################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:32:04 2021 # Report_file: c_1432_45.html ################################################################################################ #==================================== # Aligned_structures: 20 # 1: usage_00181.pdb # 2: usage_00216.pdb # 3: usage_00217.pdb # 4: usage_00218.pdb # 5: usage_00219.pdb # 6: usage_00220.pdb # 7: usage_00390.pdb # 8: usage_00391.pdb # 9: usage_00392.pdb # 10: usage_00393.pdb # 11: usage_00398.pdb # 12: usage_00399.pdb # 13: usage_01542.pdb # 14: usage_01543.pdb # 15: usage_01544.pdb # 16: usage_01545.pdb # 17: usage_01554.pdb # 18: usage_01555.pdb # 19: usage_01556.pdb # 20: usage_01557.pdb # # Length: 33 # Identity: 32/ 33 ( 97.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 33 ( 97.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 33 ( 3.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00181.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00216.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00217.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00218.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00219.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00220.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFV- 32 usage_00390.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00391.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00392.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00393.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00398.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_00399.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_01542.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_01543.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_01544.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_01545.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_01554.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_01555.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_01556.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 usage_01557.pdb 1 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFVG 33 YDDILQAGWEVTEEEIKRDVADLFSRNFWRFV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################