################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:32 2021 # Report_file: c_1305_29.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00059.pdb # 2: usage_00122.pdb # 3: usage_00269.pdb # 4: usage_00381.pdb # 5: usage_00949.pdb # 6: usage_01020.pdb # 7: usage_01281.pdb # 8: usage_01302.pdb # 9: usage_01327.pdb # # Length: 36 # Identity: 8/ 36 ( 22.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 36 ( 88.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 36 ( 8.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00059.pdb 1 NPAIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHT- 35 usage_00122.pdb 1 NPAIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHT- 35 usage_00269.pdb 1 NPAIDIGQVEGAFVQGLGLFTMEELHYSPEGSLHT- 35 usage_00381.pdb 1 -RSMVEGQIEGGVTMGQGFVLMEEIEVNTKNGAIKN 35 usage_00949.pdb 1 --AIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHT- 33 usage_01020.pdb 1 --AIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHT- 33 usage_01281.pdb 1 --AIDIGQVEGAFVQGLGLFTLEELHYSPEGSLHT- 33 usage_01302.pdb 1 NPAIDIGQVEGAFVQGLGLFTMEELHYSPEGSLHT- 35 usage_01327.pdb 1 --AIDIGQVEGAFVQGLGLFTMEELHYSPEGSLHT- 33 aidiGQvEGafvqGlGlft EElhyspegslht #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################