################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:06 2021 # Report_file: c_1199_85.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00003.pdb # 2: usage_00004.pdb # 3: usage_01840.pdb # 4: usage_01841.pdb # 5: usage_01842.pdb # 6: usage_01843.pdb # 7: usage_01844.pdb # 8: usage_01845.pdb # 9: usage_01846.pdb # 10: usage_01849.pdb # 11: usage_01850.pdb # 12: usage_02264.pdb # 13: usage_02265.pdb # # Length: 41 # Identity: 20/ 41 ( 48.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 41 ( 48.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 41 ( 7.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 --RLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGG- 38 usage_00004.pdb 1 --RLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGG- 38 usage_01840.pdb 1 DLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGW 41 usage_01841.pdb 1 DLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGW 41 usage_01842.pdb 1 DLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGW 41 usage_01843.pdb 1 DLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGW 41 usage_01844.pdb 1 DLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGW 41 usage_01845.pdb 1 DLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGW 41 usage_01846.pdb 1 --RLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGW 39 usage_01849.pdb 1 --KRANLANTSITCNDGSHAGFYLRKHPSSKKWIVLLEGG- 38 usage_01850.pdb 1 --KRANLANTSITCNDGSHAGFYLRKHPSSKKWIVLLEGG- 38 usage_02264.pdb 1 DLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGW 41 usage_02265.pdb 1 SLKRANLANTSITCNDGSHAGFYLRKHPSSKKWIVLLEGG- 40 L NTS TCNDGS AG YL S W LEGG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################