################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:41:50 2021 # Report_file: c_1369_77.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00238.pdb # 2: usage_00239.pdb # 3: usage_00240.pdb # 4: usage_00241.pdb # 5: usage_00242.pdb # 6: usage_00243.pdb # 7: usage_00244.pdb # 8: usage_00245.pdb # 9: usage_01144.pdb # 10: usage_01145.pdb # 11: usage_01146.pdb # 12: usage_01147.pdb # 13: usage_01211.pdb # 14: usage_01212.pdb # 15: usage_01213.pdb # 16: usage_01214.pdb # # Length: 51 # Identity: 47/ 51 ( 92.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 51 ( 92.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 51 ( 7.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00238.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_00239.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_00240.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_00241.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFT 51 usage_00242.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_00243.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_00244.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_00245.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_01144.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_01145.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_01146.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_01147.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA---- 47 usage_01211.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQF- 50 usage_01212.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQ-- 49 usage_01213.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQF- 50 usage_01214.pdb 1 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQF- 50 DQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################