################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:50 2021 # Report_file: c_0841_23.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00042.pdb # 2: usage_00043.pdb # 3: usage_00261.pdb # 4: usage_00262.pdb # 5: usage_00263.pdb # 6: usage_00264.pdb # # Length: 72 # Identity: 28/ 72 ( 38.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 72 ( 38.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 72 ( 9.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 RRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINEAF 60 usage_00043.pdb 1 -RSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINEAF 59 usage_00261.pdb 1 SEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKLLKKNGLTVQDIDLFEVNEAF 60 usage_00262.pdb 1 SEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKLLKKNGLTVQDIDLFEVNEAF 60 usage_00263.pdb 1 SEEKAAELGKRPLATILGFSTTGMPAHE----PGFAINKLLKKNGLTVQDIDLFEVNEAF 56 usage_00264.pdb 1 SEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKLLKKNGLTVQDIDLFEVNEAF 60 A L L F T G P P AI K L GL VQDID FE NEAF usage_00042.pdb 61 AAQALYCIHKLG 72 usage_00043.pdb 60 AAQALYCIHKLG 71 usage_00261.pdb 61 ASVVLTCEKI-- 70 usage_00262.pdb 61 ASVVLTCEKIVG 72 usage_00263.pdb 57 ASVVLTCEKIVG 68 usage_00264.pdb 61 ASVVLTCEKIVG 72 A L C #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################