################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:06 2021 # Report_file: c_1393_13.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00018.pdb # 2: usage_00380.pdb # 3: usage_00985.pdb # 4: usage_00986.pdb # 5: usage_01058.pdb # 6: usage_01276.pdb # # Length: 63 # Identity: 32/ 63 ( 50.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 63 ( 55.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 63 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 DPFARKITEGVVKDEYTHLNYGEAWLKANLESCREELLEANRENLPLIRRLDQVA----- 55 usage_00380.pdb 1 DPFARKITEGVVKDEYTHLNYGEAWLKANLESCREELLEANRENLPLIRRMLDQVA---- 56 usage_00985.pdb 1 -AFARKITEGVVRDEYLHRNFGEEWLKANFDASKAELEEANRQNLPLVWLMLNEVADDAR 59 usage_00986.pdb 1 DAFARKITEGVVRDEYLHRNFGEEWLKANFDASKAELEEANRQNLPLVWLMLNEVA---- 56 usage_01058.pdb 1 -PFARKITEGVVKDEYTHLNYGEAWLKANLESCREELLEANRENLPLIRRMLDQVA---- 55 usage_01276.pdb 1 DPFARKITEGVVKDEYTHLNYGEAWLKANLESCREELLEANRENLPLIRRMLDQVA---- 56 FARKITEGVV DEY H N GE WLKAN EL EANR NLPL ml v usage_00018.pdb --- usage_00380.pdb --- usage_00985.pdb 60 ELG 62 usage_00986.pdb --- usage_01058.pdb --- usage_01276.pdb --- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################