################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:28:06 2021 # Report_file: c_1292_56.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00003.pdb # 2: usage_00430.pdb # 3: usage_00431.pdb # 4: usage_00432.pdb # 5: usage_00695.pdb # 6: usage_00741.pdb # 7: usage_00996.pdb # 8: usage_00997.pdb # 9: usage_00998.pdb # 10: usage_00999.pdb # 11: usage_01005.pdb # 12: usage_01071.pdb # 13: usage_01072.pdb # 14: usage_01158.pdb # 15: usage_01159.pdb # # Length: 30 # Identity: 2/ 30 ( 6.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 30 ( 73.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 30 ( 26.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_00430.pdb 1 SFLGRYMSALNH-TKKWKFPQVGGLTSIKW 29 usage_00431.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_00432.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_00695.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_00741.pdb 1 SFLGRYMSALNH-TKKWKFPQVGGLTSIK- 28 usage_00996.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_00997.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_00998.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_00999.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_01005.pdb 1 ----GRYFARFEE-SPTRKVTINGSVMK-- 23 usage_01071.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIK- 27 usage_01072.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIK- 27 usage_01158.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIKW 28 usage_01159.pdb 1 -FLGRYMSALNH-TKKWKFPQVGGLTSIK- 27 rymsAlnh kkwkfpqvgGltsi #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################