################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:46 2021 # Report_file: c_0832_39.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00060.pdb # 2: usage_00662.pdb # 3: usage_00663.pdb # 4: usage_00664.pdb # 5: usage_00667.pdb # 6: usage_00814.pdb # # Length: 74 # Identity: 8/ 74 ( 10.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 74 ( 20.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 74 ( 31.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00060.pdb 1 ----YAATVKHNATTLLESGVTTIRTLGDVGYEVVTLRDQIDAGQILGPRILASGPLAIP 56 usage_00662.pdb 1 P-ASSGARLARGCWEALQNGYTSYRDLAG---YGCEVAKAINDGTIVGPNVYSSGAAL-- 54 usage_00663.pdb 1 P-ASSGARLARGCWEALQNGYTSYRDLAG---YGCEVAKAINDGTIVGPNVYSSGAAL-- 54 usage_00664.pdb 1 P-ASSGARLARGCWEALQNGYTSYRDLAG---YGCEVAKAINDGTIVGPNVYSSGAAL-- 54 usage_00667.pdb 1 P-ASSGARLARGCWEALQNGYTSYRDLAG---YGCEVAKAINDGTIVGPNVYSSGAAL-- 54 usage_00814.pdb 1 -EREQAILATQHAYVTFKSGFTTVRQVGDSGLVAISLRDAINSGKLAGPRIFAAGKTI-- 57 a l G T R l aIn G i GP sG usage_00060.pdb 57 EGHGAPLIALTS-- 68 usage_00662.pdb 55 ------------SQ 56 usage_00663.pdb 55 ------------SQ 56 usage_00664.pdb 55 ------------SQ 56 usage_00667.pdb 55 ------------SQ 56 usage_00814.pdb 58 ------------AT 59 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################