################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:19 2021 # Report_file: c_1363_127.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00449.pdb # 2: usage_00668.pdb # 3: usage_00669.pdb # 4: usage_00670.pdb # 5: usage_00671.pdb # 6: usage_01359.pdb # 7: usage_01892.pdb # 8: usage_01893.pdb # 9: usage_01894.pdb # 10: usage_01895.pdb # # Length: 38 # Identity: 11/ 38 ( 28.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 38 ( 44.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 38 ( 5.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00449.pdb 1 PSDLSSIPFSVAGQQEFLEKLAAVVEATTDGLGVYYWE 38 usage_00668.pdb 1 PSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFY-- 36 usage_00669.pdb 1 PSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFY-- 36 usage_00670.pdb 1 PSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFY-- 36 usage_00671.pdb 1 PSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFY-- 36 usage_01359.pdb 1 PSDLSSIPFSADGQETFLGRLADTLEDVGGVGIYYW-- 36 usage_01892.pdb 1 PSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFY-- 36 usage_01893.pdb 1 PSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFY-- 36 usage_01894.pdb 1 PSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFY-- 36 usage_01895.pdb 1 PSDVKNIPFSPEGQTTFITNVANIVSSVSRGVGLFY-- 36 PSD IPFS GQ tF A v v g g y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################