################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:30:32 2021
# Report_file: c_1032_22.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00127.pdb
#   2: usage_00281.pdb
#   3: usage_00282.pdb
#   4: usage_00455.pdb
#   5: usage_00464.pdb
#   6: usage_00609.pdb
#
# Length:         77
# Identity:        5/ 77 (  6.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     21/ 77 ( 27.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           22/ 77 ( 28.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00127.pdb         1  G-RHFIAVCQMT-SDN--------------DLEKNFQAAKNMIERAGEKKCEMVFLPECF   44
usage_00281.pdb         1  --VKVAYVQMN-PQIL--------------EPDKNYSKAEKLIKEASKQGAQLVVLPELF   43
usage_00282.pdb         1  --VKVAYVQMN-PQIL--------------EPDKNYSKAEKLIKEASKQGAQLVVLPELF   43
usage_00455.pdb         1  --VKVAYVQMN-PQIL--------------EPDKNYSKAEKLIKEASKQGAQLVVLPELF   43
usage_00464.pdb         1  --VKVAYVQMN-PQIL--------------EPDKNYSKAEKLIKEASKQGAQLVVLPELF   43
usage_00609.pdb         1  DTFIAAVYEHA-AILPNATLTPVSREEALALMNRNLDILEGAITSAADQGAHIIVTPEDA   59
                                a v                         kN   ae  I  A  qga  vvlPE f

usage_00127.pdb        45  DFI--GL-NKNEQIDLA   58
usage_00281.pdb        44  DTGYNFETREEVFEIA-   59
usage_00282.pdb        44  DTGYNFETREEVFEIA-   59
usage_00455.pdb        44  DTGYNFETREEVFEIA-   59
usage_00464.pdb        44  DTGYNFETREEVFEIA-   59
usage_00609.pdb        60  IYGWNFN-RDSLYPYL-   74
                           d g  f  r        


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################