################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:49 2021 # Report_file: c_0952_29.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00055.pdb # 2: usage_00056.pdb # 3: usage_00218.pdb # 4: usage_00418.pdb # 5: usage_00601.pdb # 6: usage_01568.pdb # 7: usage_01682.pdb # # Length: 68 # Identity: 20/ 68 ( 29.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 68 ( 41.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 68 ( 11.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00055.pdb 1 LTLWTTPDPPPNCSLIQELDAKLTLCLTKNGSIVNGIVSLVGVKGNLLNIQS---T-TTT 56 usage_00056.pdb 1 LTLWTTPDPPPNCSLIQELDAKLTLCLTKNGSIVNGIVSLVGVKGNLLNIQS---T-TTT 56 usage_00218.pdb 1 --LWTPPTSNPNCTVYTESDSLLSLCLTKCGAHVLGSVSLTGVAGTMTNMAE------TS 52 usage_00418.pdb 1 RTLWTTPDTSPNCTIAQDKDSKLTLVLTKCGSQILANVSLIVVAGKYHIINNKTNPKIKS 60 usage_00601.pdb 1 RTLWTTPDTSPNCTIAQDKDSKLTLVLTKCGSQILANVSLIVVAGKYHIINNKTNPKIKS 60 usage_01568.pdb 1 RTLWTTPDTSPNCTIAQDKDSKLTLVLTKCGSQILANVSLIVVAGKYHIINNKTNPKIKS 60 usage_01682.pdb 1 RTLWTTPDTSPNCTIAQDKDSKLTLVLTKCGSQILANVSLIVVAGKYHIINNKTNPKIKS 60 LWTtPd PNC q D kLtL LTK Gs VSL V G i usage_00055.pdb 57 VGVHLVFD 64 usage_00056.pdb 57 VGVHLVFD 64 usage_00218.pdb 53 LAIEFTFD 60 usage_00418.pdb 61 FTIKLLFN 68 usage_00601.pdb 61 FTIKLLFN 68 usage_01568.pdb 61 FTIKLLFN 68 usage_01682.pdb 61 FTIKLLFN 68 l F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################