################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:10 2021 # Report_file: c_1242_116.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00078.pdb # 2: usage_00962.pdb # 3: usage_00963.pdb # 4: usage_01366.pdb # 5: usage_01367.pdb # 6: usage_01423.pdb # 7: usage_01424.pdb # 8: usage_01425.pdb # 9: usage_01584.pdb # 10: usage_02220.pdb # 11: usage_02221.pdb # # Length: 37 # Identity: 14/ 37 ( 37.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 37 ( 37.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 37 ( 8.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00078.pdb 1 --LAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVV 35 usage_00962.pdb 1 RTIGVITKLDL-DEGTDARDVLENKLLPLRRGYIGVV 36 usage_00963.pdb 1 RTIGVITKLDL-DEGTDARDVLENKLLPLRRGYIGVV 36 usage_01366.pdb 1 --IGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVV 35 usage_01367.pdb 1 --IGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVV 35 usage_01423.pdb 1 RTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVV 37 usage_01424.pdb 1 RTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVV 37 usage_01425.pdb 1 --IGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVV 35 usage_01584.pdb 1 --LAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVV 35 usage_02220.pdb 1 RTFGVLTKIDLMDKGTDAVEILEGRSFKLKYPWVGVV 37 usage_02221.pdb 1 --FGVLTKIDLMDKGTDAVEILEGRSFKLKYPWVGVV 35 V TK DL D GTDA L GVV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################