################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:38 2021 # Report_file: c_0895_13.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00055.pdb # 2: usage_00070.pdb # 3: usage_00074.pdb # 4: usage_00075.pdb # 5: usage_00076.pdb # 6: usage_00077.pdb # 7: usage_00078.pdb # # Length: 66 # Identity: 4/ 66 ( 6.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 66 ( 33.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 66 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00055.pdb 1 -FNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKV-VSVLHHLSIKRAI-Q 57 usage_00070.pdb 1 DPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKL-RVPILSKLSQEINK 59 usage_00074.pdb 1 SKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGV-TRVGHRENIERAL-R 58 usage_00075.pdb 1 SKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGV-TRVGHRENIERAL-R 58 usage_00076.pdb 1 --FDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGV-TRVGHRENIERAL-R 56 usage_00077.pdb 1 SKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGV-TRVGHRENIERAL-R 58 usage_00078.pdb 1 -KFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGV-TRVGHRENIERAL-R 57 v dwl i l f i Ga l lT D l v rV h i ra usage_00055.pdb 58 VLRINN 63 usage_00070.pdb 60 -N---- 60 usage_00074.pdb 59 QL---- 60 usage_00075.pdb 59 QL---- 60 usage_00076.pdb ------ usage_00077.pdb 59 Q----- 59 usage_00078.pdb 58 QL---- 59 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################