################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:00:11 2021 # Report_file: c_1484_331.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_01986.pdb # 2: usage_02720.pdb # 3: usage_03894.pdb # 4: usage_03910.pdb # # Length: 82 # Identity: 8/ 82 ( 9.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 82 ( 30.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/ 82 ( 32.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01986.pdb 1 -----------------HYIPTLDQLIALLKSKLPEWD-VPMLARTHGQPASPTNLAKEF 42 usage_02720.pdb 1 -------------------LPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEF 41 usage_03894.pdb 1 CYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRC 60 usage_03910.pdb 1 --------------------PKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRC 40 P L i L kE a p lg TH QpA tt gk usage_01986.pdb 43 MVWIERLEEQRTMLLS------ 58 usage_02720.pdb 42 SGYVQQVKYAMTRIKAAMPRIY 63 usage_03894.pdb 61 CLWIQDLCMDLQNLKRVRDDL- 81 usage_03910.pdb 41 CLWIQDLCMDLQNLKRVRDDL- 61 wiq l lk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################