################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:22 2021 # Report_file: c_0809_14.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00110.pdb # 2: usage_00134.pdb # 3: usage_00156.pdb # 4: usage_00163.pdb # 5: usage_00164.pdb # 6: usage_00195.pdb # 7: usage_00196.pdb # 8: usage_00197.pdb # 9: usage_00198.pdb # 10: usage_00262.pdb # # Length: 54 # Identity: 16/ 54 ( 29.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/ 54 ( 90.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 54 ( 9.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00110.pdb 1 -VNEAKEKLKEAPEGTFLIRDSSHS-DYLLTISVKTSAGPTNLRIEYQDGKFRL 52 usage_00134.pdb 1 SREEVNEKLRDTADGTFLVRDASTK--GDYTLTLRKGGNNKLIKIFHRDGKYGF 52 usage_00156.pdb 1 -REEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYG- 52 usage_00163.pdb 1 SREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYG- 53 usage_00164.pdb 1 -REEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYG- 52 usage_00195.pdb 1 SREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGF 54 usage_00196.pdb 1 SREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGF 54 usage_00197.pdb 1 SREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGF 54 usage_00198.pdb 1 SREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGF 54 usage_00262.pdb 1 --EEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGF 52 eEvnEKLrdtadGTFLvRDaStk gdyTltlrkggnnklikIfhrDGKyg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################