################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:56 2021 # Report_file: c_1395_126.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00037.pdb # 2: usage_00041.pdb # 3: usage_00042.pdb # 4: usage_00063.pdb # 5: usage_00323.pdb # 6: usage_00387.pdb # 7: usage_01201.pdb # 8: usage_01202.pdb # 9: usage_01483.pdb # 10: usage_01484.pdb # # Length: 36 # Identity: 7/ 36 ( 19.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 36 ( 27.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 36 ( 30.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00037.pdb 1 ------LAQKRIFGLMEKDSYPRFLRSDLYLDLI-- 28 usage_00041.pdb 1 -----DEAQKKIFNLMEKDSYRRFLKSRFYLDLT-- 29 usage_00042.pdb 1 -----DEAQKKIFNLMEKDSYRRFLKSRFYL----- 26 usage_00063.pdb 1 ----FDAAQSRVYQLMEQDSYTRFLKSDIYLDLM-- 30 usage_00323.pdb 1 DPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYT-- 34 usage_00387.pdb 1 TSGCFTTAQKRVYSLMENDSYPRFLKSEFYQDLC-- 34 usage_01201.pdb 1 ----FTTAQKRVYSLMENNSYPRFLESEFYQDLCK- 31 usage_01202.pdb 1 ----FTTAQKRVYSLMENNSYPRFLESEFYQDLCK- 31 usage_01483.pdb 1 GRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQA 36 usage_01484.pdb 1 GRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQ- 35 AQ lM sY rF S Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################