################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:58:54 2021 # Report_file: c_0995_8.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00049.pdb # 2: usage_00053.pdb # 3: usage_00190.pdb # 4: usage_00191.pdb # 5: usage_00202.pdb # 6: usage_00204.pdb # 7: usage_00262.pdb # 8: usage_00269.pdb # 9: usage_00291.pdb # 10: usage_00316.pdb # 11: usage_00317.pdb # 12: usage_00377.pdb # 13: usage_00394.pdb # # Length: 49 # Identity: 7/ 49 ( 14.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 49 ( 55.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 49 ( 10.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00049.pdb 1 -PKVLVSYKGENKAFYPEEISSMVLT-KLKETAEAFLGHPVTNAVITVP 47 usage_00053.pdb 1 -PVIEVQYLEETKTFSPQEISAMVLT-KMKEIAEAKIGKKVEKAVITVP 47 usage_00190.pdb 1 -PKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 47 usage_00191.pdb 1 -PKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 47 usage_00202.pdb 1 KPKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 48 usage_00204.pdb 1 -PKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 47 usage_00262.pdb 1 KPKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 48 usage_00269.pdb 1 KPKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 48 usage_00291.pdb 1 -TGAEVRFAGEKHVFSATQLAAMFID-KVKDTVKQDTKANITDVCIAVP 47 usage_00316.pdb 1 KPKVQVSYKGETKAFYPEEISSV---LTKKEIAEAYLGYPVTNAVITVP 46 usage_00317.pdb 1 -PKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 47 usage_00377.pdb 1 KPKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 48 usage_00394.pdb 1 -PKVQVSYKGETKAFYPEEISSMVLT-KMKEIAEAYLGYPVTNAVITVP 47 p V y gE k F p eis m k Ke aea g vt avItVP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################