################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:32 2021 # Report_file: c_1155_1.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00026.pdb # 2: usage_00231.pdb # 3: usage_00502.pdb # 4: usage_00503.pdb # 5: usage_00536.pdb # 6: usage_00612.pdb # 7: usage_00725.pdb # 8: usage_00734.pdb # 9: usage_00858.pdb # 10: usage_00891.pdb # # Length: 61 # Identity: 59/ 61 ( 96.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 59/ 61 ( 96.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 61 ( 3.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00026.pdb 1 AAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 60 usage_00231.pdb 1 AAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 60 usage_00502.pdb 1 --IEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 58 usage_00503.pdb 1 --IEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 58 usage_00536.pdb 1 --IEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 58 usage_00612.pdb 1 AAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 60 usage_00725.pdb 1 --IEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 58 usage_00734.pdb 1 --IEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 58 usage_00858.pdb 1 AAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 60 usage_00891.pdb 1 AAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE 60 IEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVE usage_00026.pdb 61 S 61 usage_00231.pdb 61 S 61 usage_00502.pdb 59 S 59 usage_00503.pdb 59 S 59 usage_00536.pdb 59 S 59 usage_00612.pdb 61 S 61 usage_00725.pdb 59 S 59 usage_00734.pdb 59 S 59 usage_00858.pdb 61 S 61 usage_00891.pdb 61 S 61 S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################