################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:03 2021 # Report_file: c_1387_1.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00364.pdb # 2: usage_00782.pdb # 3: usage_00783.pdb # 4: usage_00784.pdb # 5: usage_00785.pdb # 6: usage_02493.pdb # # Length: 83 # Identity: 3/ 83 ( 3.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 83 ( 28.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 83 ( 21.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00364.pdb 1 MAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRAAIIMRGYISGLMENWLFAP 60 usage_00782.pdb 1 -AAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSSG 59 usage_00783.pdb 1 -AAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSSG 59 usage_00784.pdb 1 -AAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSSG 59 usage_00785.pdb 1 -AAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSSG 59 usage_02493.pdb 1 ------------SVLDEAVRVRLSRNVDKGQMRTDVPIEVLHTFLETVLDGFISRLATG- 47 e i L ve l Dl e a if ldGli rw usage_00364.pdb 61 QSFDLKKEARDYVAILLEMYLLC 83 usage_00782.pdb 60 ESFDLGKTAPRIIGIMMDNLE-- 80 usage_00783.pdb 60 ESFDLGKTAPRIIGIMMDNLE-- 80 usage_00784.pdb 60 ESFDLGKTAPRIIGIMMDNLE-- 80 usage_00785.pdb 60 ESFDLGKTAPRIIGIMMDNLE-- 80 usage_02493.pdb 48 --AS-TEGLSEVLDLVEGTVR-- 65 fd k a i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################