################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:51 2021 # Report_file: c_0940_50.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00535.pdb # 2: usage_00559.pdb # 3: usage_01184.pdb # 4: usage_01188.pdb # 5: usage_01191.pdb # 6: usage_01194.pdb # 7: usage_01199.pdb # 8: usage_01202.pdb # 9: usage_01442.pdb # 10: usage_01444.pdb # # Length: 41 # Identity: 2/ 41 ( 4.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 41 ( 39.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 41 ( 24.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00535.pdb 1 -PGISMDG----NGQIVVTGGNDAKKTSLYDSSSDSWIPGP 36 usage_00559.pdb 1 ----GIVFNEGAPG-ILYVRTD-IGGMYRWDAANGRWIPLL 35 usage_01184.pdb 1 GFVPGIIFNQKEAD-LIYARTA-IGGAYRWNSATSSWIPLL 39 usage_01188.pdb 1 GFVPGIIFNQKEAD-LIYARTA-IGGAYRWNSATSSWIPLL 39 usage_01191.pdb 1 ----GIIFNQKEAD-LIYARTD-IGGAYRWNSATSSWIPLL 35 usage_01194.pdb 1 GFVPGIIFNQKEAD-LIYARTD-IGGAYRWNSATSSWIPLL 39 usage_01199.pdb 1 GFVPGIIFNQKEAD-LIYARTD-IGGAYRWNSATSSWIPLL 39 usage_01202.pdb 1 GFVPGIIFNQKEAD-LIYARTD-IGGAYRWNSATSSWIPLL 39 usage_01442.pdb 1 GFVPGIVFNRSEKN-LAYARTD-IGGAYRWDQSGKQWKPLL 39 usage_01444.pdb 1 GFVPGIVFNRSEKN-LAYARTD-IGGAYRWDQSGKQWKPLL 39 gi f y rt igg yrw W Pll #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################