################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:01 2021 # Report_file: c_1370_120.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00340.pdb # 2: usage_00883.pdb # 3: usage_00884.pdb # 4: usage_00888.pdb # 5: usage_00908.pdb # 6: usage_01659.pdb # # Length: 69 # Identity: 9/ 69 ( 13.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 69 ( 30.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 69 ( 20.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00340.pdb 1 ---------PAVQARVDEILDGMLAAGGPVDLVSAYANAVSTSVICELLGIPRHDLEFFR 51 usage_00883.pdb 1 -LRKMQRMAPYIEQIVNDRLDEMERAGSPADLIAFVADKVPGAVLCELVGVPRD-DRDMF 58 usage_00884.pdb 1 -LRKMQRMAPYIEQIVNDRLDEMERAGSPADLIAFVADKVPGAVLCELVGVPRD-DRDMF 58 usage_00888.pdb 1 --------RPRAQEILDGLVDGILAEGPPADLVERVLEPFPIAVVSEVMGVPAA-DRERV 51 usage_00908.pdb 1 TVRRIKELEPRIVRITEDHLDAMAKAGPPVDLVQAFALPVPSLVICELLGVSYA-DHAFF 59 usage_01659.pdb 1 -LRKMQRMAPYIEQIVNDRLDEMERAGSPADLIAFVADKVPGAVLCELVGVPRD-DRDMF 58 P i lD m aG P DL a vp V cEl Gvp d usage_00340.pdb 52 DVTRISG-- 58 usage_00883.pdb 59 MKLCHGHLD 67 usage_00884.pdb 59 MKLCHGHLD 67 usage_00888.pdb 52 HSWTR---- 56 usage_00908.pdb 60 QEQTTIMV- 67 usage_01659.pdb 59 MKLCHGHLD 67 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################