################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:15:59 2021 # Report_file: c_0960_69.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00030.pdb # 2: usage_00031.pdb # 3: usage_00032.pdb # 4: usage_00033.pdb # 5: usage_00034.pdb # 6: usage_00060.pdb # 7: usage_00100.pdb # 8: usage_00156.pdb # 9: usage_00563.pdb # 10: usage_00564.pdb # 11: usage_00565.pdb # 12: usage_00700.pdb # 13: usage_00701.pdb # 14: usage_00702.pdb # # Length: 32 # Identity: 25/ 32 ( 78.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 32 ( 78.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 32 ( 9.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00030.pdb 1 LYSFYFGDYGHISVQGPYITYEDSYLAITGGS 32 usage_00031.pdb 1 LYSFYFGDYGHISVQGPYITYEDSYLAITGGS 32 usage_00032.pdb 1 LYSFYFGDYGHISVQGPYITYEDSYLAITGGS 32 usage_00033.pdb 1 LYSFYFGDYGHISVQGPYITYEDSYLAITGGS 32 usage_00034.pdb 1 LYSFYFGDYGHISVQGPYITYEDSYLAITGGS 32 usage_00060.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAITGGA 32 usage_00100.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAIT--- 29 usage_00156.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAIT--- 29 usage_00563.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAITGGA 32 usage_00564.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAITGGA 32 usage_00565.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAITGGA 32 usage_00700.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAITGGA 32 usage_00701.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAITGGA 32 usage_00702.pdb 1 TYSFYFGDYGHLSVQGPYLTYEDSFLAITGGA 32 YSFYFGDYGH SVQGPY TYEDS LAIT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################