################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:47 2021 # Report_file: c_1428_21.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00740.pdb # 2: usage_00795.pdb # 3: usage_01203.pdb # 4: usage_01204.pdb # 5: usage_01355.pdb # 6: usage_01522.pdb # 7: usage_01523.pdb # 8: usage_01524.pdb # 9: usage_01525.pdb # 10: usage_01549.pdb # # Length: 41 # Identity: 17/ 41 ( 41.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 41 ( 63.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 41 ( 14.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00740.pdb 1 TPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAK- 40 usage_00795.pdb 1 TPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAK- 40 usage_01203.pdb 1 -----KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKN 36 usage_01204.pdb 1 TPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAK- 40 usage_01355.pdb 1 ---DFKADIWSFGITAIELATGAAPYHKYPPMKVLMLTLQ- 37 usage_01522.pdb 1 ---DYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAK- 37 usage_01523.pdb 1 ---DYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAK- 37 usage_01524.pdb 1 TPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAK- 40 usage_01525.pdb 1 TPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAK- 40 usage_01549.pdb 1 TPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAK- 40 KADIWSlGIT IE A epPhhel PM VL i k #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################