################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:38 2021 # Report_file: c_1432_32.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00075.pdb # 2: usage_00380.pdb # 3: usage_00695.pdb # 4: usage_00787.pdb # 5: usage_01230.pdb # 6: usage_01239.pdb # 7: usage_01324.pdb # # Length: 63 # Identity: 10/ 63 ( 15.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 63 ( 25.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 63 ( 30.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00075.pdb 1 REAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLM-SWRVND- 58 usage_00380.pdb 1 -NSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLA------- 52 usage_00695.pdb 1 -KPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQ-VIKKTE- 57 usage_00787.pdb 1 -KPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQ-VIK---- 54 usage_01230.pdb 1 -KPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQ-VIKKTET 58 usage_01239.pdb 1 -KPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQ-VIKKT-- 56 usage_01324.pdb 1 --------EPLLDVLQKLCKIHQPENPQHFAELLGRLTELRTFNHHHAEMLM-SWRVND- 50 Ll L k Pe q Fa LL t LR H L usage_00075.pdb --- usage_00380.pdb --- usage_00695.pdb --- usage_00787.pdb --- usage_01230.pdb 59 DMS 61 usage_01239.pdb --- usage_01324.pdb --- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################