################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:13 2021 # Report_file: c_1403_6.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00129.pdb # 2: usage_00237.pdb # 3: usage_00545.pdb # 4: usage_00724.pdb # 5: usage_00725.pdb # 6: usage_00767.pdb # 7: usage_00978.pdb # 8: usage_01133.pdb # 9: usage_01134.pdb # 10: usage_01155.pdb # 11: usage_01326.pdb # # Length: 92 # Identity: 9/ 92 ( 9.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 92 ( 22.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 92 ( 23.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00129.pdb 1 ----VPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITS--PFK 54 usage_00237.pdb 1 ----VPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQ 56 usage_00545.pdb 1 ----VPFWAHYAA-AQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVH--AVF 53 usage_00724.pdb 1 GLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQ 60 usage_00725.pdb 1 ----VPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQ 56 usage_00767.pdb 1 -----PFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICH--P-- 51 usage_00978.pdb 1 ---SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITR--PLT 55 usage_01133.pdb 1 ---VVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQ 57 usage_01134.pdb 1 ---VVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQ 57 usage_01155.pdb 1 ----VPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQ 56 usage_01326.pdb 1 ----VPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQ 56 pf i W fGN C id s l DRY ai usage_00129.pdb 55 YQSLLTKNKARVIILMVWIVSGLTSFLPIQMH 86 usage_00237.pdb 57 S--LLTKNKARVIILMVWIVSGLTSFLPIQMH 86 usage_00545.pdb 54 ALKARTVTFGVVTSVITWVVAVFASL------ 79 usage_00724.pdb 61 S--LLTKNKARVIILMVWIVSGLTSFLPIQMH 90 usage_00725.pdb 57 S--LLTKNKARVIILMVWIVSGLTSFLPIQMH 86 usage_00767.pdb 52 ----RTSSKAQAVNVAIWALASVVGVPVAIM- 78 usage_00978.pdb 56 YRAKRTTKRAGVMIGLAWVISFVLW------- 80 usage_01133.pdb 58 S--LLTKNKARVIILMVWIVSGLTSFLPIQMH 87 usage_01134.pdb 58 S--LLTKNKARVIILMVWIVSGLTSFLPIQMH 87 usage_01155.pdb 57 S--LLTKNKARVIILMVWIVSGLTSFLPIQMH 86 usage_01326.pdb 57 S--LLTKNKARVIILMVWIVSGLT-------- 78 T a v W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################