################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:26:52 2021
# Report_file: c_1212_72.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00445.pdb
#   2: usage_00446.pdb
#   3: usage_00447.pdb
#   4: usage_01009.pdb
#   5: usage_01391.pdb
#   6: usage_01412.pdb
#   7: usage_01415.pdb
#   8: usage_01416.pdb
#   9: usage_01417.pdb
#  10: usage_01418.pdb
#
# Length:         57
# Identity:       26/ 57 ( 45.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     26/ 57 ( 45.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           31/ 57 ( 54.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00445.pdb         1  FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKA   57
usage_00446.pdb         1  FARVCEVDNELRICARDKEVGNLYDM-------------------------------   26
usage_00447.pdb         1  FARVCEVDNELRICARDKEVGNLYDM-------------------------------   26
usage_01009.pdb         1  FARVCEVDNELRICARDKEVGNLYDM-------------------------------   26
usage_01391.pdb         1  FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQH-----------------   40
usage_01412.pdb         1  FARVCEVDNELRICARDKEVGNLYDM-------------------------------   26
usage_01415.pdb         1  FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR----------------------   35
usage_01416.pdb         1  FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR----------------------   35
usage_01417.pdb         1  FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR----------------------   35
usage_01418.pdb         1  FARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR----------------------   35
                           FARVCEVDNELRICARDKEVGNLYDM                               


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################