################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:00 2021 # Report_file: c_0841_26.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00012.pdb # 2: usage_00013.pdb # 3: usage_00014.pdb # 4: usage_00022.pdb # 5: usage_00024.pdb # 6: usage_00065.pdb # 7: usage_00224.pdb # 8: usage_00225.pdb # # Length: 72 # Identity: 6/ 72 ( 8.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 72 ( 18.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 72 ( 9.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 SQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSW 60 usage_00013.pdb 1 SQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSW 60 usage_00014.pdb 1 SQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSW 60 usage_00022.pdb 1 SKKFEEVYKTASDNLKTLLELPSNYEVLFLA-SATEIWERIIQNCVE--KKSFHCVNGSF 57 usage_00024.pdb 1 SDDYVAIASKAEQDLRDLLDIPSDYKVLFLQGGASQQFAEIPLNLLPEDGVADYIDTGIW 60 usage_00065.pdb 1 QAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLID--KRSLHLTYGEF 58 usage_00224.pdb 1 -KHWMEEQKEATERLRTLLQVPENFNILFVAGGASLQFSAIPFNFIGEHKAVDYLCTGTW 59 usage_00225.pdb 1 GKHWMEEQKEATERLRTLLQVPENFNILFVAGGASLQFSAIPFNFIGEHKAVDYLCTGTW 60 a L Ll P lf gA n G usage_00012.pdb 61 SEKALKEAKLLG 72 usage_00013.pdb 61 SEKALKEAKLLG 72 usage_00014.pdb 61 SEKALKEAK--- 69 usage_00022.pdb 58 SKRFYEFAGELG 69 usage_00024.pdb 61 SKKAIEEARRYG 72 usage_00065.pdb 59 SAKFASAVSKN- 69 usage_00224.pdb 60 SKKAFDECKRLA 71 usage_00225.pdb 61 SKKAFDECKRLA 72 S k #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################