################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:17 2021 # Report_file: c_1482_22.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00081.pdb # 2: usage_00082.pdb # 3: usage_00167.pdb # 4: usage_00241.pdb # 5: usage_00249.pdb # 6: usage_00250.pdb # 7: usage_00272.pdb # 8: usage_00273.pdb # 9: usage_00296.pdb # 10: usage_00353.pdb # 11: usage_00477.pdb # 12: usage_00478.pdb # # Length: 30 # Identity: 1/ 30 ( 3.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 30 ( 16.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 30 ( 26.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00081.pdb 1 -------IPTKALLHAAETLHHLKVAEGFG 23 usage_00082.pdb 1 -------IPTKALLHAAETLHHLKVAEGFG 23 usage_00167.pdb 1 ------CVPKKLMVTGAQYMDLIRESGGFG 24 usage_00241.pdb 1 -----GCVPKKLMVTGAQYMEHLRESAGFG 25 usage_00249.pdb 1 -------VPKKLMVTGAQYMDLIRESGGFG 23 usage_00250.pdb 1 -------VPKKLMVTGAQYMDLIRESGGFG 23 usage_00272.pdb 1 -----GCVPKKLMVTGAQYMDLIRESGGFG 25 usage_00273.pdb 1 TCVNVGCVPKKLMVTGAQYMDLIRESGGFG 30 usage_00296.pdb 1 ------CVPKKLMVTGAQYMDLIRESGGFG 24 usage_00353.pdb 1 -------PSEKRLELYLLDTIRRVYESYG- 22 usage_00477.pdb 1 ------CVPKKLMVTGAQYMDLIRESGGFG 24 usage_00478.pdb 1 ------CVPKKLMVTGAQYMDLIRESGGFG 24 p K a gf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################