################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:14:35 2021 # Report_file: c_0702_21.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00049.pdb # 2: usage_00079.pdb # 3: usage_00133.pdb # 4: usage_00134.pdb # 5: usage_00135.pdb # 6: usage_00136.pdb # 7: usage_00165.pdb # 8: usage_00199.pdb # 9: usage_00207.pdb # 10: usage_00208.pdb # 11: usage_00217.pdb # 12: usage_00231.pdb # 13: usage_00271.pdb # 14: usage_00285.pdb # # Length: 45 # Identity: 6/ 45 ( 13.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 45 ( 82.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 45 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00049.pdb 1 -NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 44 usage_00079.pdb 1 ANECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 45 usage_00133.pdb 1 -FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 44 usage_00134.pdb 1 --QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVN-- 41 usage_00135.pdb 1 --QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 43 usage_00136.pdb 1 -FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 44 usage_00165.pdb 1 ---CISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 42 usage_00199.pdb 1 --QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 43 usage_00207.pdb 1 --QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVN-- 41 usage_00208.pdb 1 --QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 43 usage_00217.pdb 1 --QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 43 usage_00231.pdb 1 --GSQSTSNHLWLLSDILGQGATANVFRGRHKKTG-DLFAIKV-F 41 usage_00271.pdb 1 --QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 43 usage_00285.pdb 1 --QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLE 43 SvkgriysilkqiGsGgsskVFqvlneKkq yaikyvn #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################