################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:22:23 2021 # Report_file: c_1445_366.html ################################################################################################ #==================================== # Aligned_structures: 23 # 1: usage_00212.pdb # 2: usage_00213.pdb # 3: usage_03887.pdb # 4: usage_04923.pdb # 5: usage_06123.pdb # 6: usage_06124.pdb # 7: usage_06175.pdb # 8: usage_07081.pdb # 9: usage_07083.pdb # 10: usage_07174.pdb # 11: usage_07434.pdb # 12: usage_08524.pdb # 13: usage_08525.pdb # 14: usage_08526.pdb # 15: usage_08527.pdb # 16: usage_08528.pdb # 17: usage_10310.pdb # 18: usage_10637.pdb # 19: usage_11859.pdb # 20: usage_12971.pdb # 21: usage_15112.pdb # 22: usage_15113.pdb # 23: usage_15984.pdb # # Length: 32 # Identity: 16/ 32 ( 50.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 32 ( 56.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 32 ( 21.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00212.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_00213.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_03887.pdb 1 --SVFIFPPKPKDVLTITLTPKVTCVV----- 25 usage_04923.pdb 1 -PSVFLFPPKPKDTLMISRTPEVTCVVV---- 27 usage_06123.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_06124.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_06175.pdb 1 --SVFIFPPKTKDVLTITLTPKVTCVVV---- 26 usage_07081.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_07083.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_07174.pdb 1 --MVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_07434.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_08524.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_08525.pdb 1 GPSVFLFPPKPKDTLMISRTPEVTCVVV---- 28 usage_08526.pdb 1 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH 32 usage_08527.pdb 1 GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH 32 usage_08528.pdb 1 GPSVFLFPPKPKDTLMISRTPEVTCVVV---- 28 usage_10310.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_10637.pdb 1 GPSVFLFPPKPKDTLMISRTPEVTCVVV---- 28 usage_11859.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_12971.pdb 1 --SVFLFPPKPKDTLMISRTPEVTCVVV---- 26 usage_15112.pdb 1 GPSVFLFPPKPKDTLMASRTPEVTCVVV---- 28 usage_15113.pdb 1 GPSVFLFPPKPKDTLMASRTPEVTCVVV---- 28 usage_15984.pdb 1 --SVFIFPPKPKDTLMISRTPEVTCVVV---- 26 sVF FPPKpKD L TP VTCVV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################