################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:09:37 2021
# Report_file: c_1256_155.html
################################################################################################
#====================================
# Aligned_structures: 4
#   1: usage_01211.pdb
#   2: usage_01498.pdb
#   3: usage_03742.pdb
#   4: usage_03743.pdb
#
# Length:         94
# Identity:       22/ 94 ( 23.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     34/ 94 ( 36.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           32/ 94 ( 34.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_01211.pdb         1  DFLGVNYYSPTVS---------------------HSPWPGA--DRVAFHQPPGETTAMGW   37
usage_01498.pdb         1  DFLGVNHYHDDN-VSGHPLPAGQPQPVVPTDSPKSSPFVGS--EYVTFPARDLPRTAMGW   57
usage_03742.pdb         1  DFLGINYYSRMV-VRHKP-----------------GD----NLFNAEVVKMERPSTEMGW   38
usage_03743.pdb         1  DFLGINYYSRMV-VRHKP-----------------------NLFNAEVVKMERPSTEMGW   36
                           DFLG NyYs  v                                         p T MGW

usage_01211.pdb        38  AVDPSGLYELLRRLSSDFPA-LPLVITENGAAFH   70
usage_01498.pdb        58  EVNPEGLRVLLNRLNQDYANLPSLYITENGASYT   91
usage_03742.pdb        39  EIYPQGLYDILVRVNKEYTD-KPLYITENGAAFD   71
usage_03743.pdb        37  EIYPQGLYDILVRVNKEYTD-KPLYITENGAAFD   69
                           e  P GLy  L R n  y    pLyITENGAaf 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################