################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:54 2021 # Report_file: c_1116_6.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00189.pdb # 2: usage_00613.pdb # 3: usage_00614.pdb # 4: usage_00615.pdb # 5: usage_00616.pdb # 6: usage_01133.pdb # 7: usage_01134.pdb # # Length: 71 # Identity: 68/ 71 ( 95.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 68/ 71 ( 95.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 71 ( 4.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00189.pdb 1 -RSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPP 59 usage_00613.pdb 1 DRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPP 60 usage_00614.pdb 1 DRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPP 60 usage_00615.pdb 1 -RSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPP 59 usage_00616.pdb 1 -RSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPP 59 usage_01133.pdb 1 -RSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPP 59 usage_01134.pdb 1 DRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPP 60 RSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPP usage_00189.pdb 60 SALLMKFDA-- 68 usage_00613.pdb 61 SALLMKFDA-- 69 usage_00614.pdb 61 SALLMKFDA-- 69 usage_00615.pdb 60 SALLMKFDAGS 70 usage_00616.pdb 60 SALLMKFDAGS 70 usage_01133.pdb 60 SALLMKFDAGS 70 usage_01134.pdb 61 SALLMKFDAGS 71 SALLMKFDA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################