################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:24 2021 # Report_file: c_1487_304.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00554.pdb # 2: usage_02035.pdb # 3: usage_02194.pdb # 4: usage_02195.pdb # 5: usage_02196.pdb # 6: usage_03323.pdb # 7: usage_03324.pdb # 8: usage_04009.pdb # 9: usage_04010.pdb # # Length: 34 # Identity: 28/ 34 ( 82.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 34 ( 94.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 34 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00554.pdb 1 GKERMYEENSQPRRNLTKLSLIFSHMLAELKGI- 33 usage_02035.pdb 1 GKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIF 34 usage_02194.pdb 1 GKERMYEENSQPRRNLTKLSLIFSHMLAELKGIF 34 usage_02195.pdb 1 GKERMYEENSQPRRNLTKLSLIFSHMLAELKG-- 32 usage_02196.pdb 1 GKERMYEENSQPRRNLTKLSLIFSHMLAELKGI- 33 usage_03323.pdb 1 GKERMYEENSQPRRNLTKLSLIFSHMLAELKGI- 33 usage_03324.pdb 1 GKERMYEENSQPRRNLTKLSLIFSHMLAELKGIF 34 usage_04009.pdb 1 GKERMYEENSQPRRNLTKLSLIFSHMLAELKGIF 34 usage_04010.pdb 1 GKERMYEENSQPRRNLTKLSLIFSHMLAELKGI- 33 GKERMYEEnSQpRRNLTKLSLIFSHMLAElKg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################