################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:20:09 2021 # Report_file: c_1434_215.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00017.pdb # 2: usage_02299.pdb # 3: usage_02580.pdb # 4: usage_02642.pdb # 5: usage_03505.pdb # # Length: 90 # Identity: 4/ 90 ( 4.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 90 ( 23.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/ 90 ( 32.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00017.pdb 1 TEEEKIRVDILENQAMDVSNQLARVCYS--------PDFEKLKPEYLEELPTMMQHFSQF 52 usage_02299.pdb 1 -------DPYGRAQARFWADFVDKKFTDAQFKVWGK--KGEEQEAGKKEFIEAVKILESE 51 usage_02580.pdb 1 CPKERAEISMLEGAVLDIRYGVSRIAYS--------KDFETLKVDFLSKLPEMLKMFEDR 52 usage_02642.pdb 1 TEEERIRADIVENQVMDNRMQLIMLCYN--------PDFEKQKPEFLKTIPEKMKLYSEF 52 usage_03505.pdb 1 TEEERIRADIVENQVMDNRMQLIMLCYN--------PDFEKQKPEFLKTIPEKMKLYSEF 52 e q d y fe k l pe k usage_00017.pdb 53 LGKRPWFVGDKITFVDFLAYDVLDLHRIF- 81 usage_02299.pdb 52 LGDKPYFGGDSFGYVDISL----------- 70 usage_02580.pdb 53 LCHKTYLNGDHVTHPDFMLYDALDVVLYMD 82 usage_02642.pdb 53 LGKRPWFAGDKVTYVDFLAYDILDQYHIF- 81 usage_03505.pdb 53 LGKRP-FAGDKVTYVDFLAYDILDQYHIFE 81 Lg p f GD t vDf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################