################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:14 2021 # Report_file: c_0707_41.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00615.pdb # 2: usage_00729.pdb # 3: usage_00730.pdb # 4: usage_00859.pdb # 5: usage_00872.pdb # # Length: 70 # Identity: 14/ 70 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 70 ( 42.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 70 ( 11.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00615.pdb 1 YIAYISSNDHGESWSAPTLLPP-IMGLNRNAPYLGPGRGIIESS---TGRILIPSYTGK- 55 usage_00729.pdb 1 YIAMTTSQNRGESWEQFKLLPP-FLGEKHNGTYLCPGQGLALKS---SNRLIFATYTSG- 55 usage_00730.pdb 1 YIAMTTSQNRGESWEQFKLLPP-FLGEKHNGTYLCPGQGLALKS---SNRLIFATYTSG- 55 usage_00859.pdb 1 YLAMRYSDDEGASWSDLDIVS-SFKPEVSKFLVVGPGIGKQISTGENAGRLLVPLYSKSS 59 usage_00872.pdb 1 YIAMTTSQNRGESWEQFKLLPP-FLGEKHNGTYLCPGQGLALKS---SNRLIFATYTSG- 55 YiAm S GeSW llp f ge n yl PG G s Rl Yt usage_00615.pdb 56 -ESAFIYSDD 64 usage_00729.pdb 56 -ELTYLISD- 63 usage_00730.pdb 56 -ELTYLISD- 63 usage_00859.pdb 60 AELGFMYSDD 69 usage_00872.pdb 56 -ELTYLISD- 63 El SD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################