################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:22 2021 # Report_file: c_0811_36.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00112.pdb # 2: usage_00197.pdb # 3: usage_00198.pdb # 4: usage_00200.pdb # 5: usage_00256.pdb # 6: usage_00337.pdb # 7: usage_00380.pdb # 8: usage_00436.pdb # 9: usage_00500.pdb # 10: usage_00644.pdb # # Length: 55 # Identity: 19/ 55 ( 34.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 55 ( 34.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 55 ( 9.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00112.pdb 1 TFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDIN- 54 usage_00197.pdb 1 GSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLG- 54 usage_00198.pdb 1 -SQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLG- 53 usage_00200.pdb 1 -VSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALG- 53 usage_00256.pdb 1 DHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQ 55 usage_00337.pdb 1 SSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIH- 54 usage_00380.pdb 1 -LKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIET 54 usage_00436.pdb 1 -SQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLG- 53 usage_00500.pdb 1 ----LSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQ 51 usage_00644.pdb 1 --IKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQ 53 Q GM YL HRDLA RN L KI DFGL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################