################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:14:37 2021 # Report_file: c_0240_25.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00031.pdb # 2: usage_00032.pdb # 3: usage_00063.pdb # 4: usage_00118.pdb # 5: usage_00139.pdb # # Length: 147 # Identity: 10/147 ( 6.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/147 ( 13.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 30/147 ( 20.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00031.pdb 1 LAITFVAEGDIHDIGHRLVTT---------MLGA-NGFQIVDLGVDVLNENVVEEAAKHK 50 usage_00032.pdb 1 KMVIATVKGDVHDIGKNIVGV---------VLQC-NNYEIVDLGVMVPAEKILRTAKEVN 50 usage_00063.pdb 1 KIVLATVEGDLHDIGKNIFRT---------MAEA-SGFEVFDLGIDVPVKIIVDKVKEVN 50 usage_00118.pdb 1 TVVCHVAEGDVHDIGKNIVTA---------LLRA-NGYNVVDLGRDVPAEEVLAAVQKEK 50 usage_00139.pdb 1 VVVGASTGTDAHTVGIDAIMNMKGYAGHYG-LERYEMIDAYNLGSQVANEDFIKKAVELE 59 v gD HdiG l dLG V e usage_00031.pdb 51 GEKVLLVGSALMT---TSMLGQKDLMDRLNEEKLRDSVKCMFGGAPVSDKWIEEIGA--- 104 usage_00032.pdb 51 -A-DLIGLSGLIT---PSLDEMVNVAKEMERQGF-T-IPLLIGGATTSKAHTAVKIEQNY 103 usage_00063.pdb 51 -P-EIVGLSGVLT---LALDSMRETVDALKAEGLRNDLKVIIGGVPVNENVCQRVGA--- 102 usage_00118.pdb 51 -P-IMLTGTALMT---TTMYAFKEVNDMLLENGI-K-IPFACGGGAVNQDFVSQFAL--- 100 usage_00139.pdb 60 -A-DVLLVSQTVTQKNVHIQNMTHLIELLEAEGLRDRFVLLCGGPRINNEIAKELGY--- 114 s T l g GG usage_00031.pdb 105 ---DATA---ENAAEAAKVALEV-M-- 122 usage_00032.pdb 104 SGPTVYV---QNASRTVGVVAAL-L-- 124 usage_00063.pdb 103 ---DDFS---TNAADGVKICQRW-V-- 120 usage_00118.pdb 101 ---GVYG---EEAADAPKIADAIIA-- 119 usage_00139.pdb 115 ---DAGFGPGRFADDVATFAVKTLNDR 138 A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################