################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:27 2021 # Report_file: c_0931_2.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00050.pdb # 2: usage_00051.pdb # 3: usage_00480.pdb # 4: usage_00864.pdb # 5: usage_00865.pdb # 6: usage_00866.pdb # 7: usage_00944.pdb # 8: usage_00945.pdb # # Length: 86 # Identity: 84/ 86 ( 97.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 84/ 86 ( 97.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 86 ( 2.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00050.pdb 1 DRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW 60 usage_00051.pdb 1 DRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW 60 usage_00480.pdb 1 DRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW 60 usage_00864.pdb 1 DRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW 60 usage_00865.pdb 1 DRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW 60 usage_00866.pdb 1 -RLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW 59 usage_00944.pdb 1 DRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW 60 usage_00945.pdb 1 DRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW 60 RLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWW usage_00050.pdb 61 LDQDTFYDGRDRDINKRGYLMGIRET 86 usage_00051.pdb 61 LDQDTFYDGRDRDINKRGYLMGIRET 86 usage_00480.pdb 61 LDQDTFYDGRDRDINKRGYLMGIRET 86 usage_00864.pdb 61 LDQDTFYDGRDRDINKRGYLMGIRE- 85 usage_00865.pdb 61 LDQDTFYDGRDRDINKRGYLMGIRE- 85 usage_00866.pdb 60 LDQDTFYDGRDRDINKRGYLMGIRET 85 usage_00944.pdb 61 LDQDTFYDGRDRDINKRGYLMGIRET 86 usage_00945.pdb 61 LDQDTFYDGRDRDINKRGYLMGIRE- 85 LDQDTFYDGRDRDINKRGYLMGIRE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################