################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:41:57 2021 # Report_file: c_0699_46.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00532.pdb # 2: usage_00612.pdb # 3: usage_01079.pdb # 4: usage_01202.pdb # 5: usage_01496.pdb # 6: usage_01593.pdb # 7: usage_01714.pdb # # Length: 62 # Identity: 44/ 62 ( 71.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 53/ 62 ( 85.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 62 ( 14.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00532.pdb 1 -----DVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMY- 54 usage_00612.pdb 1 ------VSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMY- 53 usage_01079.pdb 1 -----DVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMY- 54 usage_01202.pdb 1 -ELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYH 59 usage_01496.pdb 1 --LNLDVSIQLPSRNSAVRHRILWESASLLRSEETKENERFTVKAEGKGQGTLSVVTVY- 57 usage_01593.pdb 1 QELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMY- 59 usage_01714.pdb 1 QELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYH 60 VSlQLPSRsSkitHRIhWESASLLRSEETKENEgFTVtAEGKGQGTLSVVTmY usage_00532.pdb -- usage_00612.pdb -- usage_01079.pdb -- usage_01202.pdb -- usage_01496.pdb -- usage_01593.pdb -- usage_01714.pdb 61 AK 62 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################