################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:04 2021 # Report_file: c_1387_16.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01725.pdb # 2: usage_01902.pdb # 3: usage_01903.pdb # 4: usage_01904.pdb # 5: usage_01905.pdb # 6: usage_02124.pdb # # Length: 81 # Identity: 2/ 81 ( 2.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 81 ( 30.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 28/ 81 ( 34.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01725.pdb 1 SAPIDQCLKQFEDRLLEFYSRNIEYGIKKGVFKNVPVSPIAHSILAIEKFSLYKWVVLKA 60 usage_01902.pdb 1 -EAFSDRFRQNDEYVRY-LKAVINHGIDEGVFTDVDAEHVTRSLLTIIDGARTRAV--L- 55 usage_01903.pdb 1 -------------------KAVINHGIDEGVFTDVDAEHVTRSLLTIIDGARTRAV--L- 38 usage_01904.pdb 1 KEAFSDRFRQNDEYVRY-LKAVINHGIDEGVFTDVDAEHVTRSLLTIIDGARTRAV--L- 56 usage_01905.pdb 1 -------------------KAVINHGIDEGVFTDVDAEHVTRSLLTIIDGARTRAV--L- 38 usage_02124.pdb 1 -ESMRITLRDGSDGIIERLVGCLGQGRDDGSLAPCDARHMASALYQLWLGASLLSKL-H- 57 i Gid Gvf vda h sll i ga v usage_01725.pdb 61 ITKEE-IEVLSFHKTLA---- 76 usage_01902.pdb 56 DDTEELETARQTASEYADA-- 74 usage_01903.pdb 39 DDTEELETARQTASEYADA-- 57 usage_01904.pdb 57 DDTEELETARQTASEYADA-- 75 usage_01905.pdb 39 DDTEELETARQTASEYADALQ 59 usage_02124.pdb 58 RSPGPLETAMQTTRSL----- 73 ee eta qt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################