################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:20:10 2021 # Report_file: c_1434_253.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_02329.pdb # 2: usage_02330.pdb # 3: usage_03499.pdb # 4: usage_03500.pdb # 5: usage_03501.pdb # # Length: 83 # Identity: 32/ 83 ( 38.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 83 ( 38.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 83 ( 3.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02329.pdb 1 -MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLP 59 usage_02330.pdb 1 -MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLP 59 usage_03499.pdb 1 DLNNLIGIIAGAITTSALIPQALKIYKTKSARDVSLAMFIFMAIGITLWFFYGVLIKEIP 60 usage_03500.pdb 1 -LNNLIGIIAGAITTSALIPQALKIYKTKSARDVSLAMFIFMAIGITLWFFYGVLIKEIP 59 usage_03501.pdb 1 DLNNLIGIIAGAITTSALIPQALKIYKTKSARDVSLAMFIFMAIGITLWFFYGVLIKEIP 60 NLIG A TT PQ L TK RD S M I G LWF YG L P usage_02329.pdb 60 IILANVVTLFFVTIILYYKLTE- 81 usage_02330.pdb 60 IILANVVTLFFVTIILYYKLT-- 80 usage_03499.pdb 61 VILANLISLILIFLIIFMKIRYG 83 usage_03500.pdb 60 VILANLISLILIFLIIFMKIRYG 82 usage_03501.pdb 61 VILANLISLILIFLIIFMKIR-- 81 ILAN L I K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################