################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:42 2021 # Report_file: c_1250_165.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_01370.pdb # 2: usage_01435.pdb # 3: usage_01436.pdb # 4: usage_01437.pdb # 5: usage_01438.pdb # 6: usage_01439.pdb # 7: usage_01440.pdb # 8: usage_01441.pdb # 9: usage_01755.pdb # 10: usage_01756.pdb # # Length: 40 # Identity: 5/ 40 ( 12.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 40 ( 82.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 40 ( 17.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01370.pdb 1 ILNFVIGA-RGIGKSYA-KVYPINRFIKYGEQFIYVR--- 35 usage_01435.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIKY--- 36 usage_01436.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIK---- 35 usage_01437.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIK---- 35 usage_01438.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIK---- 35 usage_01439.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIK---- 35 usage_01440.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIK---- 35 usage_01441.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIKYSKD 39 usage_01755.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIK---- 35 usage_01756.pdb 1 RIELIIG-PMFAGKTTELMRRVKREIHARRSCFVIK---- 35 rieliIG mfaGKtte mrrvkreiharrscFvik #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################