################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:06 2021 # Report_file: c_1337_33.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00004.pdb # 2: usage_00005.pdb # 3: usage_00006.pdb # 4: usage_00007.pdb # 5: usage_00015.pdb # 6: usage_00016.pdb # 7: usage_00017.pdb # 8: usage_00020.pdb # 9: usage_00108.pdb # 10: usage_01150.pdb # 11: usage_01151.pdb # 12: usage_01152.pdb # 13: usage_01153.pdb # # Length: 46 # Identity: 42/ 46 ( 91.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/ 46 ( 91.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 46 ( 8.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 -AYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF 45 usage_00005.pdb 1 -AYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI--- 42 usage_00006.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAA- 45 usage_00007.pdb 1 -AYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI--- 42 usage_00015.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF 46 usage_00016.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF 46 usage_00017.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAA- 45 usage_00020.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI--- 43 usage_00108.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF 46 usage_01150.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI--- 43 usage_01151.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAA- 45 usage_01152.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF 46 usage_01153.pdb 1 EAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF 46 AYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################