################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:17 2021 # Report_file: c_0686_62.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00352.pdb # 2: usage_00781.pdb # 3: usage_00784.pdb # 4: usage_00785.pdb # 5: usage_00786.pdb # 6: usage_00822.pdb # # Length: 83 # Identity: 61/ 83 ( 73.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/ 83 ( 73.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 83 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00352.pdb 1 LGVGISGHPLLNKLDDTENASAYAAN-AGVDNRECISMDYKQTQLCLIGCKPPIGEHWGK 59 usage_00781.pdb 1 -GVGISGHPLLNKLDDTENASAYA-ANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGK 58 usage_00784.pdb 1 --VGISGHPLLNKLDDTENSNKYV-GNSGTDNRECISMDYKQTQLCLIGCRPPIGEHWGK 57 usage_00785.pdb 1 --VGISGHPLLNKLDDTENSNKYV-GNSGTDNRECISMDYKQTQLCLIGCRPPIGEHWGK 57 usage_00786.pdb 1 --VGISGHPLLNKLDDTENSNKYV-GNSGTDNRECISMDYKQTQLCLIGCRPPIGEHWGK 57 usage_00822.pdb 1 LGVGISGHPLLNKLDDTENASAYAAN-AGVDNRECISMDYKQTQLCLIGCKPPIGEHWGK 59 VGISGHPLLNKLDDTEN Y G DNRECISMDYKQTQLCLIGC PPIGEHWGK usage_00352.pdb 60 GSPCTQVAVQPGDCPPLELINTV 82 usage_00781.pdb 59 GSPCTQVAVQPGDCPPLELINTV 81 usage_00784.pdb 58 GTPSNANQVKAGECPPLELLNTV 80 usage_00785.pdb 58 GTPSNANQVKAGECPPLELLNTV 80 usage_00786.pdb 58 GTPSNANQVKAGECPPLELLNTV 80 usage_00822.pdb 60 GSPCTQVAVQPGDCPPLELINTV 82 G P V G CPPLEL NTV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################