################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:53 2021 # Report_file: c_0590_55.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00013.pdb # 2: usage_00091.pdb # 3: usage_00255.pdb # 4: usage_00350.pdb # 5: usage_00351.pdb # 6: usage_00352.pdb # # Length: 92 # Identity: 8/ 92 ( 8.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 92 ( 19.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 92 ( 10.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00013.pdb 1 SLYILVLDSRRD---EKAEYWLKHIRSFGGD-SPVLVALNKIDENPS-FELNRKFLQEKY 55 usage_00091.pdb 1 QCAIIMFDVTSRVTYKNVPNWHRDLVRVCEN-IPIVLCGNKVDIK-D-RKVKAKSIVFH- 56 usage_00255.pdb 1 AGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLE-AQRDVTYEEAKQFA 59 usage_00350.pdb 1 NGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLE-KERHVSIQEAESYA 59 usage_00351.pdb 1 NGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLE-KERHVSIQEAESYA 59 usage_00352.pdb 1 AGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLE-SRREVKKEEGEAFA 59 a v D t W r gNK D r v usage_00013.pdb 56 P-SIKGFFRISCKEDRGIEGFSQKLKKELLKV 86 usage_00091.pdb 57 RKKNLQYYDISAKSNYNFEKPFLWLARKLIG- 87 usage_00255.pdb 60 EENGLLFLEASAKTGENVEDAFLEAAKKIY-- 89 usage_00350.pdb 60 ESVGAKHYHTSAKQNKGIEELFLDLCKRMI-- 89 usage_00351.pdb 60 ESVGAKHYHTSAKQNKGIEELFLDLCKRMI-- 89 usage_00352.pdb 60 REHGLIFMETSAKTASNVEEAFINTAKEIYE- 90 SaK E f k #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################