################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:32 2021 # Report_file: c_1135_54.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00900.pdb # 2: usage_00901.pdb # 3: usage_01094.pdb # 4: usage_01095.pdb # 5: usage_01096.pdb # 6: usage_01097.pdb # 7: usage_01098.pdb # 8: usage_01099.pdb # # Length: 76 # Identity: 75/ 76 ( 98.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 75/ 76 ( 98.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 76 ( 1.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00900.pdb 1 DVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL 60 usage_00901.pdb 1 -VKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL 59 usage_01094.pdb 1 DVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL 60 usage_01095.pdb 1 DVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL 60 usage_01096.pdb 1 DVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL 60 usage_01097.pdb 1 DVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL 60 usage_01098.pdb 1 -VKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL 59 usage_01099.pdb 1 DVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL 60 VKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDL usage_00900.pdb 61 KLNLKFEIEVLCKNLA 76 usage_00901.pdb 60 KLNLKFEIEVLCKNLA 75 usage_01094.pdb 61 KLNLKFEIEVLCKNLA 76 usage_01095.pdb 61 KLNLKFEIEVLCKNLA 76 usage_01096.pdb 61 KLNLKFEIEVLCKNLA 76 usage_01097.pdb 61 KLNLKFEIEVLCKNLA 76 usage_01098.pdb 60 KLNLKFEIEVLCKNLA 75 usage_01099.pdb 61 KLNLKFEIEVLCKNLA 76 KLNLKFEIEVLCKNLA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################