################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:45 2021 # Report_file: c_1365_15.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00036.pdb # 2: usage_00099.pdb # 3: usage_00100.pdb # 4: usage_00388.pdb # 5: usage_00632.pdb # 6: usage_00633.pdb # # Length: 65 # Identity: 13/ 65 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 65 ( 33.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/ 65 ( 40.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00036.pdb 1 PEVIDFAHKLESVVIATVESGKMTKDLAILIG--P-----EQDWLNSEEFLDAIADNLEK 53 usage_00099.pdb 1 KELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQR-S-DYLNTFEFMDKLGENLKI 58 usage_00100.pdb 1 KELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQR-S-DYLNTFEFMDKLGENLKI 58 usage_00388.pdb 1 -EVCEFADKLEKAVINTIESGVITKDLQPFTE------PPIDKYVTLEEFIDEVKKNLEK 53 usage_00632.pdb 1 ------------VSIETIEAGFMTKDLAACIKGLPNVQR-S-DYLNTFEFMDKLGENLKI 46 usage_00633.pdb 1 ------------VSIETIEAGFMTKDLAACIKGLPNVQR-S-DYLNTFEFMDKLGENLKI 46 v I TiE G mTKDLa i dyln EF D NL usage_00036.pdb ----- usage_00099.pdb 59 KLAQ- 62 usage_00100.pdb 59 KLAQ- 62 usage_00388.pdb 54 L---- 54 usage_00632.pdb 47 KLAQA 51 usage_00633.pdb 47 KLAQA 51 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################