################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:42:12 2021
# Report_file: c_0779_39.html
################################################################################################
#====================================
# Aligned_structures: 7
#   1: usage_00151.pdb
#   2: usage_00180.pdb
#   3: usage_00194.pdb
#   4: usage_00251.pdb
#   5: usage_00254.pdb
#   6: usage_00255.pdb
#   7: usage_00256.pdb
#
# Length:         93
# Identity:        4/ 93 (  4.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     12/ 93 ( 12.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           50/ 93 ( 53.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00151.pdb         1  NCLIMTTEILRSM-LYR------GADLIR--DVEFVIFDE--VH-YV--NDQDRGVVWEE   46
usage_00180.pdb         1  DIILTTYAVLLRDT------------RLKEVEWKYIVIDEAQNIK--NPQT-K---IFKA   42
usage_00194.pdb         1  DIIISTAQILENS-LLN-----GV--QLS--DFSLIIIDE--C-------------VYNN   35
usage_00251.pdb         1  DVVICTAQILQNA-LLSGEEEARV--ELT--DFSLLVIDE--CH---HTQKEA---VYNK   47
usage_00254.pdb         1  DVVICTAQILQNA-LLSGEEEARV--ELT--DFSLLVIDE--CH---HTQKEA---VYNK   47
usage_00255.pdb         1  DVIICTAQILENS-LLN----ESV--RLS--DFSLIIIDQ--CH---HTQKEG---VYNN   43
usage_00256.pdb         1  DVIICTAQILENS-LLN----ESV--RLS--DFSLIIIDQ--CH---HTQKEG---VYNN   43
                           d  i T  iL                 l   d     iD                 v   

usage_00151.pdb        47  VIIMLPQ------------------HVKFILLS   61
usage_00180.pdb        43  VKELK--------------------SKYRIALT   55
usage_00194.pdb        36  IMRHYL-MQKLKNNRLKKENKPVIPLPQILGLT   67
usage_00251.pdb        48  IMLSYL-QKKLSG---------QRDLPQILGLT   70
usage_00254.pdb        48  IMLSYL-QKKLSG---------QRDLPQILGLT   70
usage_00255.pdb        44  IMRRYL-KEKIKN---------RP-QPQILGLT   65
usage_00256.pdb        44  IMRRYL-KEKIKN---------RP-QPQILGLT   65
                                                          Lt


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################