################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:20 2021 # Report_file: c_1219_56.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01262.pdb # 2: usage_01263.pdb # 3: usage_01265.pdb # 4: usage_01266.pdb # 5: usage_01267.pdb # 6: usage_01269.pdb # 7: usage_01341.pdb # 8: usage_01342.pdb # 9: usage_01343.pdb # # Length: 49 # Identity: 27/ 49 ( 55.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 49 ( 55.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 49 ( 2.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01262.pdb 1 TFKIVPGLADP-SYISFQSYNFPTRYIRHYNYLLRLDEIVTELDRQDAT 48 usage_01263.pdb 1 TFKIVPGLADP-SYISFQSYNFPTRYIRHYNYLLRLDEIVTELDRQDAT 48 usage_01265.pdb 1 TFKIVPGLADP-SYISFQSYNFPTRYIRHYNYLLRLDEIVTELDRQDAT 48 usage_01266.pdb 1 TFKIVPGLADP-SYISFQSYNFPTRYIRHYNYLLRLDEIVTELDRQDAT 48 usage_01267.pdb 1 TFKIVPGLADP-SYISFQSYNFPTRYIRHYNYLLRLDEIVTELDRQDAT 48 usage_01269.pdb 1 TFKIVPGLADP-SYISFQSYNFPTRYIRHYNYLLRLDEIVTELDRQDAT 48 usage_01341.pdb 1 SFSRRAGLADSADGIAFESYNYPGRYLRHYENLLRIQPVSTALDRQDAT 49 usage_01342.pdb 1 SFSRRAGLADSADGIAFESYNYPGRYLRHYENLLRIQPVSTALDRQDAT 49 usage_01343.pdb 1 SFSRRAGLADSADGIAFESYNYPGRYLRHYENLLRIQPVSTALDRQDAT 49 F GLAD I F SYN P RY RHY LLR T LDRQDAT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################