################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:56 2021 # Report_file: c_1226_46.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00010.pdb # 2: usage_00239.pdb # 3: usage_00530.pdb # 4: usage_00833.pdb # 5: usage_00834.pdb # 6: usage_00943.pdb # 7: usage_00949.pdb # 8: usage_01236.pdb # 9: usage_01464.pdb # # Length: 32 # Identity: 1/ 32 ( 3.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 32 ( 15.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 32 ( 37.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 ----ALLTADGH---SG-EVLQMSLNAATFLG 24 usage_00239.pdb 1 ----ALLTADGH---SG-EVLQMSLNAATFLG 24 usage_00530.pdb 1 DVS-QDEPEVHAAEGFEGELHAFSLFKYLSRS 31 usage_00833.pdb 1 ----CMIAVDES---SF-RIIGYSENAREMLG 24 usage_00834.pdb 1 ----CMIAVDES---SF-RIIGYSENAREMLG 24 usage_00943.pdb 1 ---GALLTADGH---SG-EVLQMSLNAATFLG 25 usage_00949.pdb 1 ----ALLTADGH---SG-EVLQMSLNAA---- 20 usage_01236.pdb 1 ----ALLTADGH---SG-EVLQMSLNAATFLG 24 usage_01464.pdb 1 ---GALLTADGH---SG-EVLQMSLNAATFLG 25 d s S na #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################