################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:04:17 2021
# Report_file: c_1386_95.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00047.pdb
#   2: usage_00048.pdb
#   3: usage_00049.pdb
#   4: usage_00229.pdb
#   5: usage_00230.pdb
#   6: usage_00294.pdb
#   7: usage_00295.pdb
#   8: usage_00296.pdb
#   9: usage_00297.pdb
#  10: usage_00298.pdb
#  11: usage_00299.pdb
#  12: usage_00300.pdb
#  13: usage_00301.pdb
#
# Length:         34
# Identity:       15/ 34 ( 44.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     15/ 34 ( 44.1%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            1/ 34 (  2.9%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00047.pdb         1  SFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   34
usage_00048.pdb         1  -FGAAWNRFKEVNVNVEQVGKLLGGKVQHNIDAG   33
usage_00049.pdb         1  -FGAAWNRFKEVNVNVEQVGKLLGGKVQHNIDAG   33
usage_00229.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
usage_00230.pdb         1  SFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   34
usage_00294.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
usage_00295.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
usage_00296.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
usage_00297.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
usage_00298.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
usage_00299.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
usage_00300.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
usage_00301.pdb         1  -FNEAWLAFRKVNHSVADVGSIIGGNVGKNITGG   33
                            F  AW  F  VN  V  VG   GG V  NI  G


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################