################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:44 2021 # Report_file: c_0813_41.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00038.pdb # 2: usage_00039.pdb # 3: usage_00168.pdb # 4: usage_00169.pdb # 5: usage_00278.pdb # 6: usage_00279.pdb # # Length: 79 # Identity: 33/ 79 ( 41.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 79 ( 41.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 79 ( 5.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00038.pdb 1 -VCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGF 59 usage_00039.pdb 1 -VCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGF 59 usage_00168.pdb 1 GVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGF 60 usage_00169.pdb 1 GVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGF 60 usage_00278.pdb 1 GVCGEAAHFQETVIVGDVTTYLNYISCDSLAKSEIVVPMMK-NGQLLGVLDLDSSEIEDY 59 usage_00279.pdb 1 GVCGEAAHFQETVIVGDVTTYLNYISCDSLAKSEIVVPMMK-NGQLLGVLDLDSSEIEDY 59 VCG AA ET IV DV Y I CD KSEIVVP G LGV D D E usage_00038.pdb 60 DHVDKEFLEKLAKLINKS- 77 usage_00039.pdb 60 DHVDKEFLEKLAKLINKS- 77 usage_00168.pdb 61 DHVDKEFLEKLAKLINKS- 78 usage_00169.pdb 61 DHVDKEFLEKLAKLINK-- 77 usage_00278.pdb 60 DAMDRDYLEQFVAILLEKT 78 usage_00279.pdb 60 DAMDRDYLEQFVAILLEKT 78 D D LE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################