################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:56 2021 # Report_file: c_1459_92.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00201.pdb # 2: usage_00221.pdb # 3: usage_00300.pdb # 4: usage_00375.pdb # 5: usage_00501.pdb # 6: usage_01330.pdb # 7: usage_01375.pdb # 8: usage_01558.pdb # 9: usage_02075.pdb # 10: usage_02264.pdb # # Length: 39 # Identity: 9/ 39 ( 23.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 39 ( 33.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 39 ( 20.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00201.pdb 1 GLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLY- 38 usage_00221.pdb 1 GLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLY- 38 usage_00300.pdb 1 --SHSTDIGALMYPSYTFSGD--VQLAQDDIDGIQAIY- 34 usage_00375.pdb 1 GIEHSNVSSALMYPYYTGI-K--RQLDNDDCLAVWDLY- 35 usage_00501.pdb 1 GLEHSQDPGALMAPIYTYTKN--FRLSQDDIKGIQELY- 36 usage_01330.pdb 1 GLGHSSDPKAVMFPTYAYVDINTFRLSADDIRGIQSLY- 38 usage_01375.pdb 1 GLGHSSDPKAVMFPTYAYVDINTFRLSADDIRGIQSLY- 38 usage_01558.pdb 1 GLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG 39 usage_02075.pdb 1 GLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIY- 38 usage_02264.pdb 1 --DHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQS--- 34 HS d A M P Y L DD giq #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################