################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:37 2021 # Report_file: c_1043_63.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00145.pdb # 2: usage_00231.pdb # 3: usage_00361.pdb # 4: usage_00526.pdb # 5: usage_00527.pdb # # Length: 62 # Identity: 20/ 62 ( 32.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 62 ( 37.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 62 ( 16.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00145.pdb 1 VVNYPFDDD--EQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGI 58 usage_00231.pdb 1 VVNYPFDDD--EQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGI 58 usage_00361.pdb 1 VANYPYDKS--FE---ASTPTPDDKLFQKLAKVYSYAHGWMFQGWNC---G--DYFPDGI 50 usage_00526.pdb 1 VASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNC---N--DSFSGGI 55 usage_00527.pdb 1 VASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNC---N--DSFSGGI 55 V YP D s PDD vF qLA YS M G C F GI usage_00145.pdb 59 TN 60 usage_00231.pdb 59 TN 60 usage_00361.pdb 51 TN 52 usage_00526.pdb 56 TN 57 usage_00527.pdb 56 TN 57 TN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################