################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:03 2021 # Report_file: c_0787_105.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00372.pdb # 2: usage_00373.pdb # 3: usage_00421.pdb # 4: usage_00424.pdb # 5: usage_00425.pdb # 6: usage_00426.pdb # 7: usage_00642.pdb # 8: usage_00643.pdb # 9: usage_00827.pdb # 10: usage_00920.pdb # 11: usage_01083.pdb # # Length: 64 # Identity: 5/ 64 ( 7.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 64 ( 60.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 64 ( 26.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00372.pdb 1 PVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFS-Q-DKDVVQEATKVLRNAAGNFYIN- 57 usage_00373.pdb 1 PVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFS-Q-DKDVVQEATKVLRNAAGNFYIN- 57 usage_00421.pdb 1 PVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFA-Q-DKAIVQEATRMLRNAAGNFYIN- 57 usage_00424.pdb 1 PVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFA-Q-DKAIVQEATRMLRNAAGNFYIN- 57 usage_00425.pdb 1 PVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFA-Q-DKAIVQEATRMLRNAAGNFYIN- 57 usage_00426.pdb 1 PVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFA-Q-DKAIVQEATRMLRNAAGNFYIN- 57 usage_00642.pdb 1 PVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFS-Q-DKDVVQEATKVLRNAAGNFYIN- 57 usage_00643.pdb 1 PVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFS-Q-DKDVVQEATKVLRNAAGNFYIN- 57 usage_00827.pdb 1 ---QIVYPND--RDDLLKLIENNA-RLCGVIFDWDKYNLELCEEISKMNE----NLPLYA 50 usage_00920.pdb 1 PVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFA-Q-DKAIVQEATRMLRNAAGNFYIN- 57 usage_01083.pdb 1 PVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFA-Q-DKAIVQEATRMLRNAAGNFYIN- 57 vyvypD y etL Lvdstt ygltgavf q dk vqEat lr Nfyin usage_00372.pdb ---- usage_00373.pdb ---- usage_00421.pdb ---- usage_00424.pdb ---- usage_00425.pdb ---- usage_00426.pdb ---- usage_00642.pdb ---- usage_00643.pdb ---- usage_00827.pdb 51 FANT 54 usage_00920.pdb ---- usage_01083.pdb ---- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################