################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:08:11 2021 # Report_file: c_0512_61.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00042.pdb # 2: usage_00336.pdb # 3: usage_00337.pdb # 4: usage_00338.pdb # 5: usage_00339.pdb # 6: usage_00340.pdb # 7: usage_00341.pdb # 8: usage_00342.pdb # 9: usage_00343.pdb # # Length: 81 # Identity: 31/ 81 ( 38.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 76/ 81 ( 93.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 81 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 LGAIRQNIQQMGAHIPQGTLKLAVV-ANAYGHGAVAVAKAIQ--DDVDGFCVSNIDEAIE 57 usage_00336.pdb 1 LDNLRFNLNNIKNLLEEDIKICGVI-ADAYGHGAVEVAKLLEKEK-VDYLAVARTAEGIE 58 usage_00337.pdb 1 -DNLRFNLNNIKNLLEEDIKICGVI-ADAYGHGAVEVAKLLEKEK-VDYLAVARTAEGIE 57 usage_00338.pdb 1 -DNLRFNLNNIKNLLEEDIKICGVI-ADAYGHGAVEVAKLLEKEK-VDYLAVARTAEGIE 57 usage_00339.pdb 1 -DNLRFNLNNIKNLLEEDIKICGVI-ADAYGHGAVEVAKLLEKEK-VDYLAVARTAEGIE 57 usage_00340.pdb 1 LDNLRFNLNNIKNLLEEDIKICGVIKADAYGHGAVEVAKLLEKEK-VDYLAVARTAEGIE 59 usage_00341.pdb 1 LDNLRFNLNNIKNLLEEDIKICGVIKADAYGHGAVEVAKLLEKEK-VDYLAVARTAEGIE 59 usage_00342.pdb 1 LDNLRFNLNNIKNLLEEDIKICGVI-ADAYGHGAVEVAKLLEKEK-VDYLAVARTAEGIE 58 usage_00343.pdb 1 -DNLRFNLNNIKNLLEEDIKICGVI-ADAYGHGAVEVAKLLEKEK-VDYLAVARTAEGIE 57 dnlRfNlnniknlleedikicgVi AdAYGHGAVeVAKlle k VDylaVartaEgIE usage_00042.pdb 58 LRQAGLSKPILILGVSEIEAV 78 usage_00336.pdb 59 LRQNGITLPILNLGYTPDEAF 79 usage_00337.pdb 58 LRQNGITLPILNLGYTPDEAF 78 usage_00338.pdb 58 LRQNGITLPILNLGYTPDEAF 78 usage_00339.pdb 58 LRQNGITLPILNLGYTPDEAF 78 usage_00340.pdb 60 LRQNGITLPILNLGYTPDEAF 80 usage_00341.pdb 60 LRQNGITLPILNLGYTPDEAF 80 usage_00342.pdb 59 LRQNGITLPILNLGYTPDEAF 79 usage_00343.pdb 58 LRQNGITLPILNLGYTPDEAF 78 LRQnGitlPILnLGytpdEAf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################