################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:27 2021 # Report_file: c_1387_64.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00002.pdb # 2: usage_00357.pdb # 3: usage_00358.pdb # 4: usage_02014.pdb # 5: usage_02054.pdb # 6: usage_02055.pdb # 7: usage_02056.pdb # # Length: 59 # Identity: 11/ 59 ( 18.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 59 ( 78.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 59 ( 6.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00002.pdb 1 -FSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEY---MSFEEGSAYNEKLIPISRG 55 usage_00357.pdb 1 -FSEVTCLYFPLALDDRIHFACRLLTVLFLIDDVLEH---MSFADGEAYNNRLIPISRG 55 usage_00358.pdb 1 -FSEVTCLYFPLALDDRIHFACRLLTVLFLIDDVLEH---MSFADGEAYNNRLIPISRG 55 usage_02014.pdb 1 -ITELASLVYPESSAEDLALAADLMGFYFLFDDQFDSPLGRRPEQVALICERLSAIAHG 58 usage_02054.pdb 1 GFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEY---MSFEEGSAYNEKLIPISRG 56 usage_02055.pdb 1 GFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEY---MSFEEGSAYNEKLIPISRG 56 usage_02056.pdb 1 GFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEY---MSFEEGSAYNEKLIPISRG 56 fs vtcLyfP alddrihfAcrLltvlFLiDD le msf g ayn LipIsrG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################