################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:26 2021 # Report_file: c_1389_29.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00094.pdb # 2: usage_00095.pdb # 3: usage_00181.pdb # 4: usage_00319.pdb # 5: usage_00320.pdb # 6: usage_00321.pdb # 7: usage_00322.pdb # 8: usage_00323.pdb # 9: usage_00324.pdb # 10: usage_00325.pdb # 11: usage_00469.pdb # # Length: 53 # Identity: 28/ 53 ( 52.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 53 ( 56.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 53 ( 43.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00094.pdb 1 -GADLAALCSEAALQAIRKKMDLI-DLEDETIDAEVMNSLAVTMDDFRWALS- 50 usage_00095.pdb 1 VGADLAALCSEAALQAIRKKMDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 52 usage_00181.pdb 1 -----------------RKKMDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 35 usage_00319.pdb 1 ------ALCSEAALQAIRKKMDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 46 usage_00320.pdb 1 ------ALCSEAALQAIRKKMDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 46 usage_00321.pdb 1 ------ALCSEAALQAIRKKMDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 46 usage_00322.pdb 1 ------------------K-MDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 33 usage_00323.pdb 1 ------------------K-MDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 33 usage_00324.pdb 1 ------------------K-MDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 33 usage_00325.pdb 1 ------------------K-MDLI-DLEDETIDAEVMNSLAVTMDDFRWALSQ 33 usage_00469.pdb 1 VGADLAALCSEAALQAIRKKM-DLIDLEDETIDAEVMNSLAVTMDDFRWAL-- 50 K M li DLEDETIDAEVMNSLAVTMDDFRWAL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################