################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:29 2021 # Report_file: c_1304_33.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00539.pdb # 2: usage_00540.pdb # 3: usage_00706.pdb # 4: usage_00744.pdb # 5: usage_00746.pdb # 6: usage_00752.pdb # 7: usage_00819.pdb # 8: usage_01046.pdb # 9: usage_01121.pdb # 10: usage_01122.pdb # 11: usage_01123.pdb # 12: usage_01124.pdb # # Length: 46 # Identity: 5/ 46 ( 10.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 46 ( 45.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 46 ( 23.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00539.pdb 1 -RQDQLILQMITLMDKLLRRENLDLKLTPYKVLATSSKHGFLQYVD 45 usage_00540.pdb 1 -RQDQLILQMITLMDKLLRRENLDLKLTPYKVLATSSKHGFLQYVD 45 usage_00706.pdb 1 -RQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQ 45 usage_00744.pdb 1 -RQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQ 45 usage_00746.pdb 1 LRQDQLVVQIISLMNELLKNENVDLKLTPYKILATGPQEGAIEFIP 46 usage_00752.pdb 1 -MVEQMHEDIISLWDQSLK-----P-CVKLTPLCVGAGSCNT---- 35 usage_00819.pdb 1 -RQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQ 45 usage_01046.pdb 1 LRQDQLVVQIISLMNELLKNENVDLKLTPYKILATGPQEGAIEFIP 46 usage_01121.pdb 1 -RQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQ 45 usage_01122.pdb 1 -RQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQ 45 usage_01123.pdb 1 -RQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQ 45 usage_01124.pdb 1 -RQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQ 45 rqdQl q I Lm lL l ltpyk Lat g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################