################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:00:11 2021
# Report_file: c_1484_331.html
################################################################################################
#====================================
# Aligned_structures: 4
#   1: usage_01986.pdb
#   2: usage_02720.pdb
#   3: usage_03894.pdb
#   4: usage_03910.pdb
#
# Length:         82
# Identity:        8/ 82 (  9.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     25/ 82 ( 30.5%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           27/ 82 ( 32.9%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_01986.pdb         1  -----------------HYIPTLDQLIALLKSKLPEWD-VPMLARTHGQPASPTNLAKEF   42
usage_02720.pdb         1  -------------------LPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEF   41
usage_03894.pdb         1  CYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRC   60
usage_03910.pdb         1  --------------------PKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRC   40
                                               P L   i  L    kE a  p lg TH QpA  tt gk  

usage_01986.pdb        43  MVWIERLEEQRTMLLS------   58
usage_02720.pdb        42  SGYVQQVKYAMTRIKAAMPRIY   63
usage_03894.pdb        61  CLWIQDLCMDLQNLKRVRDDL-   81
usage_03910.pdb        41  CLWIQDLCMDLQNLKRVRDDL-   61
                             wiq l      lk       


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################