################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:24 2021 # Report_file: c_0907_3.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00264.pdb # 2: usage_00265.pdb # 3: usage_00266.pdb # 4: usage_00267.pdb # 5: usage_00563.pdb # 6: usage_00564.pdb # 7: usage_00699.pdb # 8: usage_00700.pdb # # Length: 77 # Identity: 36/ 77 ( 46.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 77 ( 46.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 77 ( 5.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00264.pdb 1 GRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLL 60 usage_00265.pdb 1 --VLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLL 58 usage_00266.pdb 1 GRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLL 60 usage_00267.pdb 1 GRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLL 60 usage_00563.pdb 1 GRALALATTEPGLQLYTADHLDGTLTGTSGVPYGPAAGLALETQHFPDSPNRPDFPSTVL 60 usage_00564.pdb 1 GRALALATTEPGLQLYTADHLDGTLTGTSGVPYGPAAGLALETQHFPDSPNRPDFPSTVL 60 usage_00699.pdb 1 GRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLL 60 usage_00700.pdb 1 GRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLL 60 L TT PG Q YT LDGTL G G Y G LETQ PD N P FP L usage_00264.pdb 61 RPGEEYDHTTWFKFS-- 75 usage_00265.pdb 59 RPGEEYDHTTWFKFSVA 75 usage_00266.pdb 61 RPGEEYDHTTWFKFS-- 75 usage_00267.pdb 61 RPGEEYDHTTWFKFS-- 75 usage_00563.pdb 61 RPGESYRSETVYAFS-- 75 usage_00564.pdb 61 RPGESYRSETVYAFS-- 75 usage_00699.pdb 61 RPGEEYDHTTWFKFS-- 75 usage_00700.pdb 61 RPGEEYDHTTWFKFS-- 75 RPGE Y T FS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################