################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:23 2021 # Report_file: c_0513_109.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00197.pdb # 2: usage_00300.pdb # 3: usage_00613.pdb # 4: usage_00708.pdb # 5: usage_00887.pdb # # Length: 126 # Identity: 14/126 ( 11.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/126 ( 25.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 41/126 ( 32.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00197.pdb 1 SPDFLKKSVDESLKRLNTDYIDLFYIHFPD-------------------------EHTPK 35 usage_00300.pdb 1 TPDYVRSCCEASLKRLDVDYIDLFYIHRID-------------------------TTVPI 35 usage_00613.pdb 1 ---NVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPI 57 usage_00708.pdb 1 -PARIRKEVEDSLRRLRVETIDLEQIHWPD-------------------------DKTPI 34 usage_00887.pdb 1 -PDFLKKSVDESLKRLNTDYIDLFYIHFPD-------------------------EHTPK 34 sL rL dyiDLf IH pd P usage_00197.pdb 36 DEAVNALNE-KKAGKIRSIGVSNFSLEQLKEANKDG--LVDVLQGEYNLLNREAEKTF-- 90 usage_00300.pdb 36 EITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVH--PVTALQIEYSLWTRDIEDEIVP 93 usage_00613.pdb 58 LETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQ-QP-KLIE 115 usage_00708.pdb 35 DESARELQKLHQDGKIRALGVSNFSPEQMDIFREVA--PLATIQPPLNLFERTIEKDILP 92 usage_00887.pdb 35 DEAVNALNE-KKAGKIRSIGVSNFSLEQLKEANKDG--LVDVLQGEYNLLNREAEKTF-- 89 e L GKI GvSnfs lQ e l r e usage_00197.pdb ------ usage_00300.pdb 94 LCRQLG 99 usage_00613.pdb 116 FAQKAG 121 usage_00708.pdb 93 YAEKH- 97 usage_00887.pdb ------ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################