################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:48:57 2021 # Report_file: c_1382_8.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00008.pdb # 2: usage_00015.pdb # 3: usage_00073.pdb # 4: usage_00088.pdb # 5: usage_00089.pdb # 6: usage_00090.pdb # 7: usage_00097.pdb # 8: usage_00276.pdb # 9: usage_00341.pdb # 10: usage_00384.pdb # 11: usage_00390.pdb # 12: usage_00521.pdb # 13: usage_00973.pdb # 14: usage_01022.pdb # 15: usage_01323.pdb # 16: usage_01531.pdb # 17: usage_01746.pdb # # Length: 42 # Identity: 6/ 42 ( 14.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 42 ( 69.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 42 ( 28.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00008.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_00015.pdb 1 QREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 42 usage_00073.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPTLCYWILHSLELLD 41 usage_00088.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_00089.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_00090.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_00097.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_00276.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_00341.pdb 1 -LHHWLHRLQEAPKKE---------SPGCLEASVTFNLFRLL 32 usage_00384.pdb 1 --EKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 40 usage_00390.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_00521.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_00973.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_01022.pdb 1 --EKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 40 usage_01323.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 usage_01531.pdb 1 --EKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELL- 39 usage_01746.pdb 1 -REKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLD 41 ekhfHyLkrglrql Srp LcywilhsLelL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################