################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:25 2021 # Report_file: c_0693_62.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00137.pdb # 2: usage_00138.pdb # 3: usage_00158.pdb # 4: usage_00159.pdb # 5: usage_00642.pdb # 6: usage_00643.pdb # 7: usage_00812.pdb # 8: usage_00813.pdb # # Length: 63 # Identity: 19/ 63 ( 30.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 63 ( 36.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 63 ( 15.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00137.pdb 1 ---------HVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYH 51 usage_00138.pdb 1 -------NPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYH 53 usage_00158.pdb 1 ---------NVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVH 51 usage_00159.pdb 1 ---------NVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWVCVHVH 51 usage_00642.pdb 1 TVNTTILAPHVQMLGEEGACISYVRLTQGIGPDGLPRTTQSEETRVWQKKKGVWLNVHFH 60 usage_00643.pdb 1 TVNTTILAPHVQMLGEEGACISYVRLTQGIGPDGLPRTTQSEETRVWQKKKGVWLNVHFH 60 usage_00812.pdb 1 PVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFH 60 usage_00813.pdb 1 --NTTILSPHVHVLGEDAACICYMRLTQSVNSSGEAKTLQQEETRVWQKKGGNWINVHFH 58 v Ge AC Y lTQ G T Qs E RVW G W VH H usage_00137.pdb 52 CSG 54 usage_00138.pdb 54 CSG 56 usage_00158.pdb 52 RST 54 usage_00159.pdb 52 RST 54 usage_00642.pdb 61 RSV 63 usage_00643.pdb 61 RSV 63 usage_00812.pdb 61 RS- 62 usage_00813.pdb 59 ISG 61 S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################