################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:19:18 2021
# Report_file: c_1480_11.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00977.pdb
#   2: usage_00978.pdb
#   3: usage_00979.pdb
#   4: usage_00980.pdb
#   5: usage_03402.pdb
#
# Length:         74
# Identity:       56/ 74 ( 75.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     56/ 74 ( 75.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           18/ 74 ( 24.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00977.pdb         1  ---------------LSHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGPMI   45
usage_00978.pdb         1  ----------------SHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGPMI   44
usage_00979.pdb         1  NPDQVVLVVRVLAEGLSHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGPMI   60
usage_00980.pdb         1  ---------------LSHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGPMI   45
usage_03402.pdb         1  -PDQVVLVVRVLAEGLSHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGPMI   59
                                           SHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGPMI

usage_00977.pdb        46  QDMLFMQLRHMME-   58
usage_00978.pdb        45  QDMLFMQLRHMME-   57
usage_00979.pdb        61  QDMLFMQLRHMM--   72
usage_00980.pdb        46  QDMLFMQLRHMMET   59
usage_03402.pdb        60  QDMLFMQLRHMME-   72
                           QDMLFMQLRHMM  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################