################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:02:50 2021 # Report_file: c_1408_5.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00393.pdb # 2: usage_01091.pdb # 3: usage_01094.pdb # 4: usage_01148.pdb # # Length: 121 # Identity: 86/121 ( 71.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 91/121 ( 75.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/121 ( 24.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00393.pdb 1 FLSLIVSILRSWNEPLYHLVTEVRG-MQ-EAPEAILSKAVEIEEQTKRLLEGMELIVSQV 58 usage_01091.pdb 1 -------------EPLYHLVTEVRGMQ-EAP-EAILSKAVEIEEQTKRLLERMELIVSQV 45 usage_01094.pdb 1 -------------EPLYHLVTEVRGMQ-EAP-EAILSKAVEIEEQTKRLLERMELIVSQV 45 usage_01148.pdb 1 -------------EPLYHLVTEVRGMQ-EAP-EAILSKAVEIEEQTKRLLEGMELIVSQV 45 EPLYHLVTEVRG q ap EAILSKAVEIEEQTKRLLE MELIVSQV usage_00393.pdb 59 HPETKENEIYPVWSGLPSLQ--MADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRII- 115 usage_01091.pdb 46 HPETKENEIYPVWSGLPSLQ--MADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIH 103 usage_01094.pdb 46 HPETKENEIYPVWSGLPSLQ--MADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIH 103 usage_01148.pdb 46 HPETK----YPVWSGLP---SLAD-EESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIH 97 HPETK YPVWSGLP ma EESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRII usage_00393.pdb - usage_01091.pdb 104 N 104 usage_01094.pdb 104 N 104 usage_01148.pdb 98 N 98 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################