################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:45 2021 # Report_file: c_0783_16.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00010.pdb # 2: usage_00026.pdb # 3: usage_00082.pdb # 4: usage_00087.pdb # 5: usage_00088.pdb # 6: usage_00089.pdb # 7: usage_00100.pdb # 8: usage_00101.pdb # # Length: 65 # Identity: 2/ 65 ( 3.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 65 ( 15.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 65 ( 15.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 --WDLPTAYPASNLHVENLTQFVKDVDSLSGGKLKITLHNNASLYKAPEIKRAVQGNQAQ 58 usage_00026.pdb 1 --WRYAHEEYEGDVQDVFAQAFKGYVEDNS--DHTVQVYRFGELGESDDIMEQTQNGILQ 56 usage_00082.pdb 1 --WRGWNIHVDGYPNTVAD-KFAELLAVKTGGEYTLQ-FHGGTLGSQPDAIEQVRAGALE 56 usage_00087.pdb 1 --WRGWNIHPPSYPNGKALESFAKEVAEKTEGRVEPKVYHNAVLGDQPDAIEQTRSGALD 58 usage_00088.pdb 1 --WRGWNIHPPSYPNGKALESFAKEVAEKTEGRVEPKVYHNAVLGDQPDAIEQTRSGALD 58 usage_00089.pdb 1 --WRGWNIHPPSYPNGKALESFAKEVAEKTEGRVEPKVYHNAVLGDQPDAIEQTRSGALD 58 usage_00100.pdb 1 --WRGWNIHVEDYPVSHGE-A-FEEVTEKTGGEIKGKVFHAGVLGSQPDAIEQLRLGIDF 56 usage_00101.pdb 1 KDWRGWNIHVEDYPVSHGE-A-FEEVTEKTGGEIKGKVFHAGVLGSQPDAIEQLRLGIDF 58 Wr v Lg pd eq g usage_00010.pdb 59 IGEIL 63 usage_00026.pdb 57 FVN-- 59 usage_00082.pdb 57 IGN-- 59 usage_00087.pdb 59 FAN-- 61 usage_00088.pdb 59 FAN-- 61 usage_00089.pdb 59 FAN-- 61 usage_00100.pdb 57 GV--- 58 usage_00101.pdb 59 GV--- 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################