################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:42:59 2021 # Report_file: c_1256_242.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00267.pdb # 2: usage_00288.pdb # 3: usage_00394.pdb # 4: usage_01834.pdb # 5: usage_01903.pdb # 6: usage_01960.pdb # 7: usage_02263.pdb # 8: usage_02304.pdb # 9: usage_02328.pdb # 10: usage_02353.pdb # 11: usage_02443.pdb # 12: usage_03261.pdb # 13: usage_03263.pdb # 14: usage_03264.pdb # 15: usage_03514.pdb # 16: usage_03515.pdb # # Length: 45 # Identity: 16/ 45 ( 35.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 45 ( 35.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 45 ( 15.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00267.pdb 1 NEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAY 45 usage_00288.pdb 1 NEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAY 45 usage_00394.pdb 1 --ITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSK----- 38 usage_01834.pdb 1 --LTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTR----- 38 usage_01903.pdb 1 HYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSK----- 40 usage_01960.pdb 1 HYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN--- 42 usage_02263.pdb 1 --ITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSK----- 38 usage_02304.pdb 1 --ITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSK----- 38 usage_02328.pdb 1 --ITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSK----- 38 usage_02353.pdb 1 HYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN--- 42 usage_02443.pdb 1 HYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKIN--- 42 usage_03261.pdb 1 --ITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSK----- 38 usage_03263.pdb 1 --ITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSK----- 38 usage_03264.pdb 1 --ITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSK----- 38 usage_03514.pdb 1 --LTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTR----- 38 usage_03515.pdb 1 --LTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTR----- 38 T I NYTP A KAF VW TPL F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################