################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:04 2021 # Report_file: c_0395_13.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00063.pdb # 2: usage_00187.pdb # 3: usage_00421.pdb # 4: usage_00422.pdb # 5: usage_00423.pdb # 6: usage_00424.pdb # 7: usage_00425.pdb # 8: usage_00428.pdb # # Length: 68 # Identity: 23/ 68 ( 33.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 68 ( 60.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 68 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00063.pdb 1 GSVAVAADAKSVIWTPEN---ASPAVTTDNGNSWKVCTNL-GGAVVASDRVNGKKFYAFY 56 usage_00187.pdb 1 GTVAASADGSRFVWAPGD-PGQPVVYAVGFGNSWAASQGVPANAQIRSDRVNPKTFYALS 59 usage_00421.pdb 1 GNVALAADGGAIVWAPGGS--TNVYLSTTFGSTWTAISALPAGAVIEADRVNPNKFYALA 58 usage_00422.pdb 1 GNVALAADGGAIVWAPGGS--TNVYLSTTFGSTWTAISALPAGAVIEADRVNPNKFYALA 58 usage_00423.pdb 1 GNVALAADGGAIVWAPGGS--TNVYLSTTFGSTWTAISALPAGAVIEADRVNPNKFYALA 58 usage_00424.pdb 1 GNVALAADGGAIVWAPGGS--TNVYLSTTFGSTWTAISALPAGAVIEADRVNPNKFYALA 58 usage_00425.pdb 1 GNVALAADGGAIVWAPGGS--TNVYLSTTFGSTWTAISALPAGAVIEADRVNPNKFYALA 58 usage_00428.pdb 1 GNVALAADGGAIVWAPGGS--TNVYLSTTFGSTWTAISALPAGAVIEADRVNPNKFYALA 58 G VA aADg vWaPg v t fG W a l agAvi DRVNp kFYAl usage_00063.pdb 57 NGKFYIST 64 usage_00187.pdb 60 NGTFYRST 67 usage_00421.pdb 59 NGTFYVST 66 usage_00422.pdb 59 NGTFYVST 66 usage_00423.pdb 59 NGTFYVST 66 usage_00424.pdb 59 NGTFYVST 66 usage_00425.pdb 59 NGTFYVST 66 usage_00428.pdb 59 NGTFYVST 66 NGtFY ST #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################