################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:06 2021 # Report_file: c_1483_14.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_01196.pdb # 2: usage_01268.pdb # 3: usage_01660.pdb # 4: usage_01661.pdb # 5: usage_02006.pdb # 6: usage_02025.pdb # 7: usage_02227.pdb # 8: usage_02540.pdb # # Length: 34 # Identity: 7/ 34 ( 20.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 34 ( 58.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 34 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01196.pdb 1 SPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLH 34 usage_01268.pdb 1 SPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLH 34 usage_01660.pdb 1 SPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLH 34 usage_01661.pdb 1 SPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLH 34 usage_02006.pdb 1 -TPMLWALGFLFLFTVGGVTGIVLSQASVDRYYH 33 usage_02025.pdb 1 -TPMLWALGFLFLFTVGGVTGIVLSQASVDRYYH 33 usage_02227.pdb 1 NPAFVAPVLGLLGFIPGGAGGIVNASFTLDYVV- 33 usage_02540.pdb 1 -PAMMWALGFIFLFTVGGLTGIVLANSSLDIVLH 33 m walgf flFtvGG tGIVl s D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################