################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:40:45 2021 # Report_file: c_0466_20.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00029.pdb # 2: usage_00030.pdb # 3: usage_00059.pdb # 4: usage_00060.pdb # 5: usage_00086.pdb # 6: usage_00104.pdb # 7: usage_00105.pdb # # Length: 73 # Identity: 21/ 73 ( 28.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 73 ( 46.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 73 ( 4.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00029.pdb 1 -SLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPL 59 usage_00030.pdb 1 -SLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPL 59 usage_00059.pdb 1 ESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRAL 60 usage_00060.pdb 1 ESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRAL 60 usage_00086.pdb 1 KSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPL 60 usage_00104.pdb 1 -RLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGL 59 usage_00105.pdb 1 ESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRAL 60 sL L N i Di L L L L l N i dI L LtKL L L N Isd L usage_00029.pdb 60 AGLTKLQNLYLSK 72 usage_00030.pdb 60 AGLTKLQNLYLSK 72 usage_00059.pdb 61 AGLKNLDVLEL-- 71 usage_00060.pdb 61 AGLKNLDVLEL-- 71 usage_00086.pdb 61 AGLTKLQNLYL-- 71 usage_00104.pdb 60 TRLKKVNWIDL-- 70 usage_00105.pdb 61 AGLKNLDVLEL-- 71 agL l l L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################