################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:41 2021 # Report_file: c_1409_158.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00884.pdb # 2: usage_00893.pdb # 3: usage_00894.pdb # 4: usage_00911.pdb # 5: usage_01831.pdb # # Length: 85 # Identity: 11/ 85 ( 12.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 85 ( 32.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 85 ( 15.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00884.pdb 1 AQRESIQDYLKQSLGELLFLDPG--QLRSGAQFLDLGMDSVTGTQWMRGVSRHFSIQLAA 58 usage_00893.pdb 1 -NLSEIKQVLKQQLAEALYTE--ESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKA 57 usage_00894.pdb 1 -NLSEIKQVLKQQLAEALYTE--ESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKA 57 usage_00911.pdb 1 -RQEEIAEEVARLLAGVLYLE--PDRLDPEETFLTLGVDSILGVEFVAAVNAAYPVGVKA 57 usage_01831.pdb 1 ---APVARALREELARTLYCE--PGDIDDEASFNTLGLDSILGVEFVAFVNQTYGLDEKA 55 i l La Ly e F LG DSi Gve n y kA usage_00884.pdb 59 DAIYTWPTLKSLADEVDRRVQ---- 79 usage_00893.pdb 58 TKLYDYPTLLELSGYIAQILSSQGT 82 usage_00894.pdb 58 TKLYDYPTLLELSGYIAQILSSQGT 82 usage_00911.pdb 58 TALYDHPTPAAFARHIAESL----- 77 usage_01831.pdb 56 GILYDHPSLAALSRHVAGR------ 74 lYd Ptl l a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################