################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:55 2021 # Report_file: c_1209_136.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00438.pdb # 2: usage_00439.pdb # 3: usage_00440.pdb # 4: usage_00470.pdb # 5: usage_00983.pdb # 6: usage_00984.pdb # 7: usage_00985.pdb # 8: usage_00986.pdb # 9: usage_00987.pdb # 10: usage_00988.pdb # 11: usage_00989.pdb # 12: usage_00990.pdb # 13: usage_00991.pdb # # Length: 30 # Identity: 7/ 30 ( 23.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 30 ( 80.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 30 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00438.pdb 1 -RCFTDGNLVTGAAWPGHPEFVSQLALLG- 28 usage_00439.pdb 1 -RCFTDGNLVTGAAWPGHPEFVSQLALLG- 28 usage_00440.pdb 1 -RCFTDGNLVTGAAWPGHPEFVSQLALLG- 28 usage_00470.pdb 1 -RAVSDGGVVTAAG-SAPVSFAVEILKSLG 28 usage_00983.pdb 1 DRCFTDGNLVTGAAWPGHPEFVSQLMALL- 29 usage_00984.pdb 1 -RCFTDGNLVTGAAWPGHPEFVSQLMALLG 29 usage_00985.pdb 1 DRCFTDGNLVTGAAWPGHPEFVSQLMALL- 29 usage_00986.pdb 1 DRCFTDGNLVTGAAWPGHPEFVSQLMALLG 30 usage_00987.pdb 1 DRCFTDGNLVTGAAWPGHPEFVSQLMALLG 30 usage_00988.pdb 1 DRCFTDGNLVTGAAWPGHPEFVSQLMALLG 30 usage_00989.pdb 1 DRCFTDGNLVTGAAWPGHPEFVSQLMALLG 30 usage_00990.pdb 1 -RCFTDGNLVTGAAWPGHPEFVSQLMALLG 29 usage_00991.pdb 1 -RCFTDGNLVTGAAWPGHPEFVSQLMALLG 29 RcftDGnlVTgAa pghpeFvsql l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################