################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:20 2021 # Report_file: c_1228_28.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00369.pdb # 2: usage_00510.pdb # 3: usage_00511.pdb # 4: usage_00512.pdb # 5: usage_00513.pdb # 6: usage_00681.pdb # 7: usage_00682.pdb # 8: usage_00683.pdb # 9: usage_00684.pdb # 10: usage_00685.pdb # 11: usage_00851.pdb # 12: usage_00852.pdb # # Length: 45 # Identity: 36/ 45 ( 80.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 45 ( 80.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 45 ( 20.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00369.pdb 1 GLRLV-G-------LPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 37 usage_00510.pdb 1 GLRLVT--------LPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 37 usage_00511.pdb 1 GLRLV-GSE----TLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 40 usage_00512.pdb 1 GLRLV-GS-----TLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 39 usage_00513.pdb 1 GLRLV-G-------LPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 37 usage_00681.pdb 1 GLRLV-GSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 44 usage_00682.pdb 1 GLRLV-GSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 44 usage_00683.pdb 1 GLRLV-GSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 44 usage_00684.pdb 1 GLRLV-GSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 44 usage_00685.pdb 1 GLRLV-GSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 44 usage_00851.pdb 1 GLRLV-GSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 44 usage_00852.pdb 1 GLRLV-GSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL 44 GLRLV LPGWPVTLPDPGMSLTDRGVMSYVRHVLSCL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################