################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:24:40 2021 # Report_file: c_0666_18.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00069.pdb # 2: usage_00096.pdb # 3: usage_00108.pdb # 4: usage_00109.pdb # 5: usage_00150.pdb # 6: usage_00197.pdb # 7: usage_00215.pdb # 8: usage_00370.pdb # 9: usage_00371.pdb # 10: usage_00374.pdb # # Length: 53 # Identity: 29/ 53 ( 54.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 52/ 53 ( 98.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 53 ( 1.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00069.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 usage_00096.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 usage_00108.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 usage_00109.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 usage_00150.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 usage_00197.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 usage_00215.pdb 1 RRIPLDGQDGGDGKSFTVNVPNDYGVAIPGYYMLFAMNEAGVPCVAQFFKVTL 53 usage_00370.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 usage_00371.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 usage_00374.pdb 1 RRIPLTLTNNGG-NSYSFQVPSDSGVALPGYWMLFVMNSAGVPSVASTIRVTQ 52 RRIPLtltnnGg nSysfqVPsDsGVAlPGYwMLFvMNsAGVPsVAstirVTq #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################