################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:39 2021 # Report_file: c_1407_21.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00138.pdb # 2: usage_00786.pdb # 3: usage_00787.pdb # 4: usage_01072.pdb # 5: usage_01073.pdb # # Length: 77 # Identity: 66/ 77 ( 85.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 66/ 77 ( 85.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 77 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00138.pdb 1 PRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHV 60 usage_00786.pdb 1 PRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHV 60 usage_00787.pdb 1 ---LLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHV 57 usage_01072.pdb 1 -RNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHV 59 usage_01073.pdb 1 PRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHV 60 LLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHV usage_00138.pdb 61 DLPQAVISKDTNRQRY- 76 usage_00786.pdb 61 DLPQAVISKDTNRQR-- 75 usage_00787.pdb 58 DLPQAVISKDTNRQRYP 74 usage_01072.pdb 60 DLPQAVISKMDT----- 71 usage_01073.pdb 61 DLPQAVISK-------- 69 DLPQAVISK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################