################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:23:17 2021 # Report_file: c_0600_1.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00003.pdb # 2: usage_00013.pdb # 3: usage_00014.pdb # 4: usage_00015.pdb # 5: usage_00016.pdb # 6: usage_00041.pdb # # Length: 70 # Identity: 14/ 70 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 70 ( 37.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 70 ( 7.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 TPIQVLHEYGMKT-KNIPVYECERSDVQIHVPTFTFRVTVGDITCTGEGTSKKLAKHRAA 59 usage_00013.pdb 1 -YKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAA 59 usage_00014.pdb 1 -YKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAA 59 usage_00015.pdb 1 --KTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAA 58 usage_00016.pdb 1 --KTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAA 58 usage_00041.pdb 1 -PVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAA 59 LqE k k PeY gp H k F GeG SKK A rAA usage_00003.pdb 60 EAAINILKA- 68 usage_00013.pdb 60 EELIKLLEES 69 usage_00014.pdb 60 EELIKLLE-- 67 usage_00015.pdb 59 EELIKLLEES 68 usage_00016.pdb 59 EELIKLLEES 68 usage_00041.pdb 60 AKMLLRVSG- 68 e i l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################