################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:09 2021 # Report_file: c_1408_78.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00147.pdb # 2: usage_00148.pdb # 3: usage_00648.pdb # 4: usage_00649.pdb # 5: usage_00650.pdb # 6: usage_00737.pdb # 7: usage_00860.pdb # 8: usage_01487.pdb # 9: usage_01511.pdb # # Length: 51 # Identity: 38/ 51 ( 74.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 51 ( 74.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 51 ( 25.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00147.pdb 1 --RDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 49 usage_00148.pdb 1 --RDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 49 usage_00648.pdb 1 -PRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 50 usage_00649.pdb 1 -PRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 50 usage_00650.pdb 1 RPRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 51 usage_00737.pdb 1 -PRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 50 usage_00860.pdb 1 -PRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 50 usage_01487.pdb 1 -------------QLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 38 usage_01511.pdb 1 -PRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI 50 QLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################