################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:23:30 2021 # Report_file: c_0680_8.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00087.pdb # 2: usage_01122.pdb # 3: usage_01394.pdb # 4: usage_01395.pdb # 5: usage_01396.pdb # 6: usage_01397.pdb # # Length: 66 # Identity: 20/ 66 ( 30.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 66 ( 69.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 66 ( 21.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00087.pdb 1 EEYRPPPVSELATKGTMVGVISAAAI-N------QSIVYSIVSGNE-----EDTFGINNI 48 usage_01122.pdb 1 EV-FEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQ-DPELPHKNMFTVNRD 58 usage_01394.pdb 1 EEYRPPPVSELAARGTVVGVISAAAI-N------QSIVYSIVAGNE-----EDKFGINNV 48 usage_01395.pdb 1 EEYRPPPVSELAARGTVVGVISAAAI-N------QSIVYSIVAGNE-----EDKFGINNV 48 usage_01396.pdb 1 EEYRPPPVSELAARGTVVGVISAAAI-N------QSIVYSIVAGNE-----EDKFGINNV 48 usage_01397.pdb 1 EEYRPPPVSELAARGTVVGVISAAAI-N------QSIVYSIVAGNE-----EDKFGINNV 48 Ee rpppVsElA GT VgviSAaai n qsIvYsIV g e ed FgiNn usage_00087.pdb 49 TGVIYV 54 usage_01122.pdb 59 TGVISV 64 usage_01394.pdb 49 TGVIYV 54 usage_01395.pdb 49 TGVIYV 54 usage_01396.pdb 49 TGVIYV 54 usage_01397.pdb 49 TGVIYV 54 TGVIyV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################