################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:03:49 2021
# Report_file: c_1201_72.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00151.pdb
#   2: usage_00153.pdb
#   3: usage_00161.pdb
#   4: usage_00171.pdb
#   5: usage_00469.pdb
#   6: usage_00540.pdb
#   7: usage_00602.pdb
#   8: usage_00691.pdb
#   9: usage_01379.pdb
#  10: usage_01383.pdb
#  11: usage_01393.pdb
#  12: usage_01521.pdb
#  13: usage_01640.pdb
#
# Length:         30
# Identity:        1/ 30 (  3.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      5/ 30 ( 16.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           10/ 30 ( 33.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00151.pdb         1  ---IGEGTYGVVYKARNKLTGEVVALKKIR   27
usage_00153.pdb         1  IMELGRGAYGVVEKMRHVPSGQIMAVKRIR   30
usage_00161.pdb         1  ----GEGTYGVVYKARNKLTGEVVALKKIR   26
usage_00171.pdb         1  ----GRGSFGEVHRMEDKQTGFQCAVKKVR   26
usage_00469.pdb         1  ---LGAGNGGVVFKVSHKPSGLVMARKLIH   27
usage_00540.pdb         1  ----GEGTYGVVYKARNKLTGEVVALKIR-   25
usage_00602.pdb         1  ----GEGTYGVVYKARNKLTGEVVALKKI-   25
usage_00691.pdb         1  ----GEGTYGVVYKARNKLTGEVVALKKIR   26
usage_01379.pdb         1  ---IGEGTYGVVYKARNKLTGEVVALKKIR   27
usage_01383.pdb         1  ----GEGTYGVVYKARNKLTGEVVALKKIR   26
usage_01393.pdb         1  ---ILYGG-RNKAIATPVQG-VWDMR----   21
usage_01521.pdb         1  ----GLGINGKVLQIFNKRTQEKFALKLQ-   25
usage_01640.pdb         1  ----GNGTYGQVYKGRHVKTGQLAAIKVMD   26
                               g G  g v            a     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################