################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:22 2021 # Report_file: c_1426_55.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00076.pdb # 2: usage_00328.pdb # 3: usage_00448.pdb # 4: usage_00607.pdb # 5: usage_00614.pdb # 6: usage_00642.pdb # 7: usage_00644.pdb # 8: usage_00788.pdb # 9: usage_00789.pdb # # Length: 47 # Identity: 15/ 47 ( 31.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 47 ( 40.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 47 ( 8.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00076.pdb 1 -ASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGI- 45 usage_00328.pdb 1 DAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLE 47 usage_00448.pdb 1 DAATQKLLNRGARLTELMKQPQYSPLTNAEIVIVIYAGTKGYLDGIP 47 usage_00607.pdb 1 -ASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIE 46 usage_00614.pdb 1 ---TKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGI- 43 usage_00642.pdb 1 -KATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIP 46 usage_00644.pdb 1 -KATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIP 46 usage_00788.pdb 1 DASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIE 47 usage_00789.pdb 1 DASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIE 47 T L RG R lKQ P eEqV IYA G D i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################