################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:12:33 2021 # Report_file: c_0816_5.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00034.pdb # 2: usage_00035.pdb # 3: usage_00036.pdb # 4: usage_00040.pdb # 5: usage_00138.pdb # # Length: 85 # Identity: 30/ 85 ( 35.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 85 ( 50.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 85 ( 8.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00034.pdb 1 YGPAAGLVLTVEAIKRDSKRIYPYSLYLQGEYGYNDIVAEVPAVIGKSGIERIIELPLTE 60 usage_00035.pdb 1 YGPAAGLVLTVEAIKRDSKRIYPYSLYLQGEYGYNDIVAEVPAVIGKSGIERIIELPLTE 60 usage_00036.pdb 1 YGPAAGLVLTVEAIKRDSKRIYPYSLYLQGEYGYNDIVAEVPAVIGKSGIERIIELPLTE 60 usage_00040.pdb 1 -APAASAIQMAESYLKDKKRVLPVAAQLSGQYGVKDMYVGVPTVIGANGVERIIEIDLDK 59 usage_00138.pdb 1 -APAASAIEMAESYLKDKKRILPCSAYLEGQYGVKDLFVGVPVIIGKNGVEKIIELELTE 59 PAA E D KRi P s yL G YG D VP vIGk G ErIIEl Lte usage_00034.pdb 61 DEKRKFDEAVQAVKKLVET------ 79 usage_00035.pdb 61 DEKRKFDEAVQAVKKLVET------ 79 usage_00036.pdb 61 DEKRKFDEAVQAVKKLVETL----- 80 usage_00040.pdb 60 DEKAQFDKSVASVAGLCEACIGIAP 84 usage_00138.pdb 60 EEQEMFDKSVESVRELVETVKKLN- 83 dEk FD V V LvEt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################