################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:37 2021 # Report_file: c_1172_242.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00619.pdb # 2: usage_00697.pdb # 3: usage_01610.pdb # 4: usage_02033.pdb # 5: usage_02425.pdb # 6: usage_03103.pdb # 7: usage_03699.pdb # 8: usage_04908.pdb # # Length: 42 # Identity: 8/ 42 ( 19.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 42 ( 21.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 42 ( 40.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00619.pdb 1 RRVYPEVTVYPA----------LLVCSVNGFYPGSIEVRW-- 30 usage_00697.pdb 1 ---EPKVTVYPSKT-QPLQHHNLLVCSVSGFYPGSIEVRW-- 36 usage_01610.pdb 1 RRVEPKVTVYPSKT-QPLQHHNLLVCSVSGFYPGSIEVRW-- 39 usage_02033.pdb 1 -----KVTVYPSKT-QPLQHHNLLVCSVSGFYPGSIEVRW-- 34 usage_02425.pdb 1 RRVEPKVTVYPSKT-QPLQHHNLLVCSVSGFYPGSIEVRW-- 39 usage_03103.pdb 1 -----EVTVLTNSP-VELREPNVLICFIDKFTPPVVNVTW-- 34 usage_03699.pdb 1 TNVPPEVTVLTNSP-VELREPNVLICFIDKFTPPVVNVTW-- 39 usage_04908.pdb 1 RRVEPTVTISPSRTEALN-HHNLLVCSVTDFYPAQIKVRWFR 41 VTv L C F P V W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################