################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:07 2021 # Report_file: c_0670_43.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00418.pdb # 2: usage_00419.pdb # 3: usage_00468.pdb # 4: usage_00657.pdb # 5: usage_00673.pdb # 6: usage_00674.pdb # 7: usage_00677.pdb # 8: usage_00752.pdb # 9: usage_00779.pdb # 10: usage_00780.pdb # # Length: 52 # Identity: 5/ 52 ( 9.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 52 ( 30.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 52 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00418.pdb 1 DWVNDIVLC-CNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYA 51 usage_00419.pdb 1 DWVNDIVLC-CNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYA 51 usage_00468.pdb 1 ---TAAIFDPRDRTVAYSASQDHTVRTLDLTTGQVVSTLTLTHPLLSLSALT 49 usage_00657.pdb 1 ---NDIVLC-CNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYA 48 usage_00673.pdb 1 ---NDIVLC-CNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYA 48 usage_00674.pdb 1 ---NDIVLC-CNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYA 48 usage_00677.pdb 1 ---YAMHWG-TDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYA 48 usage_00752.pdb 1 ---NDIVLC-CNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYA 48 usage_00779.pdb 1 ---NDIVLC-CNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYA 48 usage_00780.pdb 1 ---NDIVLC-CNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYA 48 l SAS D tv w g stl v Aya #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################