################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:56 2021 # Report_file: c_1261_337.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_01457.pdb # 2: usage_01458.pdb # 3: usage_01459.pdb # 4: usage_01460.pdb # 5: usage_01461.pdb # 6: usage_01462.pdb # 7: usage_01546.pdb # 8: usage_03765.pdb # # Length: 31 # Identity: 13/ 31 ( 41.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 31 ( 77.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 31 ( 6.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01457.pdb 1 -KVIELGGIGPGPHAGMVLADLGADVVRVR- 29 usage_01458.pdb 1 -KVIELGGIGPGPHAGMVLADLGADVVRVR- 29 usage_01459.pdb 1 -KVIELGGIGPGPHAGMVLADLGADVVRVR- 29 usage_01460.pdb 1 -KVIELGGIGPGPHAGMVLADLGADVVRVR- 29 usage_01461.pdb 1 -KVIELGGIGPGPHAGMVLADLGADVVRVR- 29 usage_01462.pdb 1 -KVIELGGIGPGPHAGMVLADLGADVVRVR- 29 usage_01546.pdb 1 LRVVELAGIGPGPHAAMILGDLGADVVRID- 30 usage_03765.pdb 1 LKVVELARILAGPWVGQTLCDLGADVIKVES 31 kV EL gIgpGPhagm L DLGADVvrv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################