################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:44 2021 # Report_file: c_0832_18.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00153.pdb # 2: usage_00154.pdb # 3: usage_00378.pdb # 4: usage_00698.pdb # 5: usage_00782.pdb # 6: usage_00783.pdb # 7: usage_00784.pdb # 8: usage_00929.pdb # 9: usage_00930.pdb # # Length: 87 # Identity: 17/ 87 ( 19.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 73/ 87 ( 83.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 87 ( 14.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00153.pdb 1 KPEDAKNP---QKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYF 57 usage_00154.pdb 1 KPEDAKNP---QKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYF 57 usage_00378.pdb 1 -LSALEKALTP---RTRALLLN-TPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDE 55 usage_00698.pdb 1 KPEDAKNP---QKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYF 57 usage_00782.pdb 1 KPEDAKNP---QKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYF 57 usage_00783.pdb 1 KPEDAKNP---QKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYF 57 usage_00784.pdb 1 KPEDAKNP---QKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYF 57 usage_00929.pdb 1 KPEDAKNP---QKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYF 57 usage_00930.pdb 1 KPEDAKNP---QKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYF 57 pedaknp tpkfLytv ngnNPTGnsltserkkeIyeLARkyDfliIeDdpYyf usage_00153.pdb 58 LQFNKFRVPTFLSMD-VDGRVIRADSF 83 usage_00154.pdb 58 LQFNKFRVPTFLSMD-VDGRVIRADSF 83 usage_00378.pdb 56 LYYGE-RPRRLREFAP--ERTFTVGS- 78 usage_00698.pdb 58 LQFNKFRVPTFLSMD-VDGRVIRADSF 83 usage_00782.pdb 58 LQFNSGRVPTFLSMD-VDGRVIRADSF 83 usage_00783.pdb 58 LQFNSGRVPTFLSMD-VDGRVIRADSF 83 usage_00784.pdb 58 LQFNSGRVPTFLSMD-VDGRVIRADSF 83 usage_00929.pdb 58 LQFNSGRVPTFLSMD-VDGRVIRADSF 83 usage_00930.pdb 58 LQFNSGRVPTFLSMD-VDGRVIRADSF 83 Lqfn Rvptflsmd gRviradS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################