################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:36 2021 # Report_file: c_1164_79.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00396.pdb # 2: usage_00397.pdb # 3: usage_00398.pdb # 4: usage_00460.pdb # 5: usage_00506.pdb # 6: usage_00511.pdb # 7: usage_01018.pdb # 8: usage_01819.pdb # # Length: 38 # Identity: 16/ 38 ( 42.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 38 ( 71.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 38 ( 10.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00396.pdb 1 --KDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLT- 35 usage_00397.pdb 1 -EKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLT- 36 usage_00398.pdb 1 GEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTL 38 usage_00460.pdb 1 ---DSVTFDVSKLKEGEHWMFFCTFPGHSALMKGTLTL 35 usage_00506.pdb 1 -EKDSVTFDVSKLKEGEQFMFFCTFPGHSALMWGTLHL 37 usage_00511.pdb 1 GETDSVTFDVSKLAAGEDYAYFCSFPGHFALMKGVLKL 38 usage_01018.pdb 1 GEKDSVTFDVSKLKEGEQYMFFCAAAAHAAAAMKGTLT 38 usage_01819.pdb 1 -EKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTL 37 DSVTFDVSKLkeGE mfFC fpgH Alm g l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################