################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:47 2021 # Report_file: c_1184_58.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00503.pdb # 2: usage_00560.pdb # 3: usage_00700.pdb # 4: usage_00756.pdb # 5: usage_00757.pdb # 6: usage_01142.pdb # 7: usage_01143.pdb # 8: usage_02134.pdb # 9: usage_02135.pdb # 10: usage_02151.pdb # # Length: 50 # Identity: 15/ 50 ( 30.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 50 ( 86.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 50 ( 14.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00503.pdb 1 --ADVDSEETAREDGRASNVIDGNPSTFWHTEWSRADAPGYPHRISLDLG 48 usage_00560.pdb 1 -AVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDM- 45 usage_00700.pdb 1 -AVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTID-- 44 usage_00756.pdb 1 -AVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDM- 45 usage_00757.pdb 1 -AVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDM- 45 usage_01142.pdb 1 -AVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDMK 46 usage_01143.pdb 1 -AVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDM- 45 usage_02134.pdb 1 WAVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDM- 46 usage_02135.pdb 1 -AVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDM- 45 usage_02151.pdb 1 -AVTCDSAQS---GNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTID-- 44 vtcDSaqs gnecnkaIDGNkdTFWHTfygangdPkpPHtytiD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################