################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:11:49 2021 # Report_file: c_0404_7.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00120.pdb # 2: usage_00121.pdb # 3: usage_00139.pdb # 4: usage_00180.pdb # 5: usage_00214.pdb # # Length: 110 # Identity: 23/110 ( 20.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/110 ( 57.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/110 ( 16.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00120.pdb 1 ----SVFIFPPK-PKD-TLL---ITVTPKVTCVVVDISKDDPEVQFSWFVDNVEVH-TAQ 50 usage_00121.pdb 1 ----SVFIFPPK-PKD-TLL---ITVTPKVTCVVVDISKDDPEVQFSWFVDNVEVH-TAQ 50 usage_00139.pdb 1 ----SVFLFPPK-PKD-TLM---ISRTPEVTCVVVDVSDEDGEVKFNWYVDGVEVH-NAK 50 usage_00180.pdb 1 QTDISVSLLKPP-FE-EI-WTQQ--T-ATIVCEIV-YS-DLENIKVFWQVNGVERKK-GV 51 usage_00214.pdb 1 ----SVFLFPPKPKD--TLM---ISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH-NAK 50 SVf fpPk t p vtCvvV S d ev f W Vd VEvh a usage_00120.pdb 51 TQPREEQFNSTFRVVSALPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISK 100 usage_00121.pdb 51 TQPREEQFNSTFRVVSALPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISK 100 usage_00139.pdb 51 TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPRPIEKTISK 100 usage_00180.pdb 52 ETQNPEWSGSKSTIVSKLKVMASEWDSGTEYVCLVEDSELPTPVKASIRK 101 usage_00214.pdb 51 TKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISK 100 t preEq nSt rvVS L hqdWlnGkE kC V P piektIsK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################