################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:41 2021 # Report_file: c_1452_53.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00120.pdb # 2: usage_00938.pdb # 3: usage_01240.pdb # 4: usage_01412.pdb # 5: usage_01414.pdb # 6: usage_01803.pdb # 7: usage_01857.pdb # 8: usage_02922.pdb # 9: usage_03576.pdb # 10: usage_03577.pdb # 11: usage_03600.pdb # 12: usage_05524.pdb # # Length: 32 # Identity: 9/ 32 ( 28.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 32 ( 71.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 32 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00120.pdb 1 GGINTEENYPYTAQDGECNVDLQNEKYVTID- 31 usage_00938.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 usage_01240.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 usage_01412.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 usage_01414.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 usage_01803.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 usage_01857.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 usage_02922.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 usage_03576.pdb 1 GGIEADASYPYKAMDEKCHYNSKNRAA-TCSR 31 usage_03577.pdb 1 GGIEADASYPYKAMDEKCHYNSKNRAA-TCSR 31 usage_03600.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 usage_05524.pdb 1 KGIDSDASYPYKAMDQKCQYDSKYRAA-TCSK 31 GI dasYPYkAmD kC y sk raa Tcs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################