################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:17:39 2021 # Report_file: c_0734_2.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00034.pdb # 2: usage_00180.pdb # 3: usage_00181.pdb # 4: usage_00194.pdb # 5: usage_00201.pdb # 6: usage_00202.pdb # 7: usage_00203.pdb # 8: usage_00204.pdb # 9: usage_00205.pdb # 10: usage_00206.pdb # # Length: 47 # Identity: 12/ 47 ( 25.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 47 ( 42.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 47 ( 12.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00034.pdb 1 -EVRIAMRAAGVNFRDALIALGMY-P-GVA-SLGSEGAGVVVETG-- 41 usage_00180.pdb 1 NEIQVENKAIGINFIDTYIRSGLYPPPSLPSGLGTEAAGIVSKVGS- 46 usage_00181.pdb 1 NEIQVENKAIGINFIDTYIRSGLYPPPSLPSGLGTEAAGIVSKVGS- 46 usage_00194.pdb 1 QAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVG-- 45 usage_00201.pdb 1 -ELLIKAEAIGVNFIDTYFRSGQYPRELPF-VIGSEVCGTVEAVGP- 44 usage_00202.pdb 1 -ELLIKAEAIGVNFIDTYFRSGQYPRELPF-VIGSEVCGTVEAVGP- 44 usage_00203.pdb 1 -ELLIKAEAIGVNFIDTYFRSGQYPRELPF-VIGSEVCGTVEAVGPG 45 usage_00204.pdb 1 -ELLIKAEAIGVNFIDTYFRSGQYPRELPF-VIGSEVCGTVEAVGPG 45 usage_00205.pdb 1 -ELLIKAEAIGVNFIDTYFRSGQYPRELPF-VIGSEVCGTVEAVGP- 44 usage_00206.pdb 1 -ELLIKAEAIGVNFIDTYFRSGQYPRELPF-VIGSEVCGTVEAVGP- 44 e AiG NFiDty rsG Y G E G V vG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################