################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:39 2021 # Report_file: c_1200_189.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00495.pdb # 2: usage_01254.pdb # 3: usage_01280.pdb # 4: usage_01292.pdb # 5: usage_01798.pdb # 6: usage_01838.pdb # 7: usage_01859.pdb # 8: usage_03332.pdb # 9: usage_04032.pdb # 10: usage_04601.pdb # # Length: 38 # Identity: 21/ 38 ( 55.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 38 ( 81.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 38 ( 2.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00495.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITH 38 usage_01254.pdb 1 TYYEYPIMSDYDVYTGGSPGADRVIFNGDDELAGVITH 38 usage_01280.pdb 1 PYQEFPIK-SGGVYTGGSPGADRVVINTNCEYAGAITH 37 usage_01292.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITH 38 usage_01798.pdb 1 PYYEYPILSSGDVYSGGSPGADRVVFNENNQLAGVITH 38 usage_01838.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITH 38 usage_01859.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITH 38 usage_03332.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITH 38 usage_04032.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITH 38 usage_04601.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITH 38 pYyE PI sgdVY GGSPGADRVvfN n lAGvITH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################