################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:40:24 2021 # Report_file: c_1278_11.html ################################################################################################ #==================================== # Aligned_structures: 21 # 1: usage_00010.pdb # 2: usage_00037.pdb # 3: usage_00040.pdb # 4: usage_00041.pdb # 5: usage_00042.pdb # 6: usage_00043.pdb # 7: usage_00104.pdb # 8: usage_00106.pdb # 9: usage_00163.pdb # 10: usage_00212.pdb # 11: usage_00220.pdb # 12: usage_00221.pdb # 13: usage_00226.pdb # 14: usage_00267.pdb # 15: usage_00283.pdb # 16: usage_00284.pdb # 17: usage_00292.pdb # 18: usage_00297.pdb # 19: usage_00300.pdb # 20: usage_00301.pdb # 21: usage_00302.pdb # # Length: 50 # Identity: 10/ 50 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 50 ( 26.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 50 ( 20.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 LVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDA--------- 41 usage_00037.pdb 1 LIVIDTYEHAYYVDYKNKRPPYIDAFFKNINWDVVNERFEKAMKAYEALK 50 usage_00040.pdb 1 LLALDVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNG----- 45 usage_00041.pdb 1 LLALDVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNG----- 45 usage_00042.pdb 1 LLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMACKK------ 44 usage_00043.pdb 1 LLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMA--------- 41 usage_00104.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK------ 44 usage_00106.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK------ 44 usage_00163.pdb 1 ILGIDVWEHAYYLRYQNKRADYLTTIWDVINWEEVSARYEKALK------ 44 usage_00212.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMA--------- 41 usage_00220.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK------ 44 usage_00221.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK------ 44 usage_00226.pdb 1 LVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDA--------- 41 usage_00267.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMA--------- 41 usage_00283.pdb 1 LFGIDVWEHAYYLQYKNVRPDYVHAIWKIANWKNISERFANARQ------ 44 usage_00284.pdb 1 LLGIDVAEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK------ 44 usage_00292.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK------ 44 usage_00297.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK------ 44 usage_00300.pdb 1 LVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYE---------- 40 usage_00301.pdb 1 LVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKE-------- 42 usage_00302.pdb 1 LVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKE-------- 42 l D EHAY l Y N Y w NW #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################