################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:02:54 2021 # Report_file: c_0963_38.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00025.pdb # 2: usage_00038.pdb # 3: usage_00039.pdb # 4: usage_00094.pdb # 5: usage_00191.pdb # 6: usage_00192.pdb # 7: usage_00193.pdb # 8: usage_00243.pdb # 9: usage_00301.pdb # 10: usage_00396.pdb # 11: usage_00397.pdb # 12: usage_00610.pdb # 13: usage_00611.pdb # # Length: 30 # Identity: 4/ 30 ( 13.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 30 ( 16.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 30 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 MCLATCTRDGKPSARMLLLKGFGKDGFRFF 30 usage_00038.pdb 1 --LATADSQGRPSTRIVVISEISDAGVVFS 28 usage_00039.pdb 1 --LATADSQGRPSTRIVVISEISDAGVVFS 28 usage_00094.pdb 1 -VVATVDEHGQPYQRIVLLKHYDEKGVFYT 29 usage_00191.pdb 1 MVVATVDEHGQPYQRIVLLKHYDEKGMVFY 30 usage_00192.pdb 1 -VVATVDEHGQPYQRIVLLKHYDEKGVFY- 28 usage_00193.pdb 1 MVVATVDEHGQPYQRIVLLKHYDEKGMVFY 30 usage_00243.pdb 1 -ALATVDGQGRPSTRIVVIAELGERGVVFA 29 usage_00301.pdb 1 -VVATVDEHGQPYQRIVLLKHYDEKGVFY- 28 usage_00396.pdb 1 -MVLATVADGKPVTRSVLCKILDESGVAFF 29 usage_00397.pdb 1 -MVLATVADGKPVTRSVLCKILDESGVAFF 29 usage_00610.pdb 1 MVVATVDEHGQPYQRIVLLKHYDEKGMVFY 30 usage_00611.pdb 1 MVVATVDEHGQPYQRIVLLKHYDEKGMVFY 30 G P R v G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################