################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:26:46 2021 # Report_file: c_0929_59.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00109.pdb # 2: usage_00271.pdb # 3: usage_00275.pdb # 4: usage_00276.pdb # 5: usage_00426.pdb # 6: usage_00661.pdb # 7: usage_00662.pdb # 8: usage_00743.pdb # 9: usage_00764.pdb # 10: usage_00765.pdb # 11: usage_00766.pdb # 12: usage_00794.pdb # 13: usage_00805.pdb # 14: usage_01106.pdb # 15: usage_01319.pdb # # Length: 42 # Identity: 26/ 42 ( 61.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 42 ( 92.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 42 ( 7.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00109.pdb 1 --DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 40 usage_00271.pdb 1 SNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 42 usage_00275.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 usage_00276.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 usage_00426.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 usage_00661.pdb 1 --DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 40 usage_00662.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 usage_00743.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 usage_00764.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 usage_00765.pdb 1 --DNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 40 usage_00766.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 usage_00794.pdb 1 SNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 42 usage_00805.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 usage_01106.pdb 1 ---SIELDDVANLMFYGEGQIGTNKQPFMFIFDTGSANLWVP 39 usage_01319.pdb 1 -NDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVP 41 nIELvDfqNiMFYGdaevGdNqQPFtFIlDTGSANLWVP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################