################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:32:49 2021
# Report_file: c_0863_149.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00244.pdb
#   2: usage_00245.pdb
#   3: usage_00756.pdb
#   4: usage_00798.pdb
#   5: usage_01265.pdb
#   6: usage_01348.pdb
#
# Length:         70
# Identity:        5/ 70 (  7.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     23/ 70 ( 32.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           25/ 70 ( 35.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00244.pdb         1  V---------TEGEKSYHEPLVHPAMLAHPNP-------RRVLIIGGGDGGAIREVLKHE   44
usage_00245.pdb         1  V---------TEGEKSYHEPLVHPAMLAHPNP-------RRVLIIGGGDGGAIREVLKHE   44
usage_00756.pdb         1  --------------FSYQEMIANLPLCSHPNP-------RKVLIIGGGDGGVLREVVKHP   39
usage_00798.pdb         1  V---------TEGEKSYHEPLVHPAMLAHPNP-------RRVLIIGGGDGGAIREVLKHE   44
usage_01265.pdb         1  -TTATQLYKDSAVAKVMNTIVEKVIMKAME--KLPPSRGIRLLEIGAGTGGTTSYILPHL   57
usage_01348.pdb         1  T---------ERDEYIYHETLVHPAMLTHPEP-------KRVLIVGGGEGATLREVLKHP   44
                                           y e      m  hp          rvLiiGgG Gg  revlkH 

usage_00244.pdb        45  E-V-EEVIMV   52
usage_00245.pdb        45  E-V-EEVIMV   52
usage_00756.pdb        40  S-V-ESVVQC   47
usage_00798.pdb        45  E-V-EEVIMV   52
usage_01265.pdb        58  NPNQTEYIFT   67
usage_01348.pdb        45  T-V-EKAVMV   52
                             v e     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################