################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:14 2021 # Report_file: c_1409_7.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00254.pdb # 2: usage_00255.pdb # 3: usage_01032.pdb # 4: usage_01539.pdb # 5: usage_01614.pdb # 6: usage_01866.pdb # 7: usage_01867.pdb # 8: usage_01868.pdb # 9: usage_01869.pdb # # Length: 65 # Identity: 17/ 65 ( 26.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 65 ( 46.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 65 ( 27.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00254.pdb 1 -LDLWNKFLL--EHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEF--- 54 usage_00255.pdb 1 FLDLWNKFLL--EHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEF--- 55 usage_01032.pdb 1 -LDSWLEFLK--N-NTHSISRDTWNLLYDFSQL---KDLSDY--DAWPVLIDDFVKWLKH 51 usage_01539.pdb 1 --DQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEME 58 usage_01614.pdb 1 -LDLWNKFLL--EHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEF--- 54 usage_01866.pdb 1 -LDLWNTFLM--EHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEY--- 54 usage_01867.pdb 1 FLDLWNTFLM--EHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEY--- 55 usage_01868.pdb 1 FLDLWNTFLM--EHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEY--- 55 usage_01869.pdb 1 FLDLWNTFLM--EHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEY--- 55 D W FL sI DTWNllldF d sny AWPvLiDdFVe usage_00254.pdb ----- usage_00255.pdb ----- usage_01032.pdb ----- usage_01539.pdb 59 RRKRE 63 usage_01614.pdb ----- usage_01866.pdb ----- usage_01867.pdb ----- usage_01868.pdb ----- usage_01869.pdb ----- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################