################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:03 2021 # Report_file: c_1413_43.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00661.pdb # 2: usage_00919.pdb # 3: usage_00982.pdb # 4: usage_01370.pdb # 5: usage_01397.pdb # # Length: 88 # Identity: 25/ 88 ( 28.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 88 ( 51.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 88 ( 23.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00661.pdb 1 SDEEIERLRKFARCIGLLFQVVDDILDVTIAD---KLTYPKLMGLEKSREFAEKLNTEAR 57 usage_00919.pdb 1 -EEEVAKLRKFANCIGLLFQVVDDILDVT---K--KTTYPKLIGVEKSKEFADRLNREAQ 54 usage_00982.pdb 1 TEEEIEKLRKYARCIGLLFQVVDDILDV--------LTYPRLIGLERSKEVAEKLRREAE 52 usage_01370.pdb 1 -AEQFDRLDHYAKCIGLAFQIQDDILDEE---SD-KPNYPALLGLSGAKEKAEEMHEAAL 55 usage_01397.pdb 1 -DEEIERLRKFARCIGLLFQVVDDILDVT---KSSKLTYPK-LGLEKSREFAEKLNTEAR 55 Ee Lrk A CIGLlFQvvDDILDv tYP Gle s E Ae l eA usage_00661.pdb 58 DQLLGFDSDKVAPLLALANYIA------ 79 usage_00919.pdb 55 EQLLHFHPHRAAPLIALANYIA------ 76 usage_00982.pdb 53 EQLLGFDPSKAAPLVALASYIA------ 74 usage_01370.pdb 56 ESLAGFG-PEADLLRELARFIIQRQSAE 82 usage_01397.pdb 56 DQLLGFDSDKVAPLLALA---------- 73 qLlgF apL aLA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################