################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:33:10 2021 # Report_file: c_1319_223.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01930.pdb # 2: usage_01931.pdb # 3: usage_01932.pdb # 4: usage_02097.pdb # 5: usage_02098.pdb # 6: usage_02099.pdb # # Length: 87 # Identity: 45/ 87 ( 51.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 87 ( 51.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 87 ( 6.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01930.pdb 1 -NLEAQVQIDRLINGRLTALNAYVSQQLSDITLIKAGASRAIEKVNECVKSQSPRINFCG 59 usage_01931.pdb 1 -NLEAQVQIDRLINGRLTALNAYVSQQLSDITLIKAGASRAIEKVNECVKSQSPRINFCG 59 usage_01932.pdb 1 -NLEAQVQIDRLINGRLTALNAYVSQQLSDITLIKAGASRAIEKVNECVKSQSPRINFCG 59 usage_02097.pdb 1 DSIQADQQVDRLITGRLAALNAFVSQVLNKYTEVRGSRRLAQQKINECVKSQSNRYGFCG 60 usage_02098.pdb 1 DSIQADQQVDRLITGRLAALNAFVSQVLNKYTEVRGSRRLAQQKINECVKSQSNRYGFCG 60 usage_02099.pdb 1 DSIQADQQVDRLITGRLAALNAFVSQVLNKYTEVRGSRRLAQQKINECVKSQSNRYGFCG 60 A Q DRLI GRL ALNA VSQ L T A K NECVKSQS R FCG usage_01930.pdb 60 NGNHILSLVQNAPYGLLFIHFS----- 81 usage_01931.pdb 60 NGNHILSLVQNAPYGLLFIHFS----- 81 usage_01932.pdb 60 NGNHILSLVQNAPYGLLFIHFS----- 81 usage_02097.pdb 61 NGTHIFSIVNSAPDGLLFLHTVLLPTD 87 usage_02098.pdb 61 NGTHIFSIVNSAPDGLLFLHTVLLPTD 87 usage_02099.pdb 61 NGTHIFSIVNSAPDGLLFLHTVLLPTD 87 NG HI S V AP GLLF H #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################