################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:07 2021 # Report_file: c_0651_77.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00204.pdb # 2: usage_00205.pdb # 3: usage_00402.pdb # 4: usage_00403.pdb # 5: usage_00406.pdb # 6: usage_00407.pdb # # Length: 66 # Identity: 28/ 66 ( 42.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 66 ( 42.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 66 ( 31.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00204.pdb 1 ---FCNGEDEAPLVNDG-STMTDVATYVNIFTAVDADKWEVAWQVKVSGNLDNCDADYEG 56 usage_00205.pdb 1 ---FCNGEDEAPLVNDG-STMTDVATYVNIFTAVDADKWEVAWQVKVSGNLDNCDADYEG 56 usage_00402.pdb 1 KYVICNGE--F----------------RSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDG 42 usage_00403.pdb 1 KYVICNGE--F----------------RSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDG 42 usage_00406.pdb 1 ---ICNGEFEIPMNNDGKASLEDVSTYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDG 57 usage_00407.pdb 1 ---ICNGEFEIPMNNDGKASLEDVSTYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDG 57 CNGE F DA K EVA QV V GNLDN DADY G usage_00204.pdb 57 KWAFST 62 usage_00205.pdb 57 KWAFST 62 usage_00402.pdb 43 KYFFST 48 usage_00403.pdb 43 KYFFST 48 usage_00406.pdb 58 KYFFST 63 usage_00407.pdb 58 KYFFST 63 K FST #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################