################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:33:08 2021 # Report_file: c_1297_170.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00251.pdb # 2: usage_00252.pdb # 3: usage_00253.pdb # 4: usage_01031.pdb # 5: usage_01032.pdb # 6: usage_01670.pdb # # Length: 65 # Identity: 26/ 65 ( 40.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 65 ( 50.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 65 ( 9.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00251.pdb 1 SCTTNCLAPFVKVLDQK-FGIIKGTMTTTHSYTGDQRLLDASHR-DLRRARAACL-NIVP 57 usage_00252.pdb 1 SCTTNCLAPFVKVLDQK-FGIIKGTMTTTHSYTGDQRLLDASHR-DLRRARAACL-NIVP 57 usage_00253.pdb 1 SCTTNCLAPFVKVLDQK-FGIIKGTMTTTHSYTGDQRLLDASHR-DLRRARAACL-NIVP 57 usage_01031.pdb 1 SCTTNCLAPIVHVLTKENFGIETGLMTTIHSYTATQKTVDGVSLKDWRGGRAAAV-NIIP 59 usage_01032.pdb 1 SCTTNCLAPIVHVLTKENFGIETGLMTTIHSYTATQKTVDGVSLKDWRGGRAAAV-NIIP 59 usage_01670.pdb 1 --TTNCLAPLAKVIHER-FGIVEGLMTTVHSYTATQKTVDGPSR-KAWRDGRGAHQNIIP 56 TTNCLAP v Vl FGI G MTT HSYT Q D d r raa NI P usage_00251.pdb 58 TSTGA 62 usage_00252.pdb 58 TSTGA 62 usage_00253.pdb 58 TSTGA 62 usage_01031.pdb 60 STTGA 64 usage_01032.pdb 60 STTGA 64 usage_01670.pdb 57 ASTG- 60 TG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################