################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:23 2021 # Report_file: c_1115_56.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00242.pdb # 2: usage_00510.pdb # 3: usage_00511.pdb # 4: usage_00512.pdb # 5: usage_00515.pdb # 6: usage_00825.pdb # 7: usage_01697.pdb # # Length: 66 # Identity: 6/ 66 ( 9.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 66 ( 13.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 66 ( 18.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00242.pdb 1 --AGDD-A-AQRL-RIAPRSRQAFLLTALEGFTPTEAAQILDCDFGEVERLIGDAQAEID 55 usage_00510.pdb 1 --DSVT-R-NELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLK 56 usage_00511.pdb 1 --DSVT-R-NELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLK 56 usage_00512.pdb 1 --DSVT-R-NELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLK 56 usage_00515.pdb 1 --DSVT-R-NELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQRLK 56 usage_00825.pdb 1 E-AVARAR-LA---RMTPLSRQALLLTAMEGFSPEDAAYLIEVDTSEVETLVTEALAEIE 55 usage_01697.pdb 1 -RLELA-RVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLS 58 r R L G s e A V A usage_00242.pdb 56 AE---- 57 usage_00510.pdb 57 DEIV-- 60 usage_00511.pdb 57 DEIVA- 61 usage_00512.pdb 57 DEIVAA 62 usage_00515.pdb 57 DEIVA- 61 usage_00825.pdb 56 K----- 56 usage_01697.pdb 59 ALLDAD 64 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################