################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:24 2021 # Report_file: c_0941_119.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00181.pdb # 2: usage_00182.pdb # 3: usage_00228.pdb # 4: usage_00880.pdb # 5: usage_01033.pdb # 6: usage_01034.pdb # 7: usage_01041.pdb # 8: usage_01042.pdb # 9: usage_01043.pdb # 10: usage_01059.pdb # 11: usage_01060.pdb # 12: usage_01061.pdb # # Length: 44 # Identity: 32/ 44 ( 72.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 44 ( 72.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 44 ( 4.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00181.pdb 1 --VQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEP 42 usage_00182.pdb 1 SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEP 44 usage_00228.pdb 1 -SVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEP 43 usage_00880.pdb 1 --VQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEP 42 usage_01033.pdb 1 --MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQA 42 usage_01034.pdb 1 --MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQA 42 usage_01041.pdb 1 --MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQA 42 usage_01042.pdb 1 --MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQA 42 usage_01043.pdb 1 --MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQA 42 usage_01059.pdb 1 --MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQA 42 usage_01060.pdb 1 --MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQA 42 usage_01061.pdb 1 --MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQA 42 QTAA SWGT PSIRVYTAN KITERC DG WYTGAFN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################