################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:21 2021 # Report_file: c_1238_29.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00075.pdb # 2: usage_00076.pdb # 3: usage_00245.pdb # 4: usage_00246.pdb # 5: usage_00278.pdb # 6: usage_00336.pdb # 7: usage_00337.pdb # 8: usage_00398.pdb # 9: usage_00730.pdb # 10: usage_00819.pdb # 11: usage_01381.pdb # 12: usage_01382.pdb # # Length: 47 # Identity: 17/ 47 ( 36.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 47 ( 38.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 47 ( 12.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00075.pdb 1 HIIKIGRTHTQDATPLTLG-QEFSGYAAQVASSIKRIETLPGLC-E- 44 usage_00076.pdb 1 HIIKIGRTHTQDATPLTLG-QEFSGYAAQVASSIKRIETLPGLC-E- 44 usage_00245.pdb 1 -IIKIGRTHLQDATPLT-LKQEFSGYITQIEYALERIEDALKKVY-- 43 usage_00246.pdb 1 KIIKIGRTHLQDATPLT-LKQEFSGYITQIEYALERIEDALKKVY-- 44 usage_00278.pdb 1 DIVKIGRTHLQDATPLT-LGQEFSGYVAQLDQGIRHVEAALPHLY-- 44 usage_00336.pdb 1 DIVKIGRTHLQDATPLT-LGQEISGWVAMLEHNLKHIEYSLPHVA-- 44 usage_00337.pdb 1 DIVKIGRTHLQDATPLT-LGQEISGWVAMLEHNLKHIEYSLPHVA-- 44 usage_00398.pdb 1 DIVKIGRTHLQDATPLT-LGQEISGWVAMLEHNLKHIEYSLPHVA-- 44 usage_00730.pdb 1 DIVKIGRTHLQDATPLT-LGQEISGWVAMLEHNLKHIEYSLPHVA-- 44 usage_00819.pdb 1 -IVKIGRTHLQDATPLT-LGQEISGWVAMLEHNLKHIEYSLPHVA-- 43 usage_01381.pdb 1 QIIKIGRTHTQDAVPLT-LGQEFSGYVQQVKYAMTRIKAAMPRIY-E 45 usage_01382.pdb 1 QIIKIGRTHTQDAVPLT-LGQEFSGYVQQVKYAMTRIKAAMPRIY-E 45 I KIGRTH QDA PLT QE SG i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################