################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:34 2021 # Report_file: c_1410_39.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00103.pdb # 2: usage_00468.pdb # 3: usage_01136.pdb # 4: usage_01455.pdb # 5: usage_01456.pdb # 6: usage_01457.pdb # 7: usage_01458.pdb # 8: usage_01459.pdb # 9: usage_01460.pdb # 10: usage_01461.pdb # # Length: 46 # Identity: 17/ 46 ( 37.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 46 ( 43.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 46 ( 2.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00103.pdb 1 -NFRLWGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 45 usage_00468.pdb 1 VNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 46 usage_01136.pdb 1 -NFKLLGNVLVVVLARHHGSEFTPLLQAEFQKVVAGVANALAHRYH 45 usage_01455.pdb 1 -NFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 45 usage_01456.pdb 1 -NFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 45 usage_01457.pdb 1 -NFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 45 usage_01458.pdb 1 -NFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 45 usage_01459.pdb 1 -NFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 45 usage_01460.pdb 1 -NFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 45 usage_01461.pdb 1 -NFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 45 NF Ll L LA H EFTP v A K A V L kY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################