################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:59 2021 # Report_file: c_1018_11.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00001.pdb # 2: usage_00002.pdb # 3: usage_00096.pdb # 4: usage_00187.pdb # 5: usage_00196.pdb # 6: usage_00383.pdb # 7: usage_00384.pdb # # Length: 78 # Identity: 58/ 78 ( 74.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/ 78 ( 74.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 78 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 -YVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGS-M----YVPEDL 54 usage_00002.pdb 1 -YVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGS-M----YVPEDL 54 usage_00096.pdb 1 -YVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGD-----QRNGEGAMYVPDDL 54 usage_00187.pdb 1 -YVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDK--GEGS-M----YVPEDL 52 usage_00196.pdb 1 DYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGA-M----YVPDDL 55 usage_00383.pdb 1 -YVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGD-----QRNGEGAMYVPDDL 54 usage_00384.pdb 1 -YVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGA-M----YVPDDL 54 YVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPV GD YVP DL usage_00001.pdb 55 LPVYKEKVVPLADIIT-- 70 usage_00002.pdb 55 LPVYKEKVVPLADIITPN 72 usage_00096.pdb 55 LPVYREKVVPVADIIT-- 70 usage_00187.pdb 53 LPVYKEKVVPLADIIT-- 68 usage_00196.pdb 56 LPVYREKVVPVADIIT-- 71 usage_00383.pdb 55 LPVYREKVVPVADIIT-- 70 usage_00384.pdb 55 LPVYREKVVPVADIIT-- 70 LPVY EKVVP ADIIT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################