################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:18 2021 # Report_file: c_0612_90.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00198.pdb # 2: usage_00554.pdb # 3: usage_00578.pdb # 4: usage_00833.pdb # 5: usage_01005.pdb # # Length: 80 # Identity: 11/ 80 ( 13.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 80 ( 25.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 80 ( 13.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00198.pdb 1 SGGQRQRVALGRAIIRR------PKVFL-DEPLSNLDAKLRVKRAELKKLQRQL-GVTTI 52 usage_00554.pdb 1 SGGEKRRVAIASVIVHE------PDILILDEPLVGLDREGKTDLLRIVEKWKTL-GKTVI 53 usage_00578.pdb 1 SGGQMRRVALAGVLAYE------PEIICLDEPAAGLDPMGRLEMMQLFKDYQAA-GHTVI 53 usage_00833.pdb 1 SGGQRQRVAIGRTLVAE------PSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMI 54 usage_01005.pdb 1 SGGEGIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKK-IPQVI 59 SGG rva p DEP LD r g t I usage_00198.pdb 53 YVTHDQVEA-T-GDRIAVN- 69 usage_00554.pdb 54 LISHDIETVINHVDRVVVLE 73 usage_00578.pdb 54 LVTHNMDDVADYADDVLALE 73 usage_00833.pdb 55 YVTHDQVEAMTLADKIVVLD 74 usage_01005.pdb 60 LVSHDEELKDA-ADHVIRIS 78 v Hd D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################