################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:02 2021 # Report_file: c_1315_16.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00134.pdb # 2: usage_00135.pdb # 3: usage_00136.pdb # 4: usage_00260.pdb # 5: usage_00388.pdb # 6: usage_00424.pdb # 7: usage_00425.pdb # 8: usage_00426.pdb # 9: usage_00427.pdb # 10: usage_00428.pdb # 11: usage_00429.pdb # 12: usage_00519.pdb # 13: usage_00520.pdb # # Length: 46 # Identity: 13/ 46 ( 28.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 46 ( 56.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 46 ( 13.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00134.pdb 1 VSHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 45 usage_00135.pdb 1 -SHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 44 usage_00136.pdb 1 VSHIQSAVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 45 usage_00260.pdb 1 NSHIQATILCSKKVGLQIRTRSGGHDAEGMSYISQ---VPFVVVDL 43 usage_00388.pdb 1 ASDVQTVIRCAQLHGIHVRTRSAGHCYEGLSYIA-YNKPFAVIDL- 44 usage_00424.pdb 1 VSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 45 usage_00425.pdb 1 VSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 45 usage_00426.pdb 1 -SHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 44 usage_00427.pdb 1 VSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 45 usage_00428.pdb 1 VSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 45 usage_00429.pdb 1 -SHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDL- 44 usage_00519.pdb 1 -SHIQAAVVCGRRHGMRIRVRSGGHDYEGLSYRSEKPEPFAVVDM- 44 usage_00520.pdb 1 -SHIQAAVVCGRRHGMRIRVRSGGHDYEGLSYRSEKPEPFAVVDM- 44 ShiQ C h iR RSgGHdyEGlSY s faVvd #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################