################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:24 2021 # Report_file: c_0715_13.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00193.pdb # 2: usage_00194.pdb # 3: usage_00195.pdb # 4: usage_00196.pdb # 5: usage_00519.pdb # 6: usage_00530.pdb # # Length: 75 # Identity: 9/ 75 ( 12.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 75 ( 34.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/ 75 ( 36.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00193.pdb 1 -NKSTFSL-N--DT-AWVDFYQLQN-------YTFPAIIICPGGGYQHISQRESDPLALA 48 usage_00194.pdb 1 -NKSTFSL-N--DT-AWVDFYQLQN-------YTFPAIIICPGGGYQHISQRESDPLALA 48 usage_00195.pdb 1 -NKSTFSL-N--DT-AWVDFYQLQN-------YTFPAIIICPGGGYQHISQRESDPLALA 48 usage_00196.pdb 1 -NKSTFSL-N--DT-AWVDFYQLQN-------YTFPAIIICPGGGYQHISQRESDPLALA 48 usage_00519.pdb 1 VI-KQKLT-A--TC-AQLTGYLH---------TNLPAIIIVPGGSYTHIPVAQAESLA-A 45 usage_00530.pdb 1 -QVEQRTLNTAAH-PFQITAYWLDQISDFETAVDY-PIIICPGGGFTYHSGREEAPIATR 57 l a Y l aIIIcPGGgy his re plA a usage_00193.pdb 49 FLAQGY---QVLLLN 60 usage_00194.pdb 49 FLAQGY---QVLLLN 60 usage_00195.pdb 49 FLAQGY---QVLLLN 60 usage_00196.pdb 49 FLAQGY---QVLLLN 60 usage_00519.pdb 46 FAGHGY---QAFYLE 57 usage_00530.pdb 58 ------AAGHTVVLN 66 q Ln #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################