################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:10 2021 # Report_file: c_1297_146.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00039.pdb # 2: usage_00418.pdb # 3: usage_00719.pdb # 4: usage_00762.pdb # 5: usage_01180.pdb # 6: usage_01181.pdb # 7: usage_01232.pdb # 8: usage_01233.pdb # 9: usage_01243.pdb # 10: usage_01360.pdb # 11: usage_01447.pdb # 12: usage_02185.pdb # 13: usage_03170.pdb # # Length: 33 # Identity: 28/ 33 ( 84.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 33 ( 87.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 33 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00039.pdb 1 SEDQVDQLALYAPQAAVNRIDNYEVVGKSRP-- 31 usage_00418.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSRP-- 31 usage_00719.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSRP-- 31 usage_00762.pdb 1 -EDQVDQLALYAPQATVNRIDNYEVVGKSRPSL 32 usage_01180.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR--- 30 usage_01181.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSRP-- 31 usage_01232.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSRP-- 31 usage_01233.pdb 1 -EDQVDQLALYAPQATVNRIDNYEVVGKSRP-- 30 usage_01243.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSRP-- 31 usage_01360.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR--- 30 usage_01447.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSRP-- 31 usage_02185.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR--- 30 usage_03170.pdb 1 SEDQVDQLALYAPQATVNRIDNYEVVGKSR--- 30 EDQVDQLALYAPQAtVNRIDNYEVVGKSR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################