################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:27:46 2021 # Report_file: c_0382_26.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00022.pdb # 2: usage_00023.pdb # 3: usage_00186.pdb # 4: usage_00187.pdb # 5: usage_00248.pdb # 6: usage_00460.pdb # # Length: 95 # Identity: 4/ 95 ( 4.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 95 ( 28.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 36/ 95 ( 37.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 -QIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSVP----K-LEEVLLEEMT----VFRE-- 48 usage_00023.pdb 1 -QIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSV-----------LLEEMT----VFRE-- 42 usage_00186.pdb 1 -QIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSV-----------LLEEMT----VFRE-- 42 usage_00187.pdb 1 -QIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSVPKETWHDLEEVLLEEMT----VFRE-- 53 usage_00248.pdb 1 LCSLKDSE-------GNLWFGTYLGNISYYNTR-------LK---KFQIIELEK--NE-- 39 usage_00460.pdb 1 -KIAVDNAAGPYQNHTVVFLGSEKGIILKFLAR--------GSLFLEEMN----VYNPEK 47 i vD v f Gt G lk leem e usage_00022.pdb 49 ------P-TTISAMELSTKQQQLYIGSTAGVAQLP 76 usage_00023.pdb 43 ------P-TTISAMELSTKQQQLYIGSTAGVAQLP 70 usage_00186.pdb 43 ------P-TTISAMELSTKQQQLYIGSTAGVAQLP 70 usage_00187.pdb 54 ------P-TTISAMELSTKQQQLYIGSTAGVAQLP 81 usage_00248.pdb 40 ------L-LDVRVFYED-KNKKIWIGTHAGVFVID 66 usage_00460.pdb 48 CSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVP 82 i m l k lyig agV p #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################