################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:30 2021 # Report_file: c_0752_3.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00050.pdb # 2: usage_00108.pdb # 3: usage_00117.pdb # 4: usage_00119.pdb # 5: usage_00161.pdb # 6: usage_00187.pdb # 7: usage_00238.pdb # 8: usage_00240.pdb # 9: usage_00300.pdb # # Length: 61 # Identity: 51/ 61 ( 83.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 61 ( 83.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 61 ( 16.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00050.pdb 1 -MKFTVEREHLLKPLQQVSG-------LPILGNLLLQVADGTLSLTGTDLEMEMVARVAL 52 usage_00108.pdb 1 -MKFTVEREHLLKPLQQVSGP-LGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVAL 58 usage_00117.pdb 1 -MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVA- 58 usage_00119.pdb 1 -MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVA- 58 usage_00161.pdb 1 -MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVA- 58 usage_00187.pdb 1 -MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVA- 58 usage_00238.pdb 1 AMKFTVEREHLLKPLQQVSGP----PTLPILGNLLLQVADGTLSLTGTDLEMEMVARVA- 55 usage_00240.pdb 1 AMKFTVEREHLLKPLQQVSGPL---PTLPILGNLLLQVADGTLSLTGTDLEMEMVARVAL 57 usage_00300.pdb 1 -MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVAL 59 MKFTVEREHLLKPLQQVSG LPILGNLLLQVADGTLSLTGTDLEMEMVARVA usage_00050.pdb 53 V 53 usage_00108.pdb 59 V 59 usage_00117.pdb - usage_00119.pdb - usage_00161.pdb - usage_00187.pdb - usage_00238.pdb - usage_00240.pdb - usage_00300.pdb 60 V 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################