################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:52 2021 # Report_file: c_1211_16.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00781.pdb # 2: usage_00879.pdb # 3: usage_00943.pdb # 4: usage_00944.pdb # 5: usage_00945.pdb # 6: usage_00946.pdb # 7: usage_00947.pdb # 8: usage_00948.pdb # 9: usage_01214.pdb # 10: usage_01215.pdb # # Length: 52 # Identity: 26/ 52 ( 50.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 52 ( 50.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/ 52 ( 50.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00781.pdb 1 TTQNVVLTKYGFD--------ATDQIWTGDGAKPLQGVDFTIYNVTANYWAS 44 usage_00879.pdb 1 ---NVVLTKYGFDKDVTAIDRATDQIWTGDGAKPLQGVDFTIYNVTANYWAS 49 usage_00943.pdb 1 TTQNVVLTKYGFD-----IDRATDQIWTGDGAKPLQGVDFTIYNVTANYWAS 47 usage_00944.pdb 1 TTQNVVLTKYGFDKDVTAIDRATDQIWTGDGAKPLQGVDFTIYNVTANYWAS 52 usage_00945.pdb 1 TTQNVVLTKYGFD-------RATDQIWTGDGAKPLQGVDFTIYNVTANYWAS 45 usage_00946.pdb 1 TTQNVVLTKYGFD-----IDRATDQIWTGDGAKPLQGVDFTIYNVTANYWAS 47 usage_00947.pdb 1 TTQNVVLTKYGFD------------------AKPLQGVDFTIYNVTANYWAS 34 usage_00948.pdb 1 -TQNVVLTKYGF-----------------------QGVDFTIYNVTANYWAS 28 usage_01214.pdb 1 TTQNVVLTKYGFDKDVTAIDRATDQIWTGDGAKPLQGVDFTIYNVTANYWAS 52 usage_01215.pdb 1 TTQNVVLTKYGFD-------RATDQIWTGDGAKPLQGVDFTIYNVTANYWAS 45 NVVLTKYGF QGVDFTIYNVTANYWAS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################