################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:18:00 2021 # Report_file: c_1298_28.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00047.pdb # 2: usage_00311.pdb # 3: usage_00495.pdb # 4: usage_00496.pdb # 5: usage_00528.pdb # 6: usage_00529.pdb # 7: usage_00530.pdb # 8: usage_00602.pdb # 9: usage_00704.pdb # 10: usage_00735.pdb # 11: usage_01520.pdb # 12: usage_01521.pdb # 13: usage_01655.pdb # 14: usage_01656.pdb # 15: usage_01664.pdb # 16: usage_01770.pdb # 17: usage_01886.pdb # 18: usage_01887.pdb # # Length: 31 # Identity: 29/ 31 ( 93.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 31 ( 93.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 31 ( 6.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00047.pdb 1 -EDQVDQLALYAPQATVNRIDNYEVVGKSR- 29 usage_00311.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_00495.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_00496.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_00528.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_00529.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_00530.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_00602.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_00704.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_00735.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSRP 31 usage_01520.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_01521.pdb 1 -EDQVDQLALYAPQATVNRIDNYEVVGKSR- 29 usage_01655.pdb 1 -EDQVDQLALYAPQATVNRIDNYEVVGKSR- 29 usage_01656.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_01664.pdb 1 -EDQVDQLALYAPQATVNRIDNYEVVGKSR- 29 usage_01770.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_01886.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 usage_01887.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR- 30 EDQVDQLALYAPQATVNRIDNYEVVGKSR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################