################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:26 2021 # Report_file: c_1007_18.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00015.pdb # 2: usage_00045.pdb # 3: usage_00053.pdb # 4: usage_00452.pdb # 5: usage_00540.pdb # 6: usage_00695.pdb # 7: usage_00696.pdb # 8: usage_00773.pdb # 9: usage_00774.pdb # # Length: 64 # Identity: 21/ 64 ( 32.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 64 ( 78.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 64 ( 10.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 -KEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHL 59 usage_00045.pdb 1 -KEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHL 59 usage_00053.pdb 1 -KEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIEGGSVLHL 59 usage_00452.pdb 1 -KEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHL 59 usage_00540.pdb 1 QDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHL 60 usage_00695.pdb 1 -KEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHL 59 usage_00696.pdb 1 -KEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHL 59 usage_00773.pdb 1 -KEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQ-NDEKTAADYKI-GGSVLHL 57 usage_00774.pdb 1 -KEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQ-NDEKTAADYKI-GGSVLHL 57 keiEidiePtd v riKErveekeGIPp qQRLIYsGKq D kTa dY I gGsvlHL usage_00015.pdb 60 V--- 60 usage_00045.pdb 60 VL-- 61 usage_00053.pdb 60 VLAL 63 usage_00452.pdb 60 V--- 60 usage_00540.pdb 61 V--- 61 usage_00695.pdb ---- usage_00696.pdb ---- usage_00773.pdb 58 V--- 58 usage_00774.pdb 58 V--- 58 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################