################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:45 2021 # Report_file: c_1297_4.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00446.pdb # 2: usage_01184.pdb # 3: usage_01331.pdb # 4: usage_01561.pdb # 5: usage_01562.pdb # 6: usage_02599.pdb # 7: usage_02600.pdb # 8: usage_03003.pdb # 9: usage_03158.pdb # 10: usage_03159.pdb # # Length: 64 # Identity: 6/ 64 ( 9.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 64 ( 17.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 64 ( 28.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00446.pdb 1 DKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKP--TKALLFVLLSP- 57 usage_01184.pdb 1 DKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQP--RRALLFVILCPV 58 usage_01331.pdb 1 SIDELMEACRDVIRKNN-----L-T-SAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAF-- 51 usage_01561.pdb 1 --LELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQP--TRALLFVILCPV 56 usage_01562.pdb 1 DKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQP--TRALLFVILCP- 57 usage_02599.pdb 1 --LELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQP--TRALLFVILCP- 55 usage_02600.pdb 1 --LELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQP--TRALLFVILCPV 56 usage_03003.pdb 1 -QETLEAAQRDVVRENK-----L-E-SCYLRPIIWIGSEKLG-VSAKGNTIHVAIAAWPW 51 usage_03158.pdb 1 --LELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQP--RRALLFVILCP- 55 usage_03159.pdb 1 --LELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQP--RRALLFVILCPV 56 eL e r S Y RP lG p usage_00446.pdb ---- usage_01184.pdb 59 GAYF 62 usage_01331.pdb ---- usage_01561.pdb 57 GA-- 58 usage_01562.pdb ---- usage_02599.pdb ---- usage_02600.pdb 57 GAYF 60 usage_03003.pdb 52 GA-- 53 usage_03158.pdb ---- usage_03159.pdb 57 GAYF 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################