################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:16:06 2021 # Report_file: c_1006_51.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00325.pdb # 2: usage_00333.pdb # 3: usage_00334.pdb # 4: usage_00335.pdb # 5: usage_00336.pdb # 6: usage_00338.pdb # 7: usage_00339.pdb # 8: usage_00549.pdb # 9: usage_00551.pdb # 10: usage_00553.pdb # 11: usage_00601.pdb # 12: usage_00614.pdb # 13: usage_00665.pdb # 14: usage_00667.pdb # # Length: 57 # Identity: 11/ 57 ( 19.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 57 ( 78.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 57 ( 10.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00325.pdb 1 -WYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSV-KGKVVIDAFRLID- 54 usage_00333.pdb 1 -WYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSV-KGKVVIDAFRL--- 52 usage_00334.pdb 1 -WYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSV-KGKVVIDAFRL--- 52 usage_00335.pdb 1 -WYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSV-KGKVVIDAFRL--- 52 usage_00336.pdb 1 -WYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSV-KGKVVIDAFRL--- 52 usage_00338.pdb 1 -WYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSV-KGKVVIDAFRL--- 52 usage_00339.pdb 1 -WYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSV-KGKVVIDAFRLID- 54 usage_00549.pdb 1 GWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSV-KGKVVIDAFRL--- 53 usage_00551.pdb 1 -WYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSV-KGKVVIDAFRL--- 52 usage_00553.pdb 1 GWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSV-KGKVVIDAFRL--- 53 usage_00601.pdb 1 -GWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKT-AQGSLSLKAYRLTPK 55 usage_00614.pdb 1 -WYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSV-KGKVVIDAFRLID- 54 usage_00665.pdb 1 GWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSV-KGKVVIDAFRL--- 53 usage_00667.pdb 1 GWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSV-KGKVVIDAFRL--- 53 wyhshpgfGcwls vd ntQ Sfe l raVavvvDPIqs kGkvvidAfRL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################