################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Sun Jan 24 08:57:21 2021 # Report_file: c_0669_220.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00023.pdb # 2: usage_01157.pdb # 3: usage_01193.pdb # 4: usage_01194.pdb # 5: usage_01195.pdb # # Length: 64 # Identity: 6/ 64 ( 9.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 64 ( 23.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 64 ( 20.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 -QPYIDEVGTFKERIQWVGDPSWKDGSIVIHNLDYSDNGTFTCDVKN----VGKTSQVTL 55 usage_01157.pdb 1 QQAT-PG-PANSGRETI---YP--NASLLIQNVTQNDTGFYTLQVIKSD-LVNEEATGQF 52 usage_01193.pdb 1 -NLS-VPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVEL 58 usage_01194.pdb 1 -GKF-QSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVG--KLESRKTIVL 56 usage_01195.pdb 1 -GKF-QSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVG--KLESRKTIVL 56 g f R dgS q v D G yTc l usage_00023.pdb 56 YVFE 59 usage_01157.pdb 53 HVY- 55 usage_01193.pdb 59 WVLP 62 usage_01194.pdb 57 HVVQ 60 usage_01195.pdb 57 HVVQ 60 V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################