################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 22:59:18 2021 # Report_file: c_1396_169.html ################################################################################################ #==================================== # Aligned_structures: 3 # 1: usage_00555.pdb # 2: usage_01412.pdb # 3: usage_01413.pdb # # Length: 81 # Identity: 35/ 81 ( 43.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 76/ 81 ( 93.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 81 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00555.pdb 1 AIDGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVRFL 60 usage_01412.pdb 1 VAEGLIEEANEVIESTEKNEVRDAALIAAAQKVEHYEIASYGTLATLAEQLGYSKALKLL 60 usage_01413.pdb 1 VAEGLIEEANEVIESTEKNEVRDAALIAAAQKVEHYEIASYGTLATLAEQLGYSKALKLL 60 vaeGLIeEAnEviestekneVrDAAliAaAQkVEHYEIAsYGTLatlAEqLGyskalklL usage_00555.pdb 61 TTNLNEEKAANTKLNT----- 76 usage_01412.pdb 61 KETLDEEKQTDLKLTDLAVSN 81 usage_01413.pdb 61 KETLDEEKQTDLKLTDLAVS- 80 ketLdEEKqtdlKLtd #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################