################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:37 2021 # Report_file: c_1330_40.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00777.pdb # 2: usage_00779.pdb # 3: usage_00780.pdb # 4: usage_00781.pdb # 5: usage_00809.pdb # 6: usage_00810.pdb # 7: usage_00826.pdb # 8: usage_00827.pdb # 9: usage_00844.pdb # # Length: 56 # Identity: 40/ 56 ( 71.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 56 ( 71.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 56 ( 7.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00777.pdb 1 -SDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVVKN- 54 usage_00779.pdb 1 --DDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVIR-- 52 usage_00780.pdb 1 -GDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVIR-- 53 usage_00781.pdb 1 --DDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVIRNV 54 usage_00809.pdb 1 -SDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVVKN- 54 usage_00810.pdb 1 GSDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVVKN- 55 usage_00826.pdb 1 -SDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVVKN- 54 usage_00827.pdb 1 -SDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVVKN- 54 usage_00844.pdb 1 GGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVIRN- 55 DDWIYDLGIKYSFT ELRD G YGFLLPE YI PTC EA AV KIA HV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################