVKNGTYDYPKYQKESKLNR---- 25 usage_00632.pdb 1 -NECMESVKNGTYDYPKYQKESKLNR---- 25 usage_00914.pdb 1 ---DAACVSLGNCC--LDFQETCVEPTHI- 24 usage_01219.pdb 1 -TEIIKCLRNK------D-PQEILLNEAFV 22 usage_01222.pdb 1 -NECMESVKNGTYDYPKYQKESKLNRQGI- 28 usage_01223.pdb 1 DNECMESVKNGTYDYPKYQKESKLNRQG-- 28 v ng e l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################