################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:18:07 2021 # Report_file: c_1133_41.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00060.pdb # 2: usage_00061.pdb # 3: usage_00062.pdb # 4: usage_00082.pdb # 5: usage_00531.pdb # # Length: 76 # Identity: 7/ 76 ( 9.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 76 ( 63.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/ 76 ( 35.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00060.pdb 1 IQQAIWYKLLVNLGINSITALGRQTV-AIMHNPEIRILCRQLLLDGCRVAQAEGLNFSEQ 59 usage_00061.pdb 1 IQQAIWYKLLVNLGINSITALGRQTV-AIMHNPEIRILCRQLLLDGCRVAQAEG---SEQ 56 usage_00062.pdb 1 IQQAIWYKLLVNLGINSITALGRQTV-AIMHNPEIRILCRQLLLDGCRVAQAEGLNFSEQ 59 usage_00082.pdb 1 IQRDIWFKLWGNMTMNPVSVLTGATCDRILDDPLVSAFCLAVMAEAKAIGARIG------ 54 usage_00531.pdb 1 --------------INSITLLGRQTV-AIMHNPEIRILCRQLLLDGCRVAQAEGLNFSEQ 45 iNsit LgrqTv aImhnPeirilCrqllldgcrvaqaeG usage_00060.pdb 60 -----TVDTIMTIYQ- 69 usage_00061.pdb 57 -----TVDTIMTIYQ- 66 usage_00062.pdb 60 -----TVDTIMTIYQ- 69 usage_00082.pdb 55 CPIEQSGEARSAVTRQ 70 usage_00531.pdb 46 -----TVDTIMTIYQ- 55 tvdtimtiyq #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################