################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:04:22 2021 # Report_file: c_0199_48.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00109.pdb # 2: usage_00110.pdb # 3: usage_00277.pdb # 4: usage_00354.pdb # # Length: 169 # Identity: 41/169 ( 24.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 78/169 ( 46.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/169 ( 9.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00109.pdb 1 DDRVL-EEIV-FY--REKYGNPNSA-HG-GIEANL-HEKAREKVAKVLGVSPS-EIFFTS 52 usage_00110.pdb 1 DDRVL-EEIV-FY--REKYGNPNSA-HG-GIEANL-HEKAREKVAKVLGVSPS-EIFFTS 52 usage_00277.pdb 1 DPRVA-EKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPR-EIVFTS 58 usage_00354.pdb 1 -ERILEAMLP-YM--TESFGNPSSV-HSYGFKAREAVQEAREKVAKLVNGG-GGTVVFTS 54 Rvl e f e GNP S H G A ARekvAk g ei FTS usage_00109.pdb 53 CATESINWILKTVAETFEKRKRTIITTPIEHKAVLETK-YL-SKGFKVKYVPVDSRGVVK 110 usage_00110.pdb 53 CATESINWILKTVAETFEKRKRTIITTPIEHKAVLETK-YL-SKGFKVKYVPVDSRGVVK 110 usage_00277.pdb 59 GATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIID 118 usage_00354.pdb 55 GATEANNLAIIGYAMRNARKGKHILVSAVEHMSVINPAKFLQKQGFEVEYIPVGKYGEVD 114 ATEs N k A k Iit EHkaVl t L GF V Y pv G v usage_00109.pdb 111 LEELEKLVDEDTFLVSI-AANNEVGTIQPVEDVTRIVKKKNKETLVHVD 158 usage_00110.pdb 111 LEELEKLVDEDTFLVSI-AANNEVGTIQPVEDVTRIVKKKNKETLVHVD 158 usage_00277.pdb 119 LKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGII--YHVD 165 usage_00354.pdb 115 VSFIDQKLRDDTILVSVQHANNEIGTIQPVEEISEVLAGKAA---LHID 160 l ele DT LVSi aNNE GtiQpve k HvD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################