################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:09:42 2021
# Report_file: c_1250_64.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00133.pdb
#   2: usage_00134.pdb
#   3: usage_00423.pdb
#   4: usage_00424.pdb
#   5: usage_00425.pdb
#   6: usage_00777.pdb
#   7: usage_00778.pdb
#   8: usage_01246.pdb
#   9: usage_01520.pdb
#  10: usage_01571.pdb
#
# Length:         36
# Identity:        4/ 36 ( 11.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      8/ 36 ( 22.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            6/ 36 ( 16.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00133.pdb         1  EVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVE   36
usage_00134.pdb         1  -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE   31
usage_00423.pdb         1  -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE   31
usage_00424.pdb         1  -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE   31
usage_00425.pdb         1  -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE   31
usage_00777.pdb         1  -----KIAIFGTVGAGKSTISAEISKKLGYEIFKE-   30
usage_00778.pdb         1  -----KIAIFGTVGAGKSTISAEISKKLGYEIFKE-   30
usage_01246.pdb         1  -----HVLLVGDPGVAKSQILRYVANLAPRAIYTS-   30
usage_01520.pdb         1  -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE   31
usage_01571.pdb         1  -----NILMIGPTGVGKTEIARRLAKLANAPFIKVE   31
                                 i   G  G gK  I     k       k  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################