################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:46 2021 # Report_file: c_0787_100.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00049.pdb # 2: usage_00173.pdb # 3: usage_00174.pdb # 4: usage_00219.pdb # 5: usage_01045.pdb # 6: usage_01046.pdb # # Length: 67 # Identity: 24/ 67 ( 35.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 67 ( 46.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 67 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00049.pdb 1 -NMNLPNVKVQLPVIGEKDKHDILNFGIPMGCNFIAASFVQSADDVRYIRGLLGPRGRHI 59 usage_00173.pdb 1 KGVNLPGVRVSLPGITEKDAEDIR-FGIKENVDFIAASFVRRPSDVLEIREILEEQKANI 59 usage_00174.pdb 1 KGVNLPGVRVSLPGITEKDAEDIR-FGIKENVDFIAASFVRRPSDVLEIREILEEQKANI 59 usage_00219.pdb 1 -GVNLPGVSIALPALAEKDKQDLI-FGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGEN 58 usage_01045.pdb 1 KNMNLPNVKVQLPVIGEKDKHDILNFGIPMGCNFIAASFVQSADDVRYIRGLLGPRGRHI 60 usage_01046.pdb 1 KNMNLPNV--QLPVIGEKDKHDILNFGIPMGCNFIAASFVQSADDVRYIRGLLGPRGRHI 58 NLP V LP i EKD Di FGi FiAASFv DV IR L i usage_00049.pdb 60 -RIIPKI 65 usage_00173.pdb 60 -SVFPKI 65 usage_00174.pdb 60 -SVFPKI 65 usage_00219.pdb 59 IHIISKI 65 usage_01045.pdb 61 -RIIPKI 66 usage_01046.pdb 59 -RIIPKI 64 pKI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################