################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:34:07 2021 # Report_file: c_1382_4.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00412.pdb # 2: usage_00413.pdb # 3: usage_00415.pdb # 4: usage_00420.pdb # 5: usage_00484.pdb # 6: usage_00602.pdb # 7: usage_00684.pdb # 8: usage_00913.pdb # 9: usage_01608.pdb # 10: usage_01609.pdb # 11: usage_01610.pdb # # Length: 84 # Identity: 19/ 84 ( 22.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 84 ( 47.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 44/ 84 ( 52.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00412.pdb 1 ------------------------------------IPLAVEKLLDFDNTLKKNLLNYID 24 usage_00413.pdb 1 --NDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYID 58 usage_00415.pdb 1 -FNDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYID 59 usage_00420.pdb 1 DFNDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYID 60 usage_00484.pdb 1 NIDDLSSKLNESINKAMININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIY 60 usage_00602.pdb 1 DFNDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYID 60 usage_00684.pdb 1 -FNDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYID 59 usage_00913.pdb 1 ------------------------------------------KLLDFDNTLKKNLLNYID 18 usage_01608.pdb 1 -FNDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYID 59 usage_01609.pdb 1 ------------------------------------IPLAVEKLLDFDNTLKKNLLNYID 24 usage_01610.pdb 1 ------------------------------------IPLAVEKLLDFDNTLKKNLLNYID 24 kLlDFDntLKknLLnYId usage_00412.pdb 25 ENKLYLIGSAEYEKSKVNKYLKTI 48 usage_00413.pdb 59 ENKLYLIGSAEYEKSKVNKYLKTI 82 usage_00415.pdb 60 ENKLYLIGSAEYEKSKVNKYLKTI 83 usage_00420.pdb 61 ENKLYLIGSAEYEKSKVNKYLK-- 82 usage_00484.pdb 61 DNRGTLIGQVDRLKDKVNNTLSTD 84 usage_00602.pdb 61 ENKLYLIGSAEYEKSKVNKYLKT- 83 usage_00684.pdb 60 ENKLYLIGSAEYEKSKVNKYLKTI 83 usage_00913.pdb 19 ENKLYLIGSAEYEKSKVNKYLKTI 42 usage_01608.pdb 60 ENKLYLIGSAEYEKSKVNKYLKT- 82 usage_01609.pdb 25 ENKLYLIGSAEYEKSKVNKYLKTI 48 usage_01610.pdb 25 ENKLYLIGSAEYEKSKVNKYLKTI 48 eNklyLIGsaeyeKsKVNkyLk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################