################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 22:59:46 2021 # Report_file: c_0707_6.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00102.pdb # 2: usage_00287.pdb # 3: usage_00322.pdb # 4: usage_00785.pdb # # Length: 135 # Identity: 44/135 ( 32.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 102/135 ( 75.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 33/135 ( 24.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00102.pdb 1 ---------HIINNKTNP---KIKSFTIKLLFNKNGVLLDNSNLGKAYWNFRSGNSNVST 48 usage_00287.pdb 1 SLIVVAGKYHIINNKTNP---KIKSFTIKLLFNKNGVLLDNSNLGKAYWNFRSGNSNVST 57 usage_00322.pdb 1 SLIVVAGKYHIINNKTNP---KIKSFTIKLLFNKNGVLLDNSNLGKAYWNFRSGNSNVST 57 usage_00785.pdb 1 ------------------MTGTVASVSIFLRFDQNGVLMENSSLKKHYWNFRNGNSTNAN 42 kikSftIkLlFnkNGVLldNSnLgKaYWNFRsGNSnvst usage_00102.pdb 49 AYEKAIGFMPNLVAYPKPSNSKKYARDIVYGTIYLGGKPDQPAVIKTTFNQET------- 101 usage_00287.pdb 58 AYEKAIGFMPNLVAYPKPSNSKKYARDIVYGTIYLGGKPDQPAVIKTTFNQET------- 110 usage_00322.pdb 58 AYEKAIGFMPNLVAYPKPSNSKKYARDIVYGTIYLGGKPDQPAVIKTTFNQET------- 110 usage_00785.pdb 43 PYTNAVGFMPNLLAYPKT--QSQTAKNNIVSQVYLHGDKTKPMILTITLNGT-SESTETS 99 aYekAiGFMPNLvAYPKp skkyArdivygtiYLgGkpdqPaviktTfNqe usage_00102.pdb 102 -GCEYSITFNFSWSK 115 usage_00287.pdb 111 -GCEYSITFNFSWSK 124 usage_00322.pdb 111 -GCEYSITFNFSWSK 124 usage_00785.pdb 100 EVSTYSMSFTWSWE- 113 gceYSitFnfSWs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################