################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:33 2021 # Report_file: c_0850_52.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00122.pdb # 2: usage_00389.pdb # 3: usage_00390.pdb # 4: usage_00459.pdb # 5: usage_00529.pdb # 6: usage_00530.pdb # 7: usage_00531.pdb # 8: usage_00595.pdb # 9: usage_00620.pdb # 10: usage_00786.pdb # # Length: 49 # Identity: 22/ 49 ( 44.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 49 ( 98.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 49 ( 2.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00122.pdb 1 NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADF 49 usage_00389.pdb 1 NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADF 49 usage_00390.pdb 1 NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADF 49 usage_00459.pdb 1 NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADF 49 usage_00529.pdb 1 NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADF 49 usage_00530.pdb 1 NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADF 49 usage_00531.pdb 1 NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAAF 49 usage_00595.pdb 1 -RDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADF 48 usage_00620.pdb 1 NRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADA 49 usage_00786.pdb 1 DRDRALKIVEDVKDYVDAIKVGYPLVLSTGTEIIKEIKKLCNKEVIADF 49 RDdALrvtgeVreYiDtvKiGYPLVLSeGmdIIaEfrKrfgcriIAdf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################