################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:18:52 2021 # Report_file: c_1395_19.html ################################################################################################ #==================================== # Aligned_structures: 19 # 1: usage_00017.pdb # 2: usage_00178.pdb # 3: usage_00209.pdb # 4: usage_00277.pdb # 5: usage_00278.pdb # 6: usage_00279.pdb # 7: usage_00281.pdb # 8: usage_00282.pdb # 9: usage_00333.pdb # 10: usage_00363.pdb # 11: usage_00382.pdb # 12: usage_00942.pdb # 13: usage_00984.pdb # 14: usage_00985.pdb # 15: usage_01193.pdb # 16: usage_01368.pdb # 17: usage_01471.pdb # 18: usage_01472.pdb # 19: usage_01523.pdb # # Length: 33 # Identity: 13/ 33 ( 39.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 33 ( 39.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 33 ( 6.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00017.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00178.pdb 1 --GTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 31 usage_00209.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00277.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00278.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00279.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00281.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00282.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00333.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00363.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00382.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00942.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_00984.pdb 1 --GTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 31 usage_00985.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_01193.pdb 1 DQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 33 usage_01368.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 usage_01471.pdb 1 --GISDIIERLLSETCPRYLLGVLDAGKAELQR 31 usage_01472.pdb 1 --GISDIIERLLSETCPRYLLGVLDAGKAELQR 31 usage_01523.pdb 1 -QGTSATVQMLLNDTCPLFVRGLLEAGKSDLEK 32 G S LL TCP G L AGK L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################