################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:00:12 2021 # Report_file: c_1484_300.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_03300.pdb # 2: usage_03819.pdb # 3: usage_03820.pdb # 4: usage_03821.pdb # # Length: 74 # Identity: 2/ 74 ( 2.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 74 ( 68.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 74 ( 31.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_03300.pdb 1 --------GEIKQQLEELESDWRKQHALFSEQQKCLF-IPGDWLGRIEASLQDVGAQIRQ 51 usage_03819.pdb 1 -KYKIKETLKRLEDSLRELRRILEELKEMLERLEK--NP-DKDVIVEVLKVIVKAIEASV 56 usage_03820.pdb 1 --YKIKETLKRLEDSLRELRRILEELKEMLERLEK--NP-DKDVIVEVLKVIVKAIEASV 55 usage_03821.pdb 1 TKYKIKETLKRLEDSLRELRRILEELKEMLERLEK--NP-DKDVIVEVLKVIVKAIEASV 57 lkrledslrelrrileelkemlErlek p dkdvivevlkvivkaieasv usage_03300.pdb 52 AQQ----------- 54 usage_03819.pdb 57 ENQRISAENQKALA 70 usage_03820.pdb 56 ENQRISAENQKALA 69 usage_03821.pdb 58 ENQRISAENQKALA 71 enQ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################