################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:04 2021 # Report_file: c_1387_127.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01402.pdb # 2: usage_01403.pdb # 3: usage_01412.pdb # 4: usage_01742.pdb # 5: usage_01957.pdb # 6: usage_02571.pdb # # Length: 69 # Identity: 47/ 69 ( 68.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 69 ( 68.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 69 ( 11.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01402.pdb 1 ---AKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIA-KKIHPQTIIAGWREATKA 56 usage_01403.pdb 1 ---AKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIA-KKIHPQTIIAGWREATKA 56 usage_01412.pdb 1 ---AKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIA-KKIHPQTIIAGWREATKA 56 usage_01742.pdb 1 NPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIA-KKIHPQTIIAGWREATKA 59 usage_01957.pdb 1 NPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAA 60 usage_02571.pdb 1 NPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAA 60 AKVLV S VQDDEVGDGTTSVTVL AELLREAE LI KIHPQTII G R A A usage_01402.pdb 57 ARQAL---- 61 usage_01403.pdb 57 ARQALL--- 62 usage_01412.pdb 57 ARQALL--- 62 usage_01742.pdb 60 ARQALLNS- 67 usage_01957.pdb 61 ALDALTKA- 68 usage_02571.pdb 61 ALDALTKAA 69 A AL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################