################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:25 2021 # Report_file: c_1033_53.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00050.pdb # 2: usage_00256.pdb # 3: usage_00315.pdb # 4: usage_00411.pdb # 5: usage_00412.pdb # 6: usage_00496.pdb # 7: usage_00525.pdb # 8: usage_00586.pdb # 9: usage_00908.pdb # 10: usage_00916.pdb # # Length: 67 # Identity: 2/ 67 ( 3.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 67 ( 10.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 67 ( 29.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00050.pdb 1 -VNKLLVGNKSDLTT-KK-VVDNTTAKEFADSLGI-PFLETSAKNATNVEQAFMTMAAEI 56 usage_00256.pdb 1 --DIVLIGNKADLPD-QR-EVNERQARELADKYGI-PYFETSAATGQNVEKAVETLLDLI 55 usage_00315.pdb 1 --LVVLVGNKCDLDT-RR-EVGTLEGSSLAKKLGC-GFVETSAKLGTNVEEAFFSVVRAD 55 usage_00411.pdb 1 --DIVLIGNKADLPD-QR-EVNERQARELAEKYGI-PYFETSAATGQNVEKSVETLLDLI 55 usage_00412.pdb 1 --DIVLIGNKADLPD-QR-EVNERQARELAEKYGI-PYFETSAATGQNVEKSVETLLDLI 55 usage_00496.pdb 1 DTQIIIIGNKKDQEI-DR-IITRKEAEQFAQDRLC-QFYEISTKDD-SCQLLFDCISRDF 56 usage_00525.pdb 1 --NIILVLNKFDLL---A-KIDI---KKMRKELGV-PVIPTNAKKGEGVEELKRMIALMA 50 usage_00586.pdb 1 --VIALAGNKADLAS-KR-AVEFQEAQAYADDNSL-LFMETSAKTAMNVNEIFMAIAKK- 54 usage_00908.pdb 1 --VIMLVGNKSD-RH-LR-AVPT-EARAFAEKNGL-SFIETSALDSTNVEAAFQTILTEI 53 usage_00916.pdb 1 --KTVLVGLKVDLRKDGSDDVTKQEGDDLCQKLGCVAYIEASSVAKIGLNEVFEKSVDCI 58 l gnK D e s usage_00050.pdb 57 KKRM--- 60 usage_00256.pdb 56 MKRMEQC 62 usage_00315.pdb 56 RRR---- 58 usage_00411.pdb 56 MKRMEKC 62 usage_00412.pdb 56 MKRMEKC 62 usage_00496.pdb 57 LQ----- 58 usage_00525.pdb 51 EG----- 52 usage_00586.pdb ------- usage_00908.pdb 54 YR----- 55 usage_00916.pdb ------- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################