################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:03 2021 # Report_file: c_1302_76.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00023.pdb # 2: usage_00049.pdb # 3: usage_00143.pdb # 4: usage_00154.pdb # 5: usage_00156.pdb # 6: usage_00157.pdb # 7: usage_00158.pdb # 8: usage_01265.pdb # 9: usage_01268.pdb # 10: usage_01270.pdb # # Length: 32 # Identity: 4/ 32 ( 12.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 32 ( 46.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 32 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 KVYDVIKMLAEKNISAVPIVNSEGTLLNVYES 32 usage_00049.pdb 1 --PDLVRDLIATAADISLLVSQEGVVREVMAN 30 usage_00143.pdb 1 -VIDVIQMLTQGRVSSVPIIDENGYLINVYEA 31 usage_00154.pdb 1 -VYDVIKMLAEKNISAVPIVNSEGTLLNVYES 31 usage_00156.pdb 1 -VYDVIKMLAEKNISAVPIVNSEGTLLNVYES 31 usage_00157.pdb 1 -VYDVIKMLAEKNISAVPIVNSEGTLLNVYES 31 usage_00158.pdb 1 -VYDVIKMLAEKNISAVPIVNSEGTLLNVYES 31 usage_01265.pdb 1 -VIDVIQMLTQGRVSSVPIIDENGYLINVYEA 31 usage_01268.pdb 1 -VYDVIKMLAEKNISAVPIVNSEGTLLNVYES 31 usage_01270.pdb 1 -VYDVIKMLAEKNISAVPIVNSEGTLLNVYES 31 Dvi mL s vpi G l nVye #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################