################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:00:18 2021 # Report_file: c_1434_420.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: usage_02677.pdb # 2: usage_02891.pdb # 3: usage_02892.pdb # # Length: 145 # Identity: 8/145 ( 5.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 85/145 ( 58.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 60/145 ( 41.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02677.pdb 1 AQQANELIKRVASELEKNRKKLIKQEQELADTET-AELVR-QKGELLSQNAQRYFKK-YQ 57 usage_02891.pdb 1 -EKAA---RAAKELSRESARAAKELADSNAKAAEDLMREI-----------------AER 39 usage_02892.pdb 1 MEKAA---RAAKELSRESARAAKELADSNAKAAEDLMREIS---------------S-ER 41 ekAa raakelsresaraakeladsnAkaae lmrei er usage_02677.pdb 58 KLKEAVKHLTNLIEETKSTIVYLESVDTMLGQA----S---------LAEIDEIREELIE 104 usage_02891.pdb 40 LLELMAEAIRELQKQAAESIADSQRLVVEAIIRLAEAV-----EKEIDEIVEEAKKRLEE 94 usage_02892.pdb 42 LLELMAEAIRELQKQAAESIADSQRLVVEAIIRLAEAVKQGASEKEIDEIVEEAKKRLEE 101 lLelmaeaireLqkqaaesIadsqrlvveaiir v deiveEakkrLeE usage_02677.pdb 105 TG----------------------- 106 usage_02891.pdb 95 L-AERSRQENKKIIDRAKYEMDEES 118 usage_02892.pdb 102 L-AERSRQENKKIIDRAKY------ 119 l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################