################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:09 2021 # Report_file: c_1437_41.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00015.pdb # 2: usage_00046.pdb # 3: usage_00239.pdb # 4: usage_00240.pdb # 5: usage_00336.pdb # 6: usage_00382.pdb # 7: usage_00383.pdb # 8: usage_00483.pdb # 9: usage_00484.pdb # 10: usage_00496.pdb # 11: usage_00757.pdb # 12: usage_00911.pdb # # Length: 41 # Identity: 29/ 41 ( 70.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 41 ( 90.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 41 ( 9.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 -FGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 40 usage_00046.pdb 1 --GLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 39 usage_00239.pdb 1 -FGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWV-- 38 usage_00240.pdb 1 --GLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 39 usage_00336.pdb 1 --GLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 39 usage_00382.pdb 1 -FGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 40 usage_00383.pdb 1 --GLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 39 usage_00483.pdb 1 --GLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 39 usage_00484.pdb 1 PFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 41 usage_00496.pdb 1 --GLIKSDLLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 39 usage_00757.pdb 1 -FGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKS 40 usage_00911.pdb 1 -FGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKS 40 GLIKSeLLWFLhGDTNIRfLLqhrNHIWDEWAFEkwV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################