################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:19 2021 # Report_file: c_0618_54.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00203.pdb # 2: usage_00211.pdb # 3: usage_00212.pdb # 4: usage_00253.pdb # 5: usage_00254.pdb # # Length: 76 # Identity: 13/ 76 ( 17.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 76 ( 31.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 76 ( 11.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00203.pdb 1 TGTEFTLLYLLAQHLGQVVSREHLSQEVLG--KRLTPFDHAIDMHISNLRRKLPDRKDGH 58 usage_00211.pdb 1 SPKEFDILALLIRQPGRVYSRQEIGQEIWQ--GRLPEGSNVVDVHMANLRAKLR--DLDG 56 usage_00212.pdb 1 SPKEFDILALLIRQPGRVYSRQEIGQEIWQ--GRLPEGSNVVDVHMANLRAKLR--DLDG 56 usage_00253.pdb 1 SPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQ--NTLNVNMTRLRKKIV--PIGF 56 usage_00254.pdb 1 SPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQ--NTLNVNMTRLRKKIV--PIGF 56 sp E iL L p V S w n v m LR K usage_00203.pdb 59 PWF-KTLRGRGYLM-- 71 usage_00211.pdb 57 YGLLRTVRGVGYALRG 72 usage_00212.pdb 57 YGLLRTVRGVGYALRG 72 usage_00253.pdb 57 DYI-HTVRGVGYLLQ- 70 usage_00254.pdb 57 DYI-HTVRGVGYLLQ- 70 TvRGvGY l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################