################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:46 2021 # Report_file: c_1135_78.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00001.pdb # 2: usage_00152.pdb # 3: usage_00154.pdb # 4: usage_00468.pdb # 5: usage_00675.pdb # 6: usage_01216.pdb # # Length: 98 # Identity: 50/ 98 ( 51.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 98 ( 52.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 98 ( 12.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 -SANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVYNSEKSIVG--NW 57 usage_00152.pdb 1 --ANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVYNSEKSIVG--NW 56 usage_00154.pdb 1 --ANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVYNSEKSIVG--NW 56 usage_00468.pdb 1 -SAQLTATYRRLEDLAKQITNPHSTIYKNEKAIRTVKESLAWLHQNFYNVNKDIEGSANW 59 usage_00675.pdb 1 NSAQLTATYRRLEDLAKQITNPHSTIYKNEKAIRTVKESLAWLHQNFYNVNKDIEGSANW 60 usage_01216.pdb 1 -SANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVYNSEKSIVG--NW 57 A LTATYR LE AKQ TNP S Y E RTV S W H YN K I G NW usage_00001.pdb 58 ADYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFV 95 usage_00152.pdb 57 WDYEIGTPRAINNTLSLMKEYFSDEEIKKY-------- 86 usage_00154.pdb 57 WDYEIGTPRAINNTLSLMKEYFSDEEIKKY-------- 86 usage_00468.pdb 60 WDFEIGVPRSITGTLSLMNNYFTDAEIKTYT------- 90 usage_00675.pdb 61 WDFEIGVPRSITGTLSLMNNYFTDAEIKTYT------- 91 usage_01216.pdb 58 WDYEIGTPRAINNTLSLMKEYFSDEEIKKYT------- 88 wD EIG PR I TLSLM YF D EIK Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################