################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:06 2021 # Report_file: c_1307_72.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00031.pdb # 2: usage_00195.pdb # 3: usage_00480.pdb # 4: usage_01355.pdb # 5: usage_01356.pdb # 6: usage_01404.pdb # 7: usage_01405.pdb # 8: usage_01479.pdb # 9: usage_01966.pdb # 10: usage_02546.pdb # 11: usage_02636.pdb # # Length: 32 # Identity: 28/ 32 ( 87.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 32 ( 90.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 32 ( 9.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00031.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_00195.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_00480.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_01355.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_01356.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_01404.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSW--- 29 usage_01405.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_01479.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_01966.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_02546.pdb 1 SEAEISHTQKATLVCLATGFYPDHVELSWWVN 32 usage_02636.pdb 1 SKAEISHTQKATLVCLATGFYPDHVELSWWVN 32 SeAEISHTQKATLVCLATGFYPDHVELSW #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################