################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:15:08 2021 # Report_file: c_1172_293.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00098.pdb # 2: usage_00872.pdb # 3: usage_01027.pdb # 4: usage_01118.pdb # 5: usage_01266.pdb # 6: usage_01274.pdb # 7: usage_01470.pdb # 8: usage_01477.pdb # 9: usage_01956.pdb # 10: usage_02203.pdb # 11: usage_02212.pdb # 12: usage_04080.pdb # 13: usage_04500.pdb # 14: usage_04852.pdb # 15: usage_04856.pdb # # Length: 33 # Identity: 27/ 33 ( 81.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 33 ( 81.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 33 ( 18.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00098.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTLDIN-- 30 usage_00872.pdb 1 SEVDPGRYNKVCRIEAASTTQDQCKLTLDINVE 33 usage_01027.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTL----- 27 usage_01118.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTLDIN-- 30 usage_01266.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTL----- 27 usage_01274.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTL----- 27 usage_01470.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTL----- 27 usage_01477.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTL----- 27 usage_01956.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTL----- 27 usage_02203.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTLDIN-- 30 usage_02212.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTL----- 27 usage_04080.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTLDIN-- 30 usage_04500.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTL----- 27 usage_04852.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTLDIN-- 30 usage_04856.pdb 1 -EVDPGRYNKVCRIEAASTTQDQCKLTLDIN-- 30 EVDPGRYNKVCRIEAASTTQDQCKLTL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################