################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:33:11 2021 # Report_file: c_1367_109.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00079.pdb # 2: usage_00123.pdb # 3: usage_00124.pdb # 4: usage_00148.pdb # 5: usage_00379.pdb # 6: usage_00549.pdb # # Length: 73 # Identity: 3/ 73 ( 4.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 73 ( 24.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 73 ( 30.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00079.pdb 1 SAYMFFANENRDIVRSENPDI-TFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESE 59 usage_00123.pdb 1 SAYALFFRDTQAAIKGQNPNA-TFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQ 59 usage_00124.pdb 1 TGYVRFLNERREQIRTRHPDL-PFPEITKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKE 59 usage_00148.pdb 1 TGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKG-------- 52 usage_00379.pdb 1 SAYMFFANENRDIVRSENPDI-TFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESE 59 usage_00549.pdb 1 SAYMFFANENRDIVRSENPDI-TFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESE 59 y f e r nPd f K w L eekq y ka usage_00079.pdb 60 KELYNATLA---- 68 usage_00123.pdb 60 LAAYRASLVSK-- 70 usage_00124.pdb 60 LWAYQQ-----S- 66 usage_00148.pdb ------------- usage_00379.pdb 60 KELY--------- 63 usage_00549.pdb 60 KELYNA-----TL 67 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################