################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:11 2021 # Report_file: c_0462_57.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00564.pdb # 2: usage_00651.pdb # 3: usage_00652.pdb # 4: usage_00653.pdb # 5: usage_00686.pdb # 6: usage_00698.pdb # # Length: 111 # Identity: 3/111 ( 2.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/111 ( 9.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 35/111 ( 31.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00564.pdb 1 HIAYLEAGSV--PC----TVRGKAVAGRLDELGASWS-LIVA-E---------ETAEAAR 43 usage_00651.pdb 1 KIVFLGEKD-D-DW-TRGAARRAGFKRAMREAGLNPDQEIRLGAPP-------LSIEDGV 50 usage_00652.pdb 1 KIVFLGEKD-D-DW-TRGAARRAGFKRAMREAGLNPDQEIRLGAPP-------LSIEDGV 50 usage_00653.pdb 1 KIVFLGEKD-D-DW-TRGAARRAGFKRAMREAGLNPDQEIRLGAPP-------LSIEDGV 50 usage_00686.pdb 1 AFIHYASTD-D-LKDVNIAKRLE-IKETCKNIGLPFV-QVNTPNINTEEDKNK-VKQFLN 55 usage_00698.pdb 1 RFAFYGLPE--SSGKRWATEREYAFRQLVAEEKYRGV-VYQGLETA-------PE--NWQ 48 R e g usage_00564.pdb 44 EAAAAFLREHPET---DGILAFNDLMAAGVLKALSGSGRRVP-EDCAVIGM 90 usage_00651.pdb 51 AAAELILQEYPDT---DCIFCVSDMPAFGLLSRLKSIGVAVP-EQVSVVGF 97 usage_00652.pdb 51 AAAELILQEYPDT---DCIFCVSDMPAFGLLSRLKSIGVAVP-EQVSVVGF 97 usage_00653.pdb 51 AAAELILQEYPDT---DCIFCVSDMPAFGLLSRLKSIGVAVP-EQVSVVGF 97 usage_00686.pdb 56 EDIEKQVKKYGKD---INVFGVNEY-DEVILTKALELKYIVAE-------- 94 usage_00698.pdb 49 HAQNRLADWLQTLPPQTGIIAVTDARARHILQVCEHLHIPVP-EKLCVIGI 98 a i v d a L Vp #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################