################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:01 2021 # Report_file: c_0707_10.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00637.pdb # 2: usage_00638.pdb # 3: usage_00639.pdb # 4: usage_00640.pdb # 5: usage_00641.pdb # 6: usage_00642.pdb # 7: usage_00643.pdb # # Length: 61 # Identity: 60/ 61 ( 98.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 61 ( 98.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 61 ( 1.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00637.pdb 1 STVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTIS 60 usage_00638.pdb 1 STVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTIS 60 usage_00639.pdb 1 STVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTIS 60 usage_00640.pdb 1 STVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTIS 60 usage_00641.pdb 1 STVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTIS 60 usage_00642.pdb 1 STVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTIS 60 usage_00643.pdb 1 STVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTIS 60 STVELGSKNFNVLQNTSTQEGSDNTNLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTIS usage_00637.pdb - usage_00638.pdb 61 E 61 usage_00639.pdb - usage_00640.pdb - usage_00641.pdb - usage_00642.pdb - usage_00643.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################