################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:35 2021 # Report_file: c_0888_80.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00061.pdb # 2: usage_00118.pdb # 3: usage_00129.pdb # 4: usage_00131.pdb # 5: usage_00330.pdb # 6: usage_00515.pdb # 7: usage_00653.pdb # # Length: 72 # Identity: 19/ 72 ( 26.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 72 ( 31.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 72 ( 12.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00061.pdb 1 -VPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIR 59 usage_00118.pdb 1 -VPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIR 59 usage_00129.pdb 1 -VPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT 59 usage_00131.pdb 1 -VPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT 59 usage_00330.pdb 1 AVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMT 60 usage_00515.pdb 1 AVPIFVKLLGSSSDDVREQAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSML 60 usage_00653.pdb 1 -------LLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFL 53 LL V EQA WALGN aGDs RDyVl P L usage_00061.pdb 60 TATWTLSNL-C- 69 usage_00118.pdb 60 TATWTLSNL-C- 69 usage_00129.pdb 60 RNAVWALSNLC- 70 usage_00131.pdb 60 RNAVWALSNLCR 71 usage_00330.pdb 61 RNAVWALSNLCR 72 usage_00515.pdb 61 RNATWTLSNFCR 72 usage_00653.pdb 54 RNVTWVMVNLCR 65 C #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################