################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:14:49 2021 # Report_file: c_0768_23.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00121.pdb # 2: usage_00488.pdb # 3: usage_00544.pdb # 4: usage_00545.pdb # 5: usage_00546.pdb # 6: usage_00547.pdb # 7: usage_00548.pdb # 8: usage_00549.pdb # 9: usage_00550.pdb # 10: usage_00551.pdb # 11: usage_00552.pdb # 12: usage_00725.pdb # 13: usage_00738.pdb # 14: usage_00739.pdb # # Length: 54 # Identity: 18/ 54 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 54 ( 35.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 54 ( 7.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00121.pdb 1 NIKVMLNTDYREIADFIP----FQHMIYTGPVDAFFDFCYGKLPYRSLEFRHET 50 usage_00488.pdb 1 RIEVRLDTDWFDVRDDLRAANPDAPVVYTGPLDRYFDYAEGRLGWRTLDFELEV 54 usage_00544.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00545.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00546.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00547.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00548.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00549.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00550.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00551.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00552.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00725.pdb 1 NIKVMLNTDYREIADFIP----FQHMIYTGPVDAFFDFCYGKLPYRSLEFRHET 50 usage_00738.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 usage_00739.pdb 1 RIEVRLNTDWFDVRGQLRPGSPAAPVVYTGPLDRYFDYAEGRLGWRTLDFEVEV 54 I V LnTD YTGP D FD G L R L F E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################