################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:41:16 2021
# Report_file: c_1405_110.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00270.pdb
#   2: usage_00850.pdb
#   3: usage_00851.pdb
#   4: usage_01082.pdb
#   5: usage_01285.pdb
#   6: usage_01286.pdb
#   7: usage_01456.pdb
#   8: usage_01551.pdb
#   9: usage_01553.pdb
#  10: usage_01554.pdb
#  11: usage_01555.pdb
#
# Length:         37
# Identity:        0/ 37 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      1/ 37 (  2.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           14/ 37 ( 37.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00270.pdb         1  TKAKAVNY-LTP--IFTKTAIEKGFKDYH--------   26
usage_00850.pdb         1  SIAKNITF----GDAVDEEKLNKVIKQANLEHFIKNL   33
usage_00851.pdb         1  SIAKNITF----GDAVDEEKLNKVIKQANLEHFIKNL   33
usage_01082.pdb         1  TVKENLKY-GNP--GATDEEIKEAAKLTHSDHFIKHL   34
usage_01285.pdb         1  TIADNIRY-GRV--TAGNDEVEAAAQAAGIHDAIMAF   34
usage_01286.pdb         1  TIADNIRY-GRV--TAGNDEVEAAAQAAGIHDAIMAF   34
usage_01456.pdb         1  TVRENIAYGQLH--NASDEDVIAAAKAAYAHDFIMNL   35
usage_01551.pdb         1  TIAENIRY-GRE--DVTMDEIEKAVKEANAYDFIMKL   34
usage_01553.pdb         1  TIAENIRY-GRE--DVTMDEIEKAVKEANAYDFIMKL   34
usage_01554.pdb         1  SIAENIAY-GDNSRVVSYEEIVRAAKEANIHQFIDSL   36
usage_01555.pdb         1  TIAENIRY-GRE--DVTMDEIEKAVKEANAYDFIMKL   34
                               n                                


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################