################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:18:00 2021
# Report_file: c_1298_28.html
################################################################################################
#====================================
# Aligned_structures: 18
#   1: usage_00047.pdb
#   2: usage_00311.pdb
#   3: usage_00495.pdb
#   4: usage_00496.pdb
#   5: usage_00528.pdb
#   6: usage_00529.pdb
#   7: usage_00530.pdb
#   8: usage_00602.pdb
#   9: usage_00704.pdb
#  10: usage_00735.pdb
#  11: usage_01520.pdb
#  12: usage_01521.pdb
#  13: usage_01655.pdb
#  14: usage_01656.pdb
#  15: usage_01664.pdb
#  16: usage_01770.pdb
#  17: usage_01886.pdb
#  18: usage_01887.pdb
#
# Length:         31
# Identity:       29/ 31 ( 93.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     29/ 31 ( 93.5%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 31 (  6.5%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00047.pdb         1  -EDQVDQLALYAPQATVNRIDNYEVVGKSR-   29
usage_00311.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_00495.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_00496.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_00528.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_00529.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_00530.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_00602.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_00704.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_00735.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSRP   31
usage_01520.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_01521.pdb         1  -EDQVDQLALYAPQATVNRIDNYEVVGKSR-   29
usage_01655.pdb         1  -EDQVDQLALYAPQATVNRIDNYEVVGKSR-   29
usage_01656.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_01664.pdb         1  -EDQVDQLALYAPQATVNRIDNYEVVGKSR-   29
usage_01770.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_01886.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
usage_01887.pdb         1  SEDQVDQLALYAPQATVNRIDNYEVVGKSR-   30
                            EDQVDQLALYAPQATVNRIDNYEVVGKSR 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################