################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:25 2021 # Report_file: c_1261_46.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_03467.pdb # 2: usage_03468.pdb # 3: usage_03470.pdb # 4: usage_03471.pdb # 5: usage_03472.pdb # 6: usage_03473.pdb # 7: usage_03474.pdb # 8: usage_03475.pdb # 9: usage_03476.pdb # 10: usage_03477.pdb # 11: usage_03614.pdb # 12: usage_03615.pdb # # Length: 38 # Identity: 26/ 38 ( 68.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 38 ( 68.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 38 ( 2.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_03467.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03468.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03470.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03471.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03472.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03473.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03474.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03475.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03476.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03477.pdb 1 VLTASLLYKDGKFLDEDSARFINKINMKWQDTNWYISD 38 usage_03614.pdb 1 VLTASLLYKDGKFLDEDSARFINKINKWQDTNWYISD- 37 usage_03615.pdb 1 VLTASLLYKDGKFLDEDSARFINKINKWQDTNWYISD- 37 VLTASLLYKDGKFLDEDSARFINKIN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################