################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:15:16 2021 # Report_file: c_1297_188.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00130.pdb # 2: usage_00131.pdb # 3: usage_00686.pdb # 4: usage_00687.pdb # 5: usage_01252.pdb # 6: usage_01253.pdb # 7: usage_01254.pdb # 8: usage_01257.pdb # 9: usage_01414.pdb # 10: usage_01415.pdb # 11: usage_02535.pdb # 12: usage_02536.pdb # 13: usage_02537.pdb # 14: usage_03263.pdb # 15: usage_03313.pdb # # Length: 31 # Identity: 5/ 31 ( 16.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 31 ( 90.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 31 ( 9.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00130.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_00131.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_00686.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_00687.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_01252.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_01253.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_01254.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_01257.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYV--- 28 usage_01414.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYV--- 28 usage_01415.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYV--- 28 usage_02535.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_02536.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_02537.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 usage_03263.pdb 1 RAEAVELAKKLKFDLMVLRIDRGVAAAGYAN 31 usage_03313.pdb 1 RSEWDILLKDVQCSIISVTKTDKQEAYVLSE 31 RsEwdiLlKdvqcsiisvtktdkqeAyv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################