################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:38:19 2021 # Report_file: c_1411_1.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00068.pdb # 2: usage_00069.pdb # 3: usage_00579.pdb # 4: usage_00580.pdb # 5: usage_01065.pdb # 6: usage_01066.pdb # 7: usage_01085.pdb # # Length: 79 # Identity: 72/ 79 ( 91.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 72/ 79 ( 91.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 79 ( 8.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00068.pdb 1 ----TNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRM 56 usage_00069.pdb 1 ---ATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRM 57 usage_00579.pdb 1 ----TNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRM 56 usage_00580.pdb 1 ----TNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRM 56 usage_01065.pdb 1 GPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRM 60 usage_01066.pdb 1 --GATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRM 58 usage_01085.pdb 1 ----TNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRM 56 TNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRM usage_00068.pdb 57 SLEERKAIGVKMMKVLLFM 75 usage_00069.pdb 58 SLEERKAIGVKMMKVLLFM 76 usage_00579.pdb 57 SLEERKAIGVKMMKVLLF- 74 usage_00580.pdb 57 SLEERKAIGVKMMKVLLFM 75 usage_01065.pdb 61 SLEERKAIGVKMMKVL--- 76 usage_01066.pdb 59 SLEERKAIGVKMMKVL--- 74 usage_01085.pdb 57 SLEERKAIGVKMMKVLLFM 75 SLEERKAIGVKMMKVL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################