################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:55 2021 # Report_file: c_1208_58.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00085.pdb # 2: usage_00199.pdb # 3: usage_00605.pdb # 4: usage_00850.pdb # 5: usage_00851.pdb # 6: usage_01247.pdb # 7: usage_01252.pdb # 8: usage_02315.pdb # 9: usage_02316.pdb # # Length: 39 # Identity: 8/ 39 ( 20.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 39 ( 69.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 39 ( 25.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00085.pdb 1 DALTMSAKDP-LLNIGGLVAIRDNEEIFTLARQRCVPME 38 usage_00199.pdb 1 DGCTMSGKKDCLV-NIGGFLCMNDEEMFSAAKEL----- 33 usage_00605.pdb 1 --CTMSG-KDCLV-NIGGFLCMNDDEMFSSAKEL----- 30 usage_00850.pdb 1 DGCTMSGKKDCLV-NIGGFLCMNDDEMFSSAKELVVVY- 37 usage_00851.pdb 1 DGCTMSGKKDCLV-NIGGFLCMNDDEMFSSAKELVVVY- 37 usage_01247.pdb 1 DGCTMSGKKDCLV-NIGGFLCMNDDEMFSSAKELVVVY- 37 usage_01252.pdb 1 DGCTMSGKKDCLV-NIGGFLCMNDDEMFSSAKELVVVY- 37 usage_02315.pdb 1 DGCTMSGKKDCLV-NIGGFLCMNDDEMFSSAKELVVVY- 37 usage_02316.pdb 1 DGCTMSGKKDCLV-NIGGFLCMNDDEMFSSAKELVVVY- 37 cTMSg kd Lv niGgflcmnd EmFs Akel #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################