################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:24:04 2021 # Report_file: c_0974_2.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00623.pdb # 2: usage_00624.pdb # 3: usage_00625.pdb # 4: usage_01031.pdb # 5: usage_01165.pdb # 6: usage_01166.pdb # # Length: 73 # Identity: 60/ 73 ( 82.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 67/ 73 ( 91.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 73 ( 8.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00623.pdb 1 KRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKLQASWVAHGVPPGFGKELFESDLDR 60 usage_00624.pdb 1 KRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKLQASWVAHGVPPGFGKELFESDLDR 60 usage_00625.pdb 1 ----PVLRDLEGSYYLRQERDGLLFGPYESQEKMKLQASWVAHGVPPGFGKELFESDLDR 56 usage_01031.pdb 1 ----PVLRDLEGSYYLRQERDGLLFGPYESQEKMKVQDSWVTNGVPPGFGKELFESDLDR 56 usage_01165.pdb 1 ----PVLRDLEGSYYLRQERDGLLFGPYESQEKMKLQASWVAHGVPPGFGKELFESDLDR 56 usage_01166.pdb 1 ----PVLRDLEGSYYLRQERDGLLFGPYESQEKMKLQASWVAHGVPPGFGKELFESDLDR 56 PVLRDLEGSYYLRQERDGLLFGPYESQEKMKlQaSWVahGVPPGFGKELFESDLDR usage_00623.pdb 61 ITEHVEAAMEM-- 71 usage_00624.pdb 61 ITEHVEAAMEMV- 72 usage_00625.pdb 57 ITEHVEAAMEM-- 67 usage_01031.pdb 57 IMEHIKAAMEMV- 68 usage_01165.pdb 57 ITEHVEAAMEMVP 69 usage_01166.pdb 57 ITEHVEAAMEMVP 69 ItEHveAAMEM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################