################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:18:33 2021 # Report_file: c_0906_23.html ################################################################################################ #==================================== # Aligned_structures: 19 # 1: usage_00211.pdb # 2: usage_00212.pdb # 3: usage_00618.pdb # 4: usage_00640.pdb # 5: usage_00641.pdb # 6: usage_00701.pdb # 7: usage_00758.pdb # 8: usage_00761.pdb # 9: usage_00763.pdb # 10: usage_00790.pdb # 11: usage_00791.pdb # 12: usage_00860.pdb # 13: usage_00861.pdb # 14: usage_00868.pdb # 15: usage_00869.pdb # 16: usage_00871.pdb # 17: usage_00887.pdb # 18: usage_00888.pdb # 19: usage_00911.pdb # # Length: 42 # Identity: 1/ 42 ( 2.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 4/ 42 ( 9.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 42 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00211.pdb 1 MFMHGGHTNRVSDLSWNPNNKWVLASLADDNILQIWSPS--- 39 usage_00212.pdb 1 MFMHGGHTNRVSDLSWNPNNKWVLASLADDNILQIWSPS--- 39 usage_00618.pdb 1 LFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMA--- 39 usage_00640.pdb 1 LFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMA--- 39 usage_00641.pdb 1 LFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMA--- 39 usage_00701.pdb 1 LGLWSIHTAPATAAIFDPRDRTVAYSASQDHTVRTLDLT--- 39 usage_00758.pdb 1 LFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA--- 39 usage_00761.pdb 1 LFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA--- 39 usage_00763.pdb 1 LFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA--- 39 usage_00790.pdb 1 IMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHS- 41 usage_00791.pdb 1 IMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCS--- 39 usage_00860.pdb 1 LFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMA--- 39 usage_00861.pdb 1 LFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMA--- 39 usage_00868.pdb 1 LFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMA--- 39 usage_00869.pdb 1 LFIHGGHTAKISDFSWNPNEPWVICSVSEDNIQIWQ-----A 37 usage_00871.pdb 1 LFIHGGHTAKISDFSWNPNEPWVICSVSEDNIQIWQ-----A 37 usage_00887.pdb 1 LFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA--- 39 usage_00888.pdb 1 LFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE-- 40 usage_00911.pdb 1 KGNLAGHNGWVTAIATSSENPDMILTASRDKTVIAWQLT--- 39 gH p s #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################