################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:54 2021 # Report_file: c_0856_23.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00033.pdb # 2: usage_00034.pdb # 3: usage_00035.pdb # 4: usage_00036.pdb # 5: usage_00325.pdb # 6: usage_00329.pdb # # Length: 76 # Identity: 36/ 76 ( 47.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 76 ( 65.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 76 ( 9.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00033.pdb 1 RPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTG 60 usage_00034.pdb 1 RPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTG 60 usage_00035.pdb 1 RPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTG 60 usage_00036.pdb 1 RPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTG 60 usage_00325.pdb 1 RPGMYIGST-SERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVD 59 usage_00329.pdb 1 RPGMYIGST-DGAGLHHLVWEIVDNAVDEALSGFGDRIDVTINKDGSLTVQDHGRGMPTG 59 RPGMYIG T dg GLHH V E VDNaiDEALaG I VtI Dns VqD GRGiPtg usage_00033.pdb 61 I-----VSAAEVIMT- 70 usage_00034.pdb 61 I-----VSAAEVIMT- 70 usage_00035.pdb 61 I-----VSAAEVIMT- 70 usage_00036.pdb 61 I-----VSAAEVIMT- 70 usage_00325.pdb 60 IQEKMGRPAVEVILTV 75 usage_00329.pdb 60 MHAMG-IPTVEVIFT- 73 i a EVI T #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################