################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:38 2021 # Report_file: c_0786_28.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00201.pdb # 2: usage_00482.pdb # 3: usage_00914.pdb # 4: usage_00915.pdb # 5: usage_01098.pdb # 6: usage_01099.pdb # # Length: 65 # Identity: 27/ 65 ( 41.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 65 ( 41.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 65 ( 10.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00201.pdb 1 ----LVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVH 56 usage_00482.pdb 1 ---MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVH 57 usage_00914.pdb 1 ---MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVH 57 usage_00915.pdb 1 ---MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVH 57 usage_01098.pdb 1 -FGDLVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVY 59 usage_01099.pdb 1 DFGDLVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVY 60 LVL GDL IP LP F LL KI LCTGN C E LK V usage_00201.pdb 57 IV--- 58 usage_00482.pdb 58 IVRGD 62 usage_00914.pdb 58 IVR-- 60 usage_00915.pdb 58 IVR-- 60 usage_01098.pdb 60 IV--- 61 usage_01099.pdb 61 IVSGD 65 IV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################