################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:26:57 2021
# Report_file: c_1253_16.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00408.pdb
#   2: usage_00534.pdb
#   3: usage_00535.pdb
#   4: usage_00536.pdb
#   5: usage_00537.pdb
#   6: usage_00538.pdb
#   7: usage_00539.pdb
#   8: usage_00642.pdb
#   9: usage_00643.pdb
#  10: usage_00644.pdb
#
# Length:         42
# Identity:        5/ 42 ( 11.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     10/ 42 ( 23.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           15/ 42 ( 35.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00408.pdb         1  YAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILG   42
usage_00534.pdb         1  YAHALNRGLEE--------------EIAMDMTESDLDFFAG-   27
usage_00535.pdb         1  YAHALNRGLEE--------------EIAMDMTESDLDFFAG-   27
usage_00536.pdb         1  YAHALNRGLEE--------------EIAMDMTESDLDFFAG-   27
usage_00537.pdb         1  YAHALNRGLEE--------------EIAMDMTESDLDFFAG-   27
usage_00538.pdb         1  YAHALNRGLEE--------------EIAMDMTESDLDFFAG-   27
usage_00539.pdb         1  YAHALNRGLEE--------------EIAMDMTESDLDFFAG-   27
usage_00642.pdb         1  YAHALNRGLEE--------------EIAMDMTESDLDFFAG-   27
usage_00643.pdb         1  YAHALNRGLEE--------------EIAMDMTESDLDFFAG-   27
usage_00644.pdb         1  AAHVEDRGNQT--------------EIARQYIEETQPDVILG   28
                           yAH  nRg                 eIA    e         


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################