################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:10 2021 # Report_file: c_0888_83.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00026.pdb # 2: usage_00135.pdb # 3: usage_00222.pdb # 4: usage_00225.pdb # 5: usage_00402.pdb # 6: usage_00403.pdb # 7: usage_00405.pdb # 8: usage_00827.pdb # # Length: 93 # Identity: 47/ 93 ( 50.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 93 ( 50.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 46/ 93 ( 49.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00026.pdb 1 --RKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMI 58 usage_00135.pdb 1 -------------------------LPLLKELLFHHEWVVKESGILVLGAIAEGC-QG-I 33 usage_00222.pdb 1 ----------------YRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMI 44 usage_00225.pdb 1 --------------------LLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMI 40 usage_00402.pdb 1 NLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMI 60 usage_00403.pdb 1 ---------------------LPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMI 39 usage_00405.pdb 1 --------------------LLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMI 40 usage_00827.pdb 1 NLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMI 60 LPLLKELLFHHEWVVKESGILVLGAIAEGC QG I usage_00026.pdb 59 PYLPELIPHLIQCL------------------- 72 usage_00135.pdb 34 PYLPELIPHLIQCLSDKKALVRSITCWTLSRY- 65 usage_00222.pdb 45 PYLPELIPHLIQCLSDKKALVRSITCWTLSR-- 75 usage_00225.pdb 41 PYLPELIPHLIQCLSDKKALVRSITCWTLSRYA 73 usage_00402.pdb 61 PYLPELIPHLIQCL------------------- 74 usage_00403.pdb 40 PYLPELIPHLIQCLSDKKALVRSITCWTLSRYA 72 usage_00405.pdb 41 PYLPELIPHLIQCLSDKKALVRSITCWTLSRYA 73 usage_00827.pdb 61 PYLPELIPHLIQCL------------------- 74 PYLPELIPHLIQCL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################