################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:22 2021 # Report_file: c_0786_115.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00060.pdb # 2: usage_00061.pdb # 3: usage_00206.pdb # 4: usage_00207.pdb # 5: usage_00243.pdb # 6: usage_00244.pdb # 7: usage_00308.pdb # 8: usage_00309.pdb # 9: usage_00549.pdb # 10: usage_00550.pdb # 11: usage_00628.pdb # 12: usage_00629.pdb # # Length: 62 # Identity: 11/ 62 ( 17.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 62 ( 17.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 62 ( 21.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00060.pdb 1 NFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMV 60 usage_00061.pdb 1 NFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMV 60 usage_00206.pdb 1 NAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMA 60 usage_00207.pdb 1 NAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMA 60 usage_00243.pdb 1 ENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLV 60 usage_00244.pdb 1 ENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLV 60 usage_00308.pdb 1 NFVAYGVDPETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMV 60 usage_00309.pdb 1 NFVAYGVDPETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMV 60 usage_00549.pdb 1 ESKLYKCN-SEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFA 59 usage_00550.pdb 1 ESKLYKCN-SEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFA 59 usage_00628.pdb 1 NAVQ-Y------ILDYAEIERLAVEHKPTMIIAG-----GIVDWAKFREIADKVGAYLFV 48 usage_00629.pdb 1 NAVQYG------ILDYAEIERLAVEHKPTMIIAGF----GIVDWAKFREIADKVGAYLFV 50 D A P D FR I D V A usage_00060.pdb 61 DM 62 usage_00061.pdb 61 DM 62 usage_00206.pdb 61 DI 62 usage_00207.pdb 61 DI 62 usage_00243.pdb 61 DM 62 usage_00244.pdb 61 DM 62 usage_00308.pdb 61 D- 61 usage_00309.pdb 61 DM 62 usage_00549.pdb 60 DI 61 usage_00550.pdb 60 DI 61 usage_00628.pdb 49 DM 50 usage_00629.pdb 51 DM 52 D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################