################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:17 2021 # Report_file: c_1413_172.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00324.pdb # 2: usage_00515.pdb # 3: usage_00521.pdb # 4: usage_00522.pdb # 5: usage_00523.pdb # 6: usage_00524.pdb # 7: usage_00956.pdb # 8: usage_01008.pdb # 9: usage_01367.pdb # 10: usage_01368.pdb # 11: usage_01460.pdb # # Length: 46 # Identity: 6/ 46 ( 13.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 46 ( 17.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 46 ( 26.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00324.pdb 1 SPRYLLIQKKDEAAAKSALRR-L-----AEIEEILEEDRAEKAVG- 39 usage_00515.pdb 1 -PRWLL-ENRNEEAARQVMKITYDDSEIDKELKEMKEINAISES-- 42 usage_00521.pdb 1 SPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQE- 45 usage_00522.pdb 1 SPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQE- 45 usage_00523.pdb 1 SPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQE- 45 usage_00524.pdb 1 SPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQE- 45 usage_00956.pdb 1 SPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREK 46 usage_01008.pdb 1 SPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMR-- 44 usage_01367.pdb 1 SPRYLLIQKKNESAAEKALQTLRGWKDVDMEMEEIRKEDEAEKAAG 46 usage_01368.pdb 1 SPRYLLIQKKNESAAEKALQTLRGWKDVDMEMEEIRKEDEAE---- 42 usage_01460.pdb 1 SPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREK 46 PR LL E A l e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################