################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:01:43 2021 # Report_file: c_0515_5.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00155.pdb # 2: usage_00197.pdb # 3: usage_00250.pdb # 4: usage_00251.pdb # # Length: 128 # Identity: 49/128 ( 38.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 125/128 ( 97.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/128 ( 2.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00155.pdb 1 -PDVLVRDVEMMKEARCNVMSVGIFSWSALEPEEGRYTFDWMDQVLNRLHENGISVFLAT 59 usage_00197.pdb 1 ---VWDDDIRLMKKAGVNLVSVGIFSWAKIEPEEGKYDFDWLDRAIDKLGKAGIAVDLAS 57 usage_00250.pdb 1 ---VWDDDIRLMKKAGVNLVSVGIFSWAKIEPEEGKYDFDWLDRAIDKLGKAGIAVDLAS 57 usage_00251.pdb 1 PEEVWDDDIRLMKKAGVNLVSVGIFSWAKIEPEEGKYDFDWLDRAIDKLGKAGIAVDLAS 60 VwddDirlMKkAgvNlvSVGIFSWakiEPEEGkYdFDWlDraidkLgkaGIaVdLAs usage_00155.pdb 60 PSGARPAWMSQKYPQVLRVGRDRVPALHGGRHNHCMSSPVYREKVQLMNGQLAKRYAHHP 119 usage_00197.pdb 58 ATASPPMWLTQAHPEVLWKDERGDTVWPGAREHWRPTSPVFREYALNLCRRMAEHYKGNP 117 usage_00250.pdb 58 ATASPPMWLTQAHPEVLWKDERGDTVWPGAREHWRPTSPVFREYALNLCRRMAEHYKGNP 117 usage_00251.pdb 61 ATASPPMWLTQAHPEVLWKDERGDTVWPGAREHWRPTSPVFREYALNLCRRMAEHYKGNP 120 ataspPmWltQahPeVLwkdergdtvwpGaRehwrptSPVfREyalnlcrrmAehYkgnP usage_00155.pdb 120 AVIGWHIS 127 usage_00197.pdb 118 YVVAWHVS 125 usage_00250.pdb 118 YVVAWHVS 125 usage_00251.pdb 121 YVVAWHVS 128 yVvaWHvS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################