################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:10 2021 # Report_file: c_1440_99.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00217.pdb # 2: usage_00257.pdb # 3: usage_00258.pdb # 4: usage_00259.pdb # 5: usage_00260.pdb # 6: usage_00261.pdb # 7: usage_00262.pdb # 8: usage_00263.pdb # 9: usage_00264.pdb # 10: usage_00557.pdb # 11: usage_01029.pdb # 12: usage_01030.pdb # # Length: 38 # Identity: 11/ 38 ( 28.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 38 ( 78.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 38 ( 21.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00217.pdb 1 -EPLLLRVLAELPATELVQACRLVCLRWKELVDG---- 33 usage_00257.pdb 1 PDELLLGIFSCLCLPELL-KVSGVCKRWYRLASD---- 33 usage_00258.pdb 1 PDELLLGIFSCLCLPELL-KVSGVCKRWYRLASD---- 33 usage_00259.pdb 1 PDELLLGIFSCLCLPELL-KVSGVCKRWYRLASD---- 33 usage_00260.pdb 1 PDELLLGIFSCLCLPELL-KVSGVCKRWYRLASD---- 33 usage_00261.pdb 1 PDELLLGIFSCLCLPELL-KVSGVCKRWYRLASD---- 33 usage_00262.pdb 1 PDELLLGIFSCLCLPELL-KVSGVCKRWYRLASD---- 33 usage_00263.pdb 1 -DELLLGIFSCLCLPELL-KVSGVCKRWYRLASDESLW 36 usage_00264.pdb 1 -DELLLGIFSCLCLPELL-KVSGVCKRWYRLASDESLW 36 usage_00557.pdb 1 PDELLLGIFSCLCLPELL-KVSGVCKRWYRLA------ 31 usage_01029.pdb 1 PDELLLGIFSCLCLPELL-KVSGVCKRWYRLASDESLW 37 usage_01030.pdb 1 -DELLLGIFSCLCLPELL-KVSGVCKRWYRLASD---- 32 deLLLgifscLclpELl kvsgVCkRWyrLa #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################