################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:56 2021 # Report_file: c_1214_53.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00171.pdb # 2: usage_00209.pdb # 3: usage_00212.pdb # 4: usage_00213.pdb # 5: usage_00289.pdb # 6: usage_00297.pdb # 7: usage_00306.pdb # 8: usage_00307.pdb # 9: usage_00315.pdb # # Length: 31 # Identity: 5/ 31 ( 16.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 31 ( 54.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 31 ( 12.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00171.pdb 1 EELISCADCGNSGHPSCLKFSPELTVRVKAL 31 usage_00209.pdb 1 EELISCADCGNSGHPSCLKFSPELTVRVKAL 31 usage_00212.pdb 1 EELISCADCGNSGHPSCLKFSPELTVRVKAL 31 usage_00213.pdb 1 EELISCADCGNSGHPSCLKFSPELTVRVKAL 31 usage_00289.pdb 1 EELVSCSDCGRSGHPSCLQFTPVMMAAVKTY 31 usage_00297.pdb 1 -QLVECQECHNLYHQDCHKPQV--TDKEVND 28 usage_00306.pdb 1 EELVSCADCGRSGHPTCLQFTLNMTEAVKT- 30 usage_00307.pdb 1 EELVSCADCGRSGHPTCLQFTLNMTEAVKTY 31 usage_00315.pdb 1 EELISCADCGNSGHPSCLKFSPELTVRVKAL 31 eL sC dCg sgHp Cl f t vk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################