################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:52:13 2021 # Report_file: c_0967_17.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00013.pdb # 2: usage_00023.pdb # 3: usage_00079.pdb # 4: usage_00085.pdb # 5: usage_00086.pdb # 6: usage_00197.pdb # 7: usage_00295.pdb # 8: usage_00296.pdb # 9: usage_00297.pdb # 10: usage_00349.pdb # 11: usage_00351.pdb # 12: usage_00373.pdb # # Length: 42 # Identity: 1/ 42 ( 2.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 4/ 42 ( 9.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 42 ( 42.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00013.pdb 1 GPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCL---- 38 usage_00023.pdb 1 -GPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIW----- 36 usage_00079.pdb 1 -PPIILQGPA-NQTLAVDGTALLKCKATGDPLPVISWLKE-- 38 usage_00085.pdb 1 -GPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIW----- 36 usage_00086.pdb 1 -GPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIW----- 36 usage_00197.pdb 1 -EPKIEVQFPETVPAEKGTTVKLECFALGNPVPTILWRRAD- 40 usage_00295.pdb 1 -----LKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRS-- 35 usage_00296.pdb 1 -----LKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRS-- 35 usage_00297.pdb 1 -----LKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRS-- 35 usage_00349.pdb 1 -GPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIW----- 36 usage_00351.pdb 1 -GPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIW----- 36 usage_00373.pdb 1 -GPHFVEYLS-WEVTG-ECNVLLKCKVANIK----------K 29 C a g p #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################