################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:28:26 2021
# Report_file: c_1434_250.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00094.pdb
#   2: usage_00095.pdb
#   3: usage_00096.pdb
#   4: usage_00097.pdb
#   5: usage_00098.pdb
#   6: usage_00099.pdb
#   7: usage_00100.pdb
#   8: usage_00387.pdb
#   9: usage_00388.pdb
#  10: usage_03143.pdb
#
# Length:         78
# Identity:       55/ 78 ( 70.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     55/ 78 ( 70.5%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           23/ 78 ( 29.5%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00094.pdb         1  ---------------------NVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   39
usage_00095.pdb         1  ---------------------NVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   39
usage_00096.pdb         1  TESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   60
usage_00097.pdb         1  TESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   60
usage_00098.pdb         1  -------------------KSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   41
usage_00099.pdb         1  -------------------KSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   41
usage_00100.pdb         1  -------------------KSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   41
usage_00387.pdb         1  -------------------KSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   41
usage_00388.pdb         1  -------------------KSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   41
usage_03143.pdb         1  --------------------SNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD   40
                                                NVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMAD

usage_00094.pdb        40  AKVALEKIYKEIDEIINR   57
usage_00095.pdb        40  AKVALEKIYKEIDEIINR   57
usage_00096.pdb        61  AKVALEKIYKEIDEIINR   78
usage_00097.pdb        61  AKVALEKIYKEIDEIINR   78
usage_00098.pdb        42  AKVALEKIYKEIDEII--   57
usage_00099.pdb        42  AKVALEKIYKEIDEII--   57
usage_00100.pdb        42  AKVALEKIYKEIDEII--   57
usage_00387.pdb        42  AKVALEKIYKEIDEIINR   59
usage_00388.pdb        42  AKVALEKIYKEIDEIINR   59
usage_03143.pdb        41  AKVALEKIYKEIDEIINR   58
                           AKVALEKIYKEIDEII  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################