################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:31 2021 # Report_file: c_1228_15.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00388.pdb # 2: usage_00389.pdb # 3: usage_00390.pdb # 4: usage_00391.pdb # 5: usage_00462.pdb # 6: usage_00463.pdb # 7: usage_00524.pdb # 8: usage_00793.pdb # # Length: 64 # Identity: 20/ 64 ( 31.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 64 ( 31.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/ 64 ( 48.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00388.pdb 1 -LVVTLCGDA-ADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 58 usage_00389.pdb 1 DLVVTLCGDA-ADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 59 usage_00390.pdb 1 DLVVTLC--------------VKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 46 usage_00391.pdb 1 ----------------------KREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 38 usage_00462.pdb 1 DLVVTLCSD-ADNNCPILPPNVKKEHWGFDDPA--GK----EWSEFQRVRDEIKLAIEKF 53 usage_00463.pdb 1 --------------------NVKKEHWGFDDPA--GK----EWSEFQRVRDEIKLAIEKF 34 usage_00524.pdb 1 -LVVTLCGDA-ADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEF 58 usage_00793.pdb 1 -LVVTLCSD-ADNNCPILPPNVKKEHWGFDDPA--GK----EWSEFQRVRDEIKLAIEKF 52 K EHWGFDDPA W FQRVRDEI F usage_00388.pdb 59 AETG 62 usage_00389.pdb 60 AETG 63 usage_00390.pdb 47 AETG 50 usage_00391.pdb 39 AETG 42 usage_00462.pdb 54 KLR- 56 usage_00463.pdb 35 KLR- 37 usage_00524.pdb 59 AETG 62 usage_00793.pdb 53 K--- 53 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################