################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:16:50 2021 # Report_file: c_0384_9.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00023.pdb # 2: usage_00024.pdb # 3: usage_00025.pdb # 4: usage_00029.pdb # 5: usage_00053.pdb # 6: usage_00054.pdb # 7: usage_00055.pdb # 8: usage_00072.pdb # 9: usage_00073.pdb # 10: usage_00074.pdb # # Length: 82 # Identity: 47/ 82 ( 57.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 82 ( 57.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/ 82 ( 31.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG 38 usage_00024.pdb 1 ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG 38 usage_00025.pdb 1 ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG 38 usage_00029.pdb 1 ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG 38 usage_00053.pdb 1 ----------------------CELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNG 38 usage_00054.pdb 1 ----------------------CELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNG 38 usage_00055.pdb 1 HFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG 60 usage_00072.pdb 1 ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG 38 usage_00073.pdb 1 ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG 38 usage_00074.pdb 1 ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG 38 CELETMTGEKVK VV EGDNK VTTFK IKSVTE NG usage_00023.pdb 39 DIITNTMTLGDIVFKRISK--- 57 usage_00024.pdb 39 DIITNTMTLGDIVFKRIS---- 56 usage_00025.pdb 39 DIITNTMTLGDIVFKRISK--- 57 usage_00029.pdb 39 DIITNTMTLGDIVFKRISKRIG 60 usage_00053.pdb 39 DTITNTMTLGDIVYKRVSKR-- 58 usage_00054.pdb 39 DTITNTMTLGDIVYKRVSKRI- 59 usage_00055.pdb 61 DIITNTMTLGDIVFKRISKR-- 80 usage_00072.pdb 39 DIITNTMTLGDIVFKRISKRIG 60 usage_00073.pdb 39 DIITNTMTLGDIVFKRISKRIG 60 usage_00074.pdb 39 DIITNTMTLGDIVFKRISKR-- 58 D ITNTMTLGDIV KR S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################