################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:15 2021 # Report_file: c_0697_25.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00294.pdb # 2: usage_00319.pdb # 3: usage_00376.pdb # 4: usage_00377.pdb # 5: usage_00379.pdb # 6: usage_00380.pdb # 7: usage_00390.pdb # 8: usage_00391.pdb # 9: usage_00497.pdb # 10: usage_00498.pdb # # Length: 51 # Identity: 21/ 51 ( 41.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 51 ( 78.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 51 ( 13.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00294.pdb 1 LNIEHWRPKIDPPDDSTWWEESFGGNTDSKPRGPESVGLDISFVGYEHVFG 51 usage_00319.pdb 1 MAFEHQRAPR----EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 47 usage_00376.pdb 1 MAFEHQRA------EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 45 usage_00377.pdb 1 MAFEHQRA------EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 45 usage_00379.pdb 1 -MAFEHQRAP----EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 46 usage_00380.pdb 1 MAFEHQRA------EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 45 usage_00390.pdb 1 MAFEHQRAPR----EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 47 usage_00391.pdb 1 MAFEHQRAPR----EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 47 usage_00497.pdb 1 MAFEHQRAPR----EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 47 usage_00498.pdb 1 MAFEHQRAPR----EPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYG 47 eh r epgaWEEtFkthsDSKPyGPtSVGLDfSlpGmEHVyG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################