################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:23:41 2021 # Report_file: c_0780_1.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00218.pdb # 2: usage_00631.pdb # 3: usage_00735.pdb # 4: usage_00756.pdb # 5: usage_00757.pdb # 6: usage_00832.pdb # # Length: 89 # Identity: 9/ 89 ( 10.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 89 ( 33.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/ 89 ( 34.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00218.pdb 1 YPIAILANN-----GILFAEAAQKGAHFIELACQRGIPLLFLQNITG------------- 42 usage_00631.pdb 1 AACAVAAYDYTVLAGTQGYFNHHKLDRLIALAGQWKWPLVLFAEGGGGRPGDTDMPVAA- 59 usage_00735.pdb 1 RTVGVLANNPLRLGGCLNSESAEKAARFVRLCDAFGIPLVVVVDVPGYL---------DQ 51 usage_00756.pdb 1 --VGVLANNPLRLGGCLNSESA-KAARFVRLCDAFGIPLVVVVDVPGYLPG-----VDQ- 51 usage_00757.pdb 1 --VGVLANNPLRLGGCLNSESAEKAARFVRLCDAFGIPLVVVVDVPGYLPG-----VDQ- 52 usage_00832.pdb 1 --VGVLANNPLRLGGCLNSESAEKAARFVRLCDAFGIPLVVVVDVPGYL----------- 47 vlAnn G l e a K arf L giPLv G usage_00218.pdb 43 --G-IAKHGAKLVTAVACA--RVPKFTVL 66 usage_00631.pdb 60 ALV------TPTFLNFAALSGQVPLVGVA 82 usage_00735.pdb 52 EWGGVVRRGAKLLHAFGEC--TVPRVTLV 78 usage_00756.pdb 52 EWGGVVRRGAKLLHAFGEC--TVPRVTLV 78 usage_00757.pdb 53 EWGGVVRRGAKLLHAFGEC--TVPRVTLV 79 usage_00832.pdb 48 -WGGVVRRGAKLLHAFGEC--TVPRVTLV 73 g akl af VP vt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################