################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:04 2021 # Report_file: c_1124_48.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00003.pdb # 2: usage_00293.pdb # 3: usage_00407.pdb # 4: usage_00455.pdb # 5: usage_00456.pdb # 6: usage_00457.pdb # # Length: 77 # Identity: 5/ 77 ( 6.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 77 ( 20.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 77 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 ---EPEQRKALLIEATLACLKRHGFQGASVRKICAEAGVSVGLINHHYDGKDALVAEAYL 57 usage_00293.pdb 1 ---DALKRREHIITTTCNLYRTHHHDSLT-ENIAEQAGVGVATLYRNFPDRFTLD-ACAQ 55 usage_00407.pdb 1 ---TFSDQTEEI-QATYRALREHGYADLTIQRIADEYGKSTAAVHYYYDTKDDLLAAFLD 56 usage_00455.pdb 1 -RQRDDSKRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYYEDKEQLLLATFY 59 usage_00456.pdb 1 --QRDDSKRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYYEDKEQLLLATFY 58 usage_00457.pdb 1 GRQRDDSKRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYYEDKEQLLLATFY 60 aT Hg Ia aG s a y k L a usage_00003.pdb 58 AVTGRVMRLLRGAIDTA 74 usage_00293.pdb 56 YLFNVVISLQLQAISTF 72 usage_00407.pdb 57 YLLERFVDSIHD----- 68 usage_00455.pdb 60 YVSDQVIDAALDSFSRG 76 usage_00456.pdb 59 YVSDQVIDAALDSFSRG 75 usage_00457.pdb 61 YVSDQVIDAALDSFSRG 77 y v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################