################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:37 2021 # Report_file: c_1428_18.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00065.pdb # 2: usage_00066.pdb # 3: usage_00262.pdb # 4: usage_00361.pdb # 5: usage_00362.pdb # 6: usage_01381.pdb # 7: usage_01625.pdb # # Length: 75 # Identity: 30/ 75 ( 40.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 59/ 75 ( 78.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 75 ( 21.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00065.pdb 1 NPRHREIAAFRLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVN 60 usage_00066.pdb 1 --------------KMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVN 46 usage_00262.pdb 1 ---------------MPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVN 45 usage_00361.pdb 1 --------------KMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVN 46 usage_00362.pdb 1 -PRHREIAAFRLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVN 59 usage_01381.pdb 1 ---------------LPTIAAYAYKKSVGQPFLYPDNSLTLVENFLRLTFGFPAEPYQAD 45 usage_01625.pdb 1 NPRHREIAAFRLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVN 60 mPTmAAmcYKySiGQPFvYPrNdLsyagNFLnmmFstPcEPYevn usage_00065.pdb 61 PILERAMDRILILHA 75 usage_00066.pdb 47 PILERAMDRILILHA 61 usage_00262.pdb 46 PILERAMDRILILHA 60 usage_00361.pdb 47 PILERAMDRILILHA 61 usage_00362.pdb 60 PILERAMDRILILHA 74 usage_01381.pdb 46 PEVVRALDMLFILH- 59 usage_01625.pdb 61 PILERAMDRILILHA 75 PileRAmDrilILH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################