################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:26 2021 # Report_file: c_1262_94.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00123.pdb # 2: usage_00146.pdb # 3: usage_00425.pdb # 4: usage_00426.pdb # 5: usage_00427.pdb # 6: usage_00461.pdb # 7: usage_00462.pdb # 8: usage_00856.pdb # 9: usage_01109.pdb # # Length: 35 # Identity: 1/ 35 ( 2.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 35 ( 31.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 35 ( 25.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00123.pdb 1 KYAVVAGEPL--NPEVFNRFLEFTGIKLMEGFGQ- 32 usage_00146.pdb 1 DITVYNGQHKEAAQAVADAFTRATGIKVKL----- 30 usage_00425.pdb 1 DITVYNGQHKEAAQAVADAFTRATGIKVKL----- 30 usage_00426.pdb 1 DITVYNGQHKEAAQAVADAFTRATGIKVKLNS-AK 34 usage_00427.pdb 1 DITVYNGQHKEAAQAVADAFTRATGIKVKLNS--- 32 usage_00461.pdb 1 DITVYNGQHKEAAQAVADAFTRATGIKVKLNS-AK 34 usage_00462.pdb 1 DITVYNGQHKEAAQAVADAFTRATGIKVKLN---- 31 usage_00856.pdb 1 SAYFFHPDNQEDAEAITHLFT-DVQNRYT------ 28 usage_01109.pdb 1 DITVYNGQHKEAAQAVADAFTRATGIKVKL----- 30 v g a av Ft tgik #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################