################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:29:30 2021 # Report_file: c_1242_104.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00183.pdb # 2: usage_00189.pdb # 3: usage_00216.pdb # 4: usage_00283.pdb # 5: usage_00407.pdb # 6: usage_00818.pdb # 7: usage_00819.pdb # 8: usage_01169.pdb # 9: usage_01170.pdb # 10: usage_01171.pdb # 11: usage_01993.pdb # 12: usage_02208.pdb # 13: usage_02283.pdb # 14: usage_02419.pdb # 15: usage_02420.pdb # # Length: 33 # Identity: 24/ 33 ( 72.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 33 ( 72.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 33 ( 15.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00183.pdb 1 RKPVLEVINTNYHTDRAGGNAYWKSIGAKVVST 33 usage_00189.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_00216.pdb 1 -----EVINTNYHTDRAGGNAYWKTLGAKIVAT 28 usage_00283.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_00407.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_00818.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_00819.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_01169.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_01170.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_01171.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_01993.pdb 1 PLPINEVINTNYHTDRAGGNAYWKTLGAKIVAT 33 usage_02208.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_02283.pdb 1 -----EVINTNYHTDRAGGNAYWKSIGAKVVST 28 usage_02419.pdb 1 ----NEVINTNYHTDRAGGNAYWKTLGAKIVAT 29 usage_02420.pdb 1 -----EVINTNYHTDRAGGNAYWKTLGAKIVAT 28 EVINTNYHTDRAGGNAYWK GAK V T #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################