################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:41:40 2021
# Report_file: c_1329_19.html
################################################################################################
#====================================
# Aligned_structures: 16
#   1: usage_00036.pdb
#   2: usage_00037.pdb
#   3: usage_00041.pdb
#   4: usage_00049.pdb
#   5: usage_00050.pdb
#   6: usage_00067.pdb
#   7: usage_00068.pdb
#   8: usage_00072.pdb
#   9: usage_00073.pdb
#  10: usage_00074.pdb
#  11: usage_00075.pdb
#  12: usage_00076.pdb
#  13: usage_00077.pdb
#  14: usage_00101.pdb
#  15: usage_00200.pdb
#  16: usage_00201.pdb
#
# Length:         32
# Identity:       14/ 32 ( 43.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     16/ 32 ( 50.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            5/ 32 ( 15.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00036.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNLMMCCRK   32
usage_00037.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNLMMCCRK   32
usage_00041.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRN   32
usage_00049.pdb         1  SAAAKFERQHMDSGN-----STYCNQMMRRRN   27
usage_00050.pdb         1  SAAAKFERQHMDSGN----SSTYCNQMMRRRN   28
usage_00067.pdb         1  SAAQKFQRQHMDPDGSSINSPTYCNQMMKRRD   32
usage_00068.pdb         1  SAAQKFQRQHMDPDGSSINSPTYCNQMMKRRD   32
usage_00072.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNQMMLLRN   32
usage_00073.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNLMMLLRN   32
usage_00074.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNLMMLLRN   32
usage_00075.pdb         1  SRAKKFQRQHMDSDSSPSSSSLYCNLMMLLRN   32
usage_00076.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRN   32
usage_00077.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRN   32
usage_00101.pdb         1  SSADKFKRQHMDTEGPSKSSPTYCNQMMKRQG   32
usage_00200.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRN   32
usage_00201.pdb         1  SRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRN   32
                           S A KF RQHMD         tYCN MM  r 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################