################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:52 2021 # Report_file: c_0587_19.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00082.pdb # 2: usage_00126.pdb # 3: usage_00250.pdb # 4: usage_00334.pdb # 5: usage_00344.pdb # 6: usage_00345.pdb # # Length: 78 # Identity: 5/ 78 ( 6.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 78 ( 26.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 78 ( 12.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00082.pdb 1 PVDILYADSRDDADQARTIARAFVDDPRVVGVLGDFSSTVS-AAGSIYGKEG-PQLSPTA 58 usage_00126.pdb 1 QIKIVLGDDVSDPKQGISVANKFVADG-VKFVVGHFNSGVSIPASEVYAENGILEITPAA 59 usage_00250.pdb 1 --VGVEYDDACDPKQAVAVANKIVNDG-IKYVIGHLCSSSTQPASDIYEDEGILMISPGA 57 usage_00334.pdb 1 ----EIRDSCWHSSVALEQSIEFIRKP-IAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSA 55 usage_00344.pdb 1 QIKIVLGDDVSDPKQGISVANKFVADG-VKFVVGHFNSGVSIPASEVYAENGILEITPAA 59 usage_00345.pdb 1 QIKIVLGDDVSDPKQGISVANKFVADG-VKFVVGHFNSGVSIPASEVYAENGILEITPAA 59 D d q a fv d V G S v a y g i p A usage_00082.pdb 59 AHPDYIKI-SPWQFR-AI 74 usage_00126.pdb 60 TNPVFTERGLWNTFR-TC 76 usage_00250.pdb 58 TNPELTQRGYQHIMR-TA 74 usage_00334.pdb 56 TSIDLSDKTLYKYFLRV- 72 usage_00344.pdb 60 TNPVFTERGLWNTFR-TC 76 usage_00345.pdb 60 TNPVFTERGLWNTFR-TC 76 t p fr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################