################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:07 2021 # Report_file: c_0895_25.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00135.pdb # 2: usage_00136.pdb # 3: usage_00159.pdb # 4: usage_00208.pdb # 5: usage_00209.pdb # 6: usage_00210.pdb # 7: usage_00211.pdb # 8: usage_00212.pdb # 9: usage_00213.pdb # # Length: 67 # Identity: 9/ 67 ( 13.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 67 ( 38.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 67 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00135.pdb 1 ---ELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISEL 57 usage_00136.pdb 1 ---ELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISEL 57 usage_00159.pdb 1 --SPLETFLASLHMEDFAALLRQEKIDLEALMLCSDLDLRSISVP-LGPREKILGAVRRR 57 usage_00208.pdb 1 KGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKLLAISELN 60 usage_00209.pdb 1 ---DLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKLLAISELN 57 usage_00210.pdb 1 ----LPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREK-LLAISEL 55 usage_00211.pdb 1 ----LPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISEL 56 usage_00212.pdb 1 ----LPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISEL 56 usage_00213.pdb 1 ----LPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGAREKMLLAISEL 56 L kL l ky f qe D fltltD DLkelgi G R L usage_00135.pdb 58 N------ 58 usage_00136.pdb 58 NAG---- 60 usage_00159.pdb 58 RQAMERP 64 usage_00208.pdb 61 K------ 61 usage_00209.pdb 58 K------ 58 usage_00210.pdb 56 N------ 56 usage_00211.pdb 57 NK----- 58 usage_00212.pdb 57 NK----- 58 usage_00213.pdb 57 NKNRR-- 61 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################