################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:58 2021 # Report_file: c_1477_48.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00223.pdb # 2: usage_00228.pdb # 3: usage_00298.pdb # 4: usage_00299.pdb # 5: usage_00300.pdb # 6: usage_00441.pdb # 7: usage_00835.pdb # 8: usage_00836.pdb # 9: usage_01343.pdb # 10: usage_01344.pdb # # Length: 31 # Identity: 24/ 31 ( 77.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 31 ( 77.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 31 ( 16.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00223.pdb 1 HHHHHEMEKEFEQIDKSGSWAAIYQDIRHEA 31 usage_00228.pdb 1 HHHHHEMEKEFEQIDKSGSWAAIYQDIRHEA 31 usage_00298.pdb 1 KLEFMEMEKEFEQIDKSGSWAAIYQDIRHE- 30 usage_00299.pdb 1 -LEFMEMEKEFEQIDKSGSWAAIYQDIRHEA 30 usage_00300.pdb 1 -LEFMEMEKEFEQIDKSGSWAAIYQDIRHEA 30 usage_00441.pdb 1 --EFMEMEKEFEQIDKSGSWAAIYQDIRH-- 27 usage_00835.pdb 1 KLEFMEMEKEFEQIDKSGSWAAIYQDIRHEA 31 usage_00836.pdb 1 --EFMEMEKEFEQIDKSGSWAAIYQDIRHEA 29 usage_01343.pdb 1 --EFMEMEKEFEQIDKSGSWAAIYQDIRHEA 29 usage_01344.pdb 1 ---FMEMEKEFEQIDKSGSWAAIYQDIRHE- 27 EMEKEFEQIDKSGSWAAIYQDIRH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################