################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:01:47 2021 # Report_file: c_0701_73.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00022.pdb # 2: usage_00123.pdb # 3: usage_00124.pdb # 4: usage_00144.pdb # 5: usage_00150.pdb # 6: usage_01176.pdb # 7: usage_01313.pdb # 8: usage_01330.pdb # 9: usage_01335.pdb # 10: usage_01352.pdb # 11: usage_01536.pdb # 12: usage_01537.pdb # 13: usage_01538.pdb # # Length: 55 # Identity: 7/ 55 ( 12.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/ 55 ( 76.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 55 ( 16.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 SNCTFITKGAWEVIGIEALTSDYLYYISNEHKGMPGGRNLYRIQLNDYTKVTCLS 55 usage_00123.pdb 1 SNCTFITKGAWEVIGIEALTSDYLYYISNEHKGMPGGRNLYRIQLNDYTKVTCLS 55 usage_00124.pdb 1 SNCTFITKGAWEVIGIEALTSDYLYYISNEHKGMPGGRNLYRIQLNDYTKVTCLS 55 usage_00144.pdb 1 KDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLS 55 usage_00150.pdb 1 KDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLS 55 usage_01176.pdb 1 KDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLS 55 usage_01313.pdb 1 KDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLS 55 usage_01330.pdb 1 SNCTFITKGAWEVIGIEALTSDYLYYISNEHKGMPGGRNLYRIQLNDYTKVTCLS 55 usage_01335.pdb 1 -TGFKEL-AKGEFCN-INVTSQYVYFTD-F-----VSNKEYCTSTQNPDTIKALQ 46 usage_01352.pdb 1 SNCTFITKGAWEVIGIEALTSDYLYYISNEHKGMPGGRNLYRIQLNDYTKVTCLS 55 usage_01536.pdb 1 SNCTFITKGAWEVIGIEALTSDYLYYISNEHKGMPGGRNLYRIQLNDYTKVTCLS 55 usage_01537.pdb 1 SNCTFITKGAWEVIGIEALTSDYLYYISNEHKGMPGGRNLYRIQLNDYTKVTCLS 55 usage_01538.pdb 1 SNCTFITKGAWEVIGIEALTSDYLYYISNEHKGMPGGRNLYRIQLNDYTKVTCLS 55 ctfit g wEvig ealTSdYlYyis e ggrnlY iql dytkvtcLs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################