################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:13:08 2021 # Report_file: c_1429_158.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00585.pdb # 2: usage_00587.pdb # 3: usage_00667.pdb # 4: usage_00825.pdb # 5: usage_00870.pdb # 6: usage_01640.pdb # 7: usage_01641.pdb # 8: usage_01674.pdb # 9: usage_01675.pdb # # Length: 43 # Identity: 2/ 43 ( 4.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 4/ 43 ( 9.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 43 ( 20.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00585.pdb 1 ----EDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHI 39 usage_00587.pdb 1 ----EDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSH- 38 usage_00667.pdb 1 GSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTG- 42 usage_00825.pdb 1 ---DQSSVDTLLSFGFAEDVARKALKASGGDIEKATDWVFNNS 40 usage_00870.pdb 1 ---PEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHP 40 usage_01640.pdb 1 ----EDDIELVNQTGASREDATRALQETGGDLAEAIRL----- 34 usage_01641.pdb 1 ----EDDIELVNQTGASREDATRALQETGGDLAEAIRL----- 34 usage_01674.pdb 1 SPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHS 43 usage_01675.pdb 1 ---DEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLLTSN 40 G Al a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################