################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:17 2021 # Report_file: c_1374_22.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00222.pdb # 2: usage_00556.pdb # 3: usage_00557.pdb # 4: usage_00567.pdb # 5: usage_00598.pdb # 6: usage_00599.pdb # 7: usage_00684.pdb # 8: usage_00854.pdb # 9: usage_00855.pdb # 10: usage_00861.pdb # # Length: 46 # Identity: 5/ 46 ( 10.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 46 ( 67.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 46 ( 28.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00222.pdb 1 -SETADACAEFARTTESG----VYSHGVNRF-PRF---IQQLENG- 36 usage_00556.pdb 1 -SEGLAEAKEFAGEFAKDTEGKIHPWAMQAK-MKDIVNSPEDYKRF 44 usage_00557.pdb 1 SSEGLAEAKEFAGEFAKDTEGKIHPWAMQAK-MKDIVNSPEDYKRF 45 usage_00567.pdb 1 SSEGLAEAKEFAGEFAKDTEGKIHPWAMQAK-MKDIVNSPEDYKRF 45 usage_00598.pdb 1 SSEGLAEAKEFAGEFAKDTEGKIHPWAMQAK-MKDIVNSPEDYKR- 44 usage_00599.pdb 1 SSEGLAEAKEFAGEFAKDTEGKIHPWAMQAK-MKDIVNSPEDYKR- 44 usage_00684.pdb 1 SSEGLAEAKEFAGEFAKDTEGKIHPWAMQAK-MKDIVNSPEDYKRF 45 usage_00854.pdb 1 SSEGLAEAKEFAGEFAKDTEGKIHPWAMQAK-MKDIVNSPEDYKR- 44 usage_00855.pdb 1 SSEGLAEAKEFAGEFAKDTEGKIHPWAMQAK-MKDIVNSPEDYKRF 45 usage_00861.pdb 1 SSEGLAEAKEFAGEFAKDTEGKIHPWAQ---AKKDIVNSPEDYKR- 42 SEglaeakEFAgefakd ihpwa kd spedykr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################