################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:42 2021 # Report_file: c_0770_127.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00090.pdb # 2: usage_00091.pdb # 3: usage_00247.pdb # 4: usage_00593.pdb # 5: usage_00594.pdb # 6: usage_00822.pdb # 7: usage_00871.pdb # 8: usage_00872.pdb # # Length: 64 # Identity: 16/ 64 ( 25.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 64 ( 29.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 64 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00090.pdb 1 HTLFIGCSDSRYN-ENCLGVLPGEVFTWKNVANICHSEDLTLKATLEFAIICLKVNKVII 59 usage_00091.pdb 1 HTLFIGCSDSRYNE-NCLGVLPGEVFTWKNVANICHSEDLTLKATLEFAIICLKVNKVII 59 usage_00247.pdb 1 EYLYIGCADSRVSPAQLFNMAPGEVFVQRNVGNLVSNKDLNCMSCLEYTVDHLKIKHILV 60 usage_00593.pdb 1 EILWIGCSDSRCPETTILGMQPGDVFVHRNIANIVSPTDINTTAVIEYAVAHLKVKHIVL 60 usage_00594.pdb 1 EILWIGCSDSRCPETTILGMQPGDVFVHRNIANIVSPTDINTTAVIEYAVAHLKVKHIVL 60 usage_00822.pdb 1 -YLWIGCSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIII 59 usage_00871.pdb 1 EYLWIGCSDARVPANEIVGMLPGDLFVHRNVANVVLHTDLNCLSVIQFAVDVLKVKHILV 60 usage_00872.pdb 1 EYLWIGCSDARVPANEIVGMLPGDLFVHRNVANVVLHTDLNCLSVIQFAVDVLKVKHILV 60 L IGCsD R PG F N aN D a LK usage_00090.pdb 60 CGHT 63 usage_00091.pdb 60 CGHT 63 usage_00247.pdb 61 CGHY 64 usage_00593.pdb 61 CGH- 63 usage_00594.pdb 61 CGH- 63 usage_00822.pdb 60 CGHT 63 usage_00871.pdb 61 TGHY 64 usage_00872.pdb 61 TGHY 64 GH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################