################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:18:44 2021
# Report_file: c_1348_8.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00061.pdb
#   2: usage_00062.pdb
#   3: usage_00063.pdb
#   4: usage_00064.pdb
#   5: usage_00091.pdb
#   6: usage_00092.pdb
#   7: usage_00093.pdb
#   8: usage_00094.pdb
#   9: usage_00095.pdb
#  10: usage_00096.pdb
#
# Length:         40
# Identity:       14/ 40 ( 35.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     34/ 40 ( 85.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            6/ 40 ( 15.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00061.pdb         1  -----GGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   35
usage_00062.pdb         1  ----LGGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   36
usage_00063.pdb         1  ----LGGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   36
usage_00064.pdb         1  ----LGGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   36
usage_00091.pdb         1  TPEQTHAYLHHIGIDDPGPPSLANLDRLIDAHLRRVAFEN   40
usage_00092.pdb         1  ----LGGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   36
usage_00093.pdb         1  -----GGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   35
usage_00094.pdb         1  -----GGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   35
usage_00095.pdb         1  ------GYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   34
usage_00096.pdb         1  ----LGGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFEN   36
                                 gYLtrIGlDgrprPdLgtLhaivaAHnRsipFEN


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################