################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:08 2021 # Report_file: c_1242_39.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00695.pdb # 2: usage_00948.pdb # 3: usage_00950.pdb # 4: usage_00951.pdb # 5: usage_00952.pdb # 6: usage_01208.pdb # 7: usage_01209.pdb # 8: usage_01210.pdb # 9: usage_02150.pdb # 10: usage_02317.pdb # 11: usage_02318.pdb # 12: usage_02460.pdb # 13: usage_02461.pdb # 14: usage_02462.pdb # # Length: 33 # Identity: 16/ 33 ( 48.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 33 ( 48.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 33 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00695.pdb 1 GYELLGSVSTHWHEDRTAGIKWLNDQSISTYAT 33 usage_00948.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_00950.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_00951.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_00952.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_01208.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_01209.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_01210.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_02150.pdb 1 GYELLGSVSTHWHEDRTAGIKWLNDQSISTYAT 33 usage_02317.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_02318.pdb 1 GYQVMASISTHSHEDRTAGIKLLNSKSIPTYTS 33 usage_02460.pdb 1 GYKIKGSISSHFHSDSTGGIEWLNSRSIPTYAS 33 usage_02461.pdb 1 GYKIKGSISSHFHSDSTGGIEWLNSRSIPTYAS 33 usage_02462.pdb 1 GYKIKGSISSHFHSDSTGGIEWLNSRSIPTYAS 33 GY S S H H D T GI LN SI TY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################