################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:41:18 2021
# Report_file: c_1432_188.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00830.pdb
#   2: usage_00831.pdb
#   3: usage_00832.pdb
#   4: usage_00833.pdb
#   5: usage_00834.pdb
#   6: usage_00835.pdb
#   7: usage_00836.pdb
#   8: usage_00837.pdb
#   9: usage_01546.pdb
#  10: usage_01547.pdb
#  11: usage_01682.pdb
#
# Length:         37
# Identity:        5/ 37 ( 13.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     24/ 37 ( 64.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            6/ 37 ( 16.2%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00830.pdb         1  RVSILFSEGVKKG-RITLNQFVD-IVSTRIAKLFG--   33
usage_00831.pdb         1  RVSILFSEGVKKG-RITLNQFVD-IVSTRIAKLFG--   33
usage_00832.pdb         1  RVSILFSEGVKKG-RITLNQFVD-IVSTRIAKLFG--   33
usage_00833.pdb         1  RVSILFSEGVKKG-RITLNQFVD-IVSTRIAKLFG--   33
usage_00834.pdb         1  RVSILFSEGVKKG-RITLNQFVD-IVSTRIAKLFG--   33
usage_00835.pdb         1  RVSILFSEGVKKG-RITLNQFVD-IVSTRIAKLFG--   33
usage_00836.pdb         1  RVSILFSEGVKKG-RITLNQFVD-IVSTRIAKLFG--   33
usage_00837.pdb         1  RVSILFSEGVKKG-RITLNQFVD-IVSTRIAKLFG--   33
usage_01546.pdb         1  RMTILFSEGVRKG-KISLNQFVD-ITSTKVAKLF---   32
usage_01547.pdb         1  RMTILFSEGVRKG-KISLNQFVD-ITSTKVAKLF---   32
usage_01682.pdb         1  RLEQVAKEAFKKLGKY-RLQDFLATLEQHFITLIFQG   36
                           R  ilfsEgv Kg  i lnQfvd i st  akLf   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################