################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:18 2021 # Report_file: c_0659_1.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00042.pdb # 2: usage_00135.pdb # 3: usage_00155.pdb # 4: usage_00190.pdb # 5: usage_00406.pdb # 6: usage_00463.pdb # 7: usage_00464.pdb # 8: usage_00493.pdb # # Length: 78 # Identity: 8/ 78 ( 10.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 78 ( 25.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 78 ( 21.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 AGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPT---EAGMAPAVV 57 usage_00135.pdb 1 PSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTG--LQP 58 usage_00155.pdb 1 PSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTG--LQP 58 usage_00190.pdb 1 PSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTG--LQP 58 usage_00406.pdb 1 PSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTG--LQP 58 usage_00463.pdb 1 ATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDPQAPVDSHG--LRP 58 usage_00464.pdb 1 ATLTQTLLIQNGAREDCREMKIYLRNE------LSPIHIALNFSLDPQAPVDSHG--LRP 52 usage_00493.pdb 1 PSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTG--LQP 58 i g C e yLR E L PI i Ld d g l p usage_00042.pdb 58 L---HGDTHVQEQTR--- 69 usage_00135.pdb 59 ILNQFTPANISRQAH--- 73 usage_00155.pdb 59 ILNQFTPANISRQAHIL- 75 usage_00190.pdb 59 ILNQFTPANISRQAHIL- 75 usage_00406.pdb 59 ILNQFTPANISRQAHIL- 75 usage_00463.pdb 59 ALHYQSKSRIEDKAQIL- 75 usage_00464.pdb 53 ALHYQSKSRIEDKAQI-- 68 usage_00493.pdb 59 ILNQFTPANISRQAHILL 76 i a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################