################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:49 2021 # Report_file: c_1485_6.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00043.pdb # 2: usage_01257.pdb # 3: usage_01258.pdb # 4: usage_02063.pdb # 5: usage_02064.pdb # # Length: 74 # Identity: 18/ 74 ( 24.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/ 74 ( 66.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 25/ 74 ( 33.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00043.pdb 1 KDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPG---NARKMDKSTVLQKSIDFLRKHKEI 57 usage_01257.pdb 1 ------DNHNLIERRRRFNINDRIKELGTLIPK--DPDMRWNKGTILKASVDYIRKLQRE 52 usage_01258.pdb 1 -----KDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQRE 55 usage_02063.pdb 1 --------HNLIERRRRFNINDRIKELGTLIPK--S--MRWNKGTILKASVDYIRKLQRE 48 usage_02064.pdb 1 --RQKKDNHNLIERRRRFNINDRIKELGTLIPKS-DPDMRWNKGTILKASVDYIRKLQRE 57 hNliErrRRfniNdrIKELGtliPk mrwnKgTiLkaSvDyiRKlqre usage_00043.pdb 58 TAWLEH-------- 63 usage_01257.pdb 53 QQRAKDLE------ 60 usage_01258.pdb 56 QQ------------ 57 usage_02063.pdb 49 QQRAKDLE------ 56 usage_02064.pdb 58 QQRAKDLENRQKKL 71 qq #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################