################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:54 2021 # Report_file: c_1120_101.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00360.pdb # 2: usage_00561.pdb # 3: usage_00562.pdb # 4: usage_00895.pdb # 5: usage_00896.pdb # 6: usage_01060.pdb # # Length: 79 # Identity: 26/ 79 ( 32.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 79 ( 64.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 79 ( 17.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00360.pdb 1 -----RANIFRIHSKS-SVERGIRWELISRLCPNSTGAELRSVCTEAG-FAIRARRKVAT 53 usage_00561.pdb 1 -DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 59 usage_00562.pdb 1 -DLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 59 usage_00895.pdb 1 -DLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIAT 59 usage_00896.pdb 1 A----RLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVV 56 usage_01060.pdb 1 ------THIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIAT 54 If IH s sver Ir El rLcpnstGAe RsVCTEAG FAIRArrk at usage_00360.pdb 54 EKDFLKAVDKVIS------ 66 usage_00561.pdb 60 EKDFLKAVDKVISG----- 73 usage_00562.pdb 60 EKDFLKAVDKVISG----- 73 usage_00895.pdb 60 EKDFLEAVNKVIKSYAKF- 77 usage_00896.pdb 57 QEDFMKAVRKVADSKKLES 75 usage_01060.pdb 55 EKDFLEAVNKVIKSYAKFS 73 ekDFl AV KVi #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################