################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:11:24 2021
# Report_file: c_1484_256.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_01172.pdb
#   2: usage_01176.pdb
#   3: usage_01433.pdb
#   4: usage_02283.pdb
#   5: usage_02782.pdb
#   6: usage_02783.pdb
#   7: usage_02784.pdb
#   8: usage_04011.pdb
#   9: usage_04640.pdb
#  10: usage_04641.pdb
#  11: usage_04642.pdb
#
# Length:         37
# Identity:        0/ 37 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      3/ 37 (  8.1%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           16/ 37 ( 43.2%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_01172.pdb         1  ------KELASLLAWTHQMKAKNWQE---WTQQAAKQ   28
usage_01176.pdb         1  ------KELASLLAWTHQMKAKNWQE---WTQQAAKQ   28
usage_01433.pdb         1  ------KEVASLLAWTHQMKAKNWQE---WTQQAAKQ   28
usage_02283.pdb         1  DPNISSWLEDAAYFAAIDNSVNTISWYDWPEPLKNR-   36
usage_02782.pdb         1  ------KEVASLLAWTHQMKAKNWPE---WTQQAAKQ   28
usage_02783.pdb         1  ------KEVASLLAWTHQMKAKNWPE---WTQQAAKQ   28
usage_02784.pdb         1  ------KEVASLLAWTHQMKAKNWPE---WTQQAAKQ   28
usage_04011.pdb         1  ----------FTNSLRMLQQK-RWDE---AAVNLAKS   23
usage_04640.pdb         1  ------KEVASLLAWTHQMKAKNWPE---WTQQAA--   26
usage_04641.pdb         1  ------KEVASLLAWTHQMKAKNWPE---WTQQAA--   26
usage_04642.pdb         1  ------KEVASLLAWTHQMKAKNWPE---WTQQAA--   26
                                                  w e        a  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################