################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:45 2021 # Report_file: c_0940_24.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00286.pdb # 2: usage_00650.pdb # 3: usage_00818.pdb # 4: usage_00819.pdb # 5: usage_01060.pdb # 6: usage_01170.pdb # 7: usage_01171.pdb # 8: usage_01172.pdb # 9: usage_01514.pdb # 10: usage_01633.pdb # 11: usage_01634.pdb # # Length: 61 # Identity: 5/ 61 ( 8.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 61 ( 70.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 61 ( 29.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00286.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_00650.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_00818.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_00819.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_01060.pdb 1 APQVFYFEPH----KLWYLVYQ-NG-----------NAAYSTNPD-INDPSKWTAPE-VF 42 usage_01170.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_01171.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_01172.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_01514.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_01633.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 usage_01634.pdb 1 NLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFY 60 nlvtmttaPr gdratwfg yy vglellvnh alDParWTiqk fy usage_00286.pdb 61 Q 61 usage_00650.pdb 61 Q 61 usage_00818.pdb 61 Q 61 usage_00819.pdb 61 Q 61 usage_01060.pdb 43 Y 43 usage_01170.pdb 61 Q 61 usage_01171.pdb 61 Q 61 usage_01172.pdb 61 Q 61 usage_01514.pdb 61 Q 61 usage_01633.pdb 61 Q 61 usage_01634.pdb 61 Q 61 q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################