################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:14:40 2021 # Report_file: c_0243_28.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00059.pdb # 2: usage_00078.pdb # 3: usage_00252.pdb # 4: usage_00253.pdb # 5: usage_00254.pdb # # Length: 124 # Identity: 17/124 ( 13.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 52/124 ( 41.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/124 ( 13.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00059.pdb 1 GTIIIVDDNKGVLTAVQLLLKNHFSKVITLSSPVSLSTVLREENPEVVLLDMNFTS--NE 58 usage_00078.pdb 1 -KILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLHAPDVIITDIR---PKLG 56 usage_00252.pdb 1 -DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGSRLD 59 usage_00253.pdb 1 -DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGSRLD 59 usage_00254.pdb 1 -DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGSRLD 59 Il VdD d r v ils e ta d s aP v lDi l usage_00059.pdb 59 GLFWLHEIKRQYRDLPVVLFTAYAD-IDLAVRGIKEGASDFVVKPWDNQKLLETLLNAAS 117 usage_00078.pdb 57 GL-ELDRIKAGGAKPYVIVIS----SEKYFIKAIELGVHLFLPKPIEPGRL-ETLEDFRH 110 usage_00252.pdb 60 GLALLDEIKKQHPELPVVMISGHGN-IETAVSAIRRGAYDFIEKPFKADRLILVAERALE 118 usage_00253.pdb 60 GLALLDEIKKQHPELPVVMISGHGN-IETAVSAIRRGAYDFIEKPFKADRLILVAERALE 118 usage_00254.pdb 60 GLALLDEIKKQHPELPVVMISGHGN-IETAVSAIRRGAYDFIEKPFKADRLILVAERALE 118 GL LdeIK q lpVv is i av aI Ga dF KP rL e a usage_00059.pdb ---- usage_00078.pdb 111 IKLA 114 usage_00252.pdb 119 T--- 119 usage_00253.pdb 119 TS-- 120 usage_00254.pdb 119 TS-- 120 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################