################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:32 2021 # Report_file: c_0773_5.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00120.pdb # 2: usage_00181.pdb # 3: usage_00200.pdb # 4: usage_00201.pdb # 5: usage_00202.pdb # 6: usage_00203.pdb # 7: usage_00205.pdb # 8: usage_00901.pdb # # Length: 79 # Identity: 3/ 79 ( 3.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 79 ( 7.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 79 ( 21.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00120.pdb 1 --PIVLISGGVGLTPMVSMLKVALQ------------APPRQVVFVHGARNSAVHAMRDR 46 usage_00181.pdb 1 ---ELYIGGGAG-APLRAQILHLFRT-------L---KTGRKVSYWYGARSKNEIFYEED 46 usage_00200.pdb 1 --DIMFLATGTGIAPFIGMSEELLEH-------K-LIKFTGNITLVYGAPYSDELVMMDY 50 usage_00201.pdb 1 --DIMFLATGTGIAPFIGMSEELLEH-------K-LIKFTGNITLVYGAPYSDELVMMDY 50 usage_00202.pdb 1 --DIMFLATGTGIAPFIGMSEELLEH-------K-LIKFTGNITLVYGAPYSDELVMMDY 50 usage_00203.pdb 1 --DIMFLATGTGIAPFIGMSEELLEH-------K-LIKFTGNITLVYGAPYSDELVMMDY 50 usage_00205.pdb 1 --PMILIAGGTGFSYARSILLTALAR-----------NPNRDITIYWGGREEQHLYDLCE 47 usage_00901.pdb 1 NTNFIFIATGTGISPYISFLKKLFA-YDKNNLYNRNSNYTGYITIYYGVYNEDSILYLNE 59 G G p G usage_00120.pdb 47 LREAAKTYENLDLFVFYD- 64 usage_00181.pdb 47 FREIEREFPNFKFHIALSD 65 usage_00200.pdb 51 LKGLESKHKNFKLITAIS- 68 usage_00201.pdb 51 LKGLESKHKNFKLITAIS- 68 usage_00202.pdb 51 LKGLESKHKNFKLITAIS- 68 usage_00203.pdb 51 LKGLESKHKNFKLITAIS- 68 usage_00205.pdb 48 LEALSLKHPGLQVVPVVE- 65 usage_00901.pdb 60 LEYFQKMYPNNINIHYVFS 78 l n #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################