################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:22 2021 # Report_file: c_1245_42.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00001.pdb # 2: usage_00006.pdb # 3: usage_00283.pdb # 4: usage_00284.pdb # 5: usage_00285.pdb # 6: usage_00287.pdb # 7: usage_00381.pdb # 8: usage_00408.pdb # 9: usage_00461.pdb # 10: usage_00752.pdb # 11: usage_00753.pdb # 12: usage_00761.pdb # # Length: 41 # Identity: 18/ 41 ( 43.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 41 ( 48.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 41 ( 9.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 -QAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYAS- 39 usage_00006.pdb 1 --AFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQ 39 usage_00283.pdb 1 -QAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYAS- 39 usage_00284.pdb 1 -QAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYA-- 38 usage_00285.pdb 1 --AFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYA-- 37 usage_00287.pdb 1 --AFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYAS- 38 usage_00381.pdb 1 NQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYAS- 40 usage_00408.pdb 1 -QAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYA-- 38 usage_00461.pdb 1 -EAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYAS- 39 usage_00752.pdb 1 -QAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYAS- 39 usage_00753.pdb 1 -QAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYA-- 38 usage_00761.pdb 1 -QAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTS- 39 AF LLVN S VS S Y DeDGF YM Ya #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################