################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:26:56 2021 # Report_file: c_0961_21.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00037.pdb # 2: usage_00078.pdb # 3: usage_00099.pdb # 4: usage_00115.pdb # 5: usage_00325.pdb # 6: usage_00349.pdb # 7: usage_00350.pdb # 8: usage_00351.pdb # 9: usage_00352.pdb # 10: usage_00371.pdb # 11: usage_00372.pdb # 12: usage_00373.pdb # 13: usage_00374.pdb # 14: usage_00383.pdb # 15: usage_00398.pdb # # Length: 34 # Identity: 9/ 34 ( 26.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 34 ( 32.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 34 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00037.pdb 1 DFDYLKLLGKGTFGKVILVREKATGRYYAMKILR 34 usage_00078.pdb 1 DFKFGKILGEGSFSTVVLARELATSREYAIKILE 34 usage_00099.pdb 1 DFEIGRPLGKGKFGNVYLAREKQSKFILALKVLF 34 usage_00115.pdb 1 --ERIKTLGTGSFGRVMLVKHMETGNHYAMKILD 32 usage_00325.pdb 1 --KFGKILGEGSFSTVVLARELATSREYAIKILE 32 usage_00349.pdb 1 DFKFGKILGEGSFSTVVLARELATSREYAIKILE 34 usage_00350.pdb 1 DFKFGKILGEGSFSTVVLARELATSREYAIKILE 34 usage_00351.pdb 1 DFKFGKILGEGSFSTVVLARELATSREYAIKILE 34 usage_00352.pdb 1 DFKFGKILGEGSFSTVVLARELATSREYAIKILE 34 usage_00371.pdb 1 DFKFGKILGEGSFSTVVLARELATSREYAIKILE 34 usage_00372.pdb 1 --KFGKILGEGSFSTVVLARELATSREYAIKILE 32 usage_00373.pdb 1 --KFGKILGEGSFSTVVLARELATSREYAIKILE 32 usage_00374.pdb 1 DFKFGKILGEGSFSTVVLARELATSREYAIKILE 34 usage_00383.pdb 1 --KFGKILGEGSFSTVVLARELATSREYAIKILE 32 usage_00398.pdb 1 --EIGRPLGKGKFGNVYLAREKQSKFILALKVLF 32 LG G F V L re A K L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################