################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:10 2021 # Report_file: c_1240_119.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00921.pdb # 2: usage_00922.pdb # 3: usage_00923.pdb # 4: usage_00926.pdb # 5: usage_00927.pdb # 6: usage_00928.pdb # 7: usage_00929.pdb # 8: usage_01997.pdb # 9: usage_01998.pdb # 10: usage_02007.pdb # 11: usage_02008.pdb # # Length: 37 # Identity: 13/ 37 ( 35.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 37 ( 35.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 37 ( 8.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00921.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_00922.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_00923.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_00926.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_00927.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_00928.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_00929.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_01997.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_01998.pdb 1 RYGYISEFESGETALESKAKVDQLAQDYHINAWQFYD 37 usage_02007.pdb 1 RYGYIANFPE-QSKEKSALIIEDLNK-YHLNGLLFY- 34 usage_02008.pdb 1 RYGYIANFPE-QSKEKSALIIEDLNK-YHLNGLLFY- 34 RYGYI F S L YH N FY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################