################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:49 2021 # Report_file: c_1373_26.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00020.pdb # 2: usage_00731.pdb # 3: usage_00873.pdb # 4: usage_01115.pdb # 5: usage_01123.pdb # 6: usage_01539.pdb # # Length: 68 # Identity: 10/ 68 ( 14.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 68 ( 36.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 68 ( 23.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00020.pdb 1 -YCGVLYFTGSDIFNKNMKAHALE-KGFTINEYTIRP--------------GEPLPVDSE 44 usage_00731.pdb 1 FPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPE-----------QKTFFQAASE 49 usage_00873.pdb 1 YYCGVLYFTGSDIFNKNMRAHALE-KGFTINEYTIRPA-------------GEPLPVDSE 46 usage_01115.pdb 1 FACALLYFTGSAHFNRSMRALAKT-KGMSLSEHALSTAVVRNTHGC-KVGPGRVLPTPTE 58 usage_01123.pdb 1 -YCGVLYFTGSDIFNKNMRAHALE-KGFTINEYTIRPLGV------TGVA-GEPLPVDSE 51 usage_01539.pdb 1 YYCGVLYFTGSDIFNKNMKAHALE-KGFTINEYTIRPLA------------GEPLPVDSE 47 c LyfTGS Fn m a a KG ne g lp sE usage_00020.pdb 45 KDIFDYIQ 52 usage_00731.pdb 50 EDIFRHLG 57 usage_00873.pdb 47 KDIFDYIQ 54 usage_01115.pdb 59 KDVFRLLG 66 usage_01123.pdb 52 KDIFDYIQ 59 usage_01539.pdb 48 KDIFDYIQ 55 kDiF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################