################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:50:33 2021 # Report_file: c_1219_112.html ################################################################################################ #==================================== # Aligned_structures: 22 # 1: usage_00551.pdb # 2: usage_00552.pdb # 3: usage_00553.pdb # 4: usage_00554.pdb # 5: usage_00555.pdb # 6: usage_00556.pdb # 7: usage_00557.pdb # 8: usage_00558.pdb # 9: usage_00559.pdb # 10: usage_00560.pdb # 11: usage_01124.pdb # 12: usage_01125.pdb # 13: usage_01126.pdb # 14: usage_01127.pdb # 15: usage_01128.pdb # 16: usage_01129.pdb # 17: usage_01942.pdb # 18: usage_01943.pdb # 19: usage_01944.pdb # 20: usage_01945.pdb # 21: usage_02052.pdb # 22: usage_02053.pdb # # Length: 31 # Identity: 31/ 31 (100.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 31 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 31 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00551.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00552.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00553.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00554.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00555.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00556.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00557.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00558.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00559.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_00560.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01124.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01125.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01126.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01127.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01128.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01129.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01942.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01943.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01944.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_01945.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_02052.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 usage_02053.pdb 1 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN 31 GITDQRTENVFEDLTGNRVRYTNWNEGEPNN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################