################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:20:08 2021
# Report_file: c_1428_287.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00852.pdb
#   2: usage_00995.pdb
#   3: usage_00996.pdb
#   4: usage_01103.pdb
#   5: usage_01663.pdb
#
# Length:         90
# Identity:        1/ 90 (  1.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      2/ 90 (  2.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           65/ 90 ( 72.2%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00852.pdb         1  ----------------------------------------------SEEELSDLFRMFDK   14
usage_00995.pdb         1  ------------------------------------AFDDF-IQGCIVLQRLTDIFRRYD   23
usage_00996.pdb         1  DKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDF-IQGCIVLQRLTDIFRRYD   59
usage_01103.pdb         1  -----------------------------------------VFDLPQIESEVDAILGAAD   19
usage_01663.pdb         1  ------------------------------------------QRSAFLAAQSAEL-TRMG   17
                                                                                       

usage_00852.pdb        15  ---NADGYIDL------DEL-KIMLQAT--   32
usage_00995.pdb        24  T--DQDGWIQVSYEQYLSMV-F--------   42
usage_00996.pdb        60  T--DQDGWIQVSYEQYLSMVFS--------   79
usage_01103.pdb        20  F--DRNGYIDY------SEF-VTVAM----   36
usage_01663.pdb        18  -VVNSAGAVDP------RVA-QWITT--VC   37
                                 G i                     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################