################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:12 2021 # Report_file: c_1104_71.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00007.pdb # 2: usage_00008.pdb # 3: usage_00420.pdb # 4: usage_00445.pdb # 5: usage_00484.pdb # 6: usage_00711.pdb # 7: usage_00854.pdb # # Length: 81 # Identity: 34/ 81 ( 42.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 81 ( 44.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 81 ( 23.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00007.pdb 1 ---EELARYCDSLLKK--------ELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVH 49 usage_00008.pdb 1 -SPEELARYCDSLLKKSSKNPEEAELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVH 59 usage_00420.pdb 1 KPAELIAKYVDSKLRAG-N--TDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLV 57 usage_00445.pdb 1 KSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVH 60 usage_00484.pdb 1 --PEELARYCDSLLKKSSKNPEEAELEDTLNQVMEKFKKIEDKDVFQKFYAKMLAKRLVH 58 usage_00711.pdb 1 ---EELARYCDSLLK----------LEDTLNQVMEKFKK--DKDVFQKFYAKMLAKRLVH 45 usage_00854.pdb 1 -PAELIAKHVDSKLRAGNKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLV 59 E A y DS L LE tL M F KDVF FY K LAKRL usage_00007.pdb 50 QNSASDDAEASMISKLK---- 66 usage_00008.pdb 60 QNSASDDAEASMISKLKQA-- 78 usage_00420.pdb 58 GKSASVDAEKSMLSKLKHECG 78 usage_00445.pdb 61 QNSASDDAEASMISKLKQACG 81 usage_00484.pdb 59 QNSASDDAEASMISKLKQA-- 77 usage_00711.pdb 46 QNSASDDAEASMISKLKQA-- 64 usage_00854.pdb 60 GKSASVDAEKSMLSKLKH--- 77 SAS DAE SM SKLK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################