################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:29 2021 # Report_file: c_0856_15.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00025.pdb # 2: usage_00213.pdb # 3: usage_00214.pdb # 4: usage_00215.pdb # 5: usage_00216.pdb # 6: usage_00403.pdb # 7: usage_00404.pdb # # Length: 81 # Identity: 19/ 81 ( 23.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 74/ 81 ( 91.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 81 ( 8.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 -VQLINSLDVALKEILEEGLHKRWDLHRE-SDWFKDSLVNGLQLTSVSRYPSNSAHGLTA 58 usage_00213.pdb 1 SVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTA-MGLSVWAASDSIASPTTTA 59 usage_00214.pdb 1 SVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTA-MGLSVWAASDSIASPTTTA 59 usage_00215.pdb 1 SVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTA-MGLSVWAASDSIASPTTTA 59 usage_00216.pdb 1 SVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTA-MGLSVWAASDSIASPTTTA 59 usage_00403.pdb 1 SVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTA-MGLSVWAASDSIASPTTTA 59 usage_00404.pdb 1 -VSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTA-MGLSVWAASDSIASPTTTA 58 VseINgLDVALdlyLnEGpeavWarHal akamragvta mgLsvwaasdSiaspttTA usage_00025.pdb 59 VYV---ADPPDVIAFLKSHG- 75 usage_00213.pdb 60 VRTPDGVDEKALRQAARARYG 80 usage_00214.pdb 60 VRTPDGVDEKALRQAARARYG 80 usage_00215.pdb 60 VRTPDGVDEKALRQAARARYG 80 usage_00216.pdb 60 VRTPDGVDEKALRQAARARYG 80 usage_00403.pdb 60 VRTPDGVDEKALRQAARARYG 80 usage_00404.pdb 59 VRTPDGVDEKALRQAARARYG 79 Vrt vDekalrqaarary #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################