################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:14:32 2021 # Report_file: c_0695_54.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00170.pdb # 2: usage_00225.pdb # 3: usage_00367.pdb # 4: usage_00373.pdb # 5: usage_00374.pdb # 6: usage_00375.pdb # 7: usage_00376.pdb # 8: usage_00377.pdb # 9: usage_00378.pdb # 10: usage_00379.pdb # 11: usage_00380.pdb # 12: usage_00428.pdb # 13: usage_00429.pdb # 14: usage_00430.pdb # # Length: 31 # Identity: 2/ 31 ( 6.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 31 ( 19.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 31 ( 3.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00170.pdb 1 -ASYEDVKLIGEDFSGKSLTYAQFTNADLTD 30 usage_00225.pdb 1 GATFSGSDLSGGEFSTFDWRAANFTHCDLTN 31 usage_00367.pdb 1 -ANLEQADLAGAQLVGAVLDGANLHGANLNN 30 usage_00373.pdb 1 -ANLSGADLQEANLTQANLKDANLSDANLEQ 30 usage_00374.pdb 1 -ANLRGADLHEANLSGADLQEANLTQANLKD 30 usage_00375.pdb 1 -ANLRGADLHEANLSGADLQEANLTQANLKD 30 usage_00376.pdb 1 NASLTGADLSYANLHHANLSRANLRSADLRN 31 usage_00377.pdb 1 EANLSGADLQEANLTQANLKDANLSDANLEQ 31 usage_00378.pdb 1 HANLSRANLRSADLRNANLSHANLSGANLEE 31 usage_00379.pdb 1 -ANLRGADLHEANLSGADLQEANLTQANLKD 30 usage_00380.pdb 1 NASLTGADLSYANLHHANLSRANLRSADLRN 31 usage_00428.pdb 1 -TCLREADLSEAILWGIDLSEADLYRAILRE 30 usage_00429.pdb 1 EANLIKASLCGANLNSANLSRCLLFQADLRP 31 usage_00430.pdb 1 -ADLSGASLQGADLSYANLESAILRKANLQG 30 a L l a a L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################