################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:53 2021 # Report_file: c_0851_10.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00023.pdb # 2: usage_00059.pdb # 3: usage_00060.pdb # 4: usage_00061.pdb # 5: usage_00274.pdb # 6: usage_00544.pdb # 7: usage_00629.pdb # 8: usage_00630.pdb # 9: usage_00941.pdb # # Length: 71 # Identity: 57/ 71 ( 80.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 57/ 71 ( 80.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 71 ( 1.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 YSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRN 60 usage_00059.pdb 1 YSLISLCKHFCKFMNSGGSVVSLTYQASQKVVPGYGGGMSSAKAALESDTRVLAYYLGRK 60 usage_00060.pdb 1 YSLISLCKHFCKFMNSGGSVVSLTYQASQKVVPGYGGGMSSAKAALESDTRVLAYYLGRK 60 usage_00061.pdb 1 YSLISLCKHFCKFMNSGGSVVSLTYQASQKVVPGYGGGMSSAKAALESDTRVLAYYLGRK 60 usage_00274.pdb 1 YSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRN 60 usage_00544.pdb 1 YSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRN 60 usage_00629.pdb 1 YSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRN 60 usage_00630.pdb 1 -SLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRN 59 usage_00941.pdb 1 YSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRN 60 SLISLCK F M S SLTY ASQKVVPGYGGGMSSAKAALESDTRVLAY LGR usage_00023.pdb 61 YNIRINTISAG 71 usage_00059.pdb 61 YNIRINTISAG 71 usage_00060.pdb 61 YNIRINTISAG 71 usage_00061.pdb 61 YNIRINTISAG 71 usage_00274.pdb 61 YNIRINTISAG 71 usage_00544.pdb 61 YNIRINTISAG 71 usage_00629.pdb 61 YNIRINTISAG 71 usage_00630.pdb 60 YNIRINTISAG 70 usage_00941.pdb 61 YNIRINTISAG 71 YNIRINTISAG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################