################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:26 2021 # Report_file: c_1333_11.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00124.pdb # 2: usage_00194.pdb # 3: usage_00446.pdb # 4: usage_00465.pdb # 5: usage_00466.pdb # 6: usage_00467.pdb # 7: usage_00468.pdb # 8: usage_00469.pdb # 9: usage_00470.pdb # 10: usage_00483.pdb # 11: usage_00658.pdb # 12: usage_00831.pdb # # Length: 43 # Identity: 2/ 43 ( 4.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 43 ( 7.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 43 ( 34.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00124.pdb 1 SVKSHDNFCAK------------QGFAFPLVSDGDEALCRAFD 31 usage_00194.pdb 1 ---WSEDVKCLS-------GVK-GDMPYPIIADETRELAVKLG 32 usage_00446.pdb 1 SVEDHLAWSKDINAYNCEEP-T-EKLPFPIIDDRNRELAILLG 41 usage_00465.pdb 1 SQYSHLAWDNLD-R---KSG-GLGHMKIPLLADRKQEISKAYG 38 usage_00466.pdb 1 SQYSHLAWDNLD-R---KSG-GLGHMKIPLLADRKQEISKAYG 38 usage_00467.pdb 1 SQYSHLAWDNLD-R---KSG-GLGHMKIPLLADRKQEISKAYG 38 usage_00468.pdb 1 SQYSHLAWDNLD-R---KSG-GLGHMKIPLLADRKQEISKAYG 38 usage_00469.pdb 1 SQYSHLAWDNLD-R---KSG-GLGHMKIPLLADRKQEISKAYG 38 usage_00470.pdb 1 -QYSHLAWDNLD-R---KSG-GLGHMKIPLLADRKQEISKAYG 37 usage_00483.pdb 1 SQYSHLAWDNLD-R---KSG-GLGHMKIPLLADRKQEISKAYG 38 usage_00658.pdb 1 SLRSHDNFKAK------------LELPFPLISDADEALCALFD 31 usage_00831.pdb 1 -VFSHIKWIEWI-K---DNL-S-VEIDFPVIADDRGELAEKLG 36 h P D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################