################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:16:09 2021 # Report_file: c_1028_50.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00068.pdb # 2: usage_00069.pdb # 3: usage_00253.pdb # 4: usage_00310.pdb # 5: usage_00499.pdb # 6: usage_00500.pdb # 7: usage_00517.pdb # 8: usage_00518.pdb # 9: usage_00581.pdb # 10: usage_00767.pdb # 11: usage_00808.pdb # 12: usage_00809.pdb # 13: usage_00817.pdb # 14: usage_00818.pdb # # Length: 35 # Identity: 20/ 35 ( 57.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 35 ( 57.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 35 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00068.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00069.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00253.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00310.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00499.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00500.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00517.pdb 1 DGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDA 35 usage_00518.pdb 1 DGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDA 35 usage_00581.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00767.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00808.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00809.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00817.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 usage_00818.pdb 1 CCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 35 FA V P HK VE LQ AMTGDGVNDA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################