################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:48:28 2021 # Report_file: c_0413_4.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00008.pdb # 2: usage_00009.pdb # 3: usage_00017.pdb # 4: usage_00018.pdb # 5: usage_00019.pdb # 6: usage_00114.pdb # 7: usage_00182.pdb # 8: usage_00183.pdb # # Length: 69 # Identity: 56/ 69 ( 81.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 69 ( 81.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 69 ( 18.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00008.pdb 1 ---EVVMENVTAFWEEGL-GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP 56 usage_00009.pdb 1 ---EVVMENVTAFW--------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP 49 usage_00017.pdb 1 ---EVVMENVTAFW----GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP 53 usage_00018.pdb 1 ---EVVMENVTAFWE-E-GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP 55 usage_00019.pdb 1 TTTEVVMENVTAFWE-E-GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP 58 usage_00114.pdb 1 ---EVVMENVTAFWE-----TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP 52 usage_00182.pdb 1 ---EVVMENVTAFWE-E-GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP 55 usage_00183.pdb 1 ---EVVMENVTAFWE-E-GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP 55 EVVMENVTAFW VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEP usage_00008.pdb 57 SEGKIKHS- 64 usage_00009.pdb 50 SEGKIKH-- 56 usage_00017.pdb 54 SEGKIKHSG 62 usage_00018.pdb 56 SEGKIKHS- 63 usage_00019.pdb 59 SEGKIKHSG 67 usage_00114.pdb 53 SEGKIKH-- 59 usage_00182.pdb 56 SEGKIKHSG 64 usage_00183.pdb 56 SEGKIKHSG 64 SEGKIKH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################