################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:40 2021 # Report_file: c_1046_37.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00017.pdb # 2: usage_00151.pdb # 3: usage_00187.pdb # 4: usage_00188.pdb # 5: usage_00250.pdb # 6: usage_00374.pdb # 7: usage_00375.pdb # 8: usage_00412.pdb # # Length: 68 # Identity: 34/ 68 ( 50.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 68 ( 50.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 68 ( 4.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00017.pdb 1 -VLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADL-GYPLPSNGDLTPWA 58 usage_00151.pdb 1 -VVILGQDPYHGPNQAHGLCFSVQRPVP-PPPSLENIYKELSTDIEDFVHPGHGDLSGWA 58 usage_00187.pdb 1 KVVILGQDPYHGPNQAHGLCFSVQRPVP-PPPSLENIYKELSTDIEDFVHPGHGDLSGWA 59 usage_00188.pdb 1 KVVILGQDPYHGPNQAHGLCFSVQRPVP-PPPSLENIYKELSTDIEDFVHPGHGDLSGWA 59 usage_00250.pdb 1 -VLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADL-GYPLPSNGDLTPWA 58 usage_00374.pdb 1 KVVILGQDPYHGPNQAHGLCFSVQRPVP-PPPSLENIYKELSTDIEDFVHPGHGDLSGWA 59 usage_00375.pdb 1 KVVILGQDPYHGPNQAHGLCFSVQRPVP-PPPSLENIYKELSTDIEDFVHPGHGDLSGWA 59 usage_00412.pdb 1 -VVILGQDPYHGPNQAHGLCFSVQKPVP-PPPSLVNIYKELCTDIDGFKHPGHGDLSGWA 58 V I GQDPY P A GL FSV V P SL NI E D P GDL WA usage_00017.pdb 59 QRGVLLLN 66 usage_00151.pdb 59 KQGVLLLN 66 usage_00187.pdb 60 KQGVLLLN 67 usage_00188.pdb 60 KQGVLLLN 67 usage_00250.pdb 59 QRGVLLLN 66 usage_00374.pdb 60 KQGVLLLN 67 usage_00375.pdb 60 KQGVLLLN 67 usage_00412.pdb 59 KQGVLLLN 66 GVLLLN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################