################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:56 2021 # Report_file: c_1266_87.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00145.pdb # 2: usage_00174.pdb # 3: usage_00245.pdb # 4: usage_00246.pdb # 5: usage_00452.pdb # 6: usage_00788.pdb # 7: usage_00789.pdb # 8: usage_00794.pdb # 9: usage_01096.pdb # 10: usage_01097.pdb # 11: usage_01098.pdb # 12: usage_01290.pdb # 13: usage_01385.pdb # # Length: 34 # Identity: 32/ 34 ( 94.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 34 ( 94.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 34 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00145.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_00174.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_00245.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_00246.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_00452.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_00788.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_00789.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_00794.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYP 34 usage_01096.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_01097.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_01098.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_01290.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT-- 32 usage_01385.pdb 1 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYP 34 FYSTDNKYDAAGYSVDNENPLSGKAGGVVKVT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################