################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:29:15 2021 # Report_file: c_0731_34.html ################################################################################################ #==================================== # Aligned_structures: 20 # 1: usage_00050.pdb # 2: usage_00051.pdb # 3: usage_00078.pdb # 4: usage_00131.pdb # 5: usage_00140.pdb # 6: usage_00141.pdb # 7: usage_00161.pdb # 8: usage_00168.pdb # 9: usage_00200.pdb # 10: usage_00201.pdb # 11: usage_00202.pdb # 12: usage_00203.pdb # 13: usage_00204.pdb # 14: usage_00249.pdb # 15: usage_00424.pdb # 16: usage_00425.pdb # 17: usage_00429.pdb # 18: usage_00477.pdb # 19: usage_00500.pdb # 20: usage_00527.pdb # # Length: 44 # Identity: 8/ 44 ( 18.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 44 ( 86.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 44 ( 13.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00050.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00051.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00078.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00131.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00140.pdb 1 --CLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 38 usage_00141.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00161.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00168.pdb 1 --CLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 38 usage_00200.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00201.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00202.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00203.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00204.pdb 1 --CLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 38 usage_00249.pdb 1 --TQAIIDTSKAIIVGPKAYVNPINEAIGCVVEKTTTRRICKLD 42 usage_00424.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00425.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00429.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00477.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 usage_00500.pdb 1 --CLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 38 usage_00527.pdb 1 DGCLALVDTGASYISGSTSSIEKLMEALGAKKRLF--DY-VVK- 40 clAlvDTgasyIsGstssieklmEAlGakkrlf dy vvk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################