################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:17:27 2021 # Report_file: c_0621_2.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00080.pdb # 2: usage_00081.pdb # 3: usage_00086.pdb # 4: usage_00087.pdb # 5: usage_00100.pdb # 6: usage_00172.pdb # 7: usage_00192.pdb # 8: usage_00193.pdb # 9: usage_00194.pdb # 10: usage_00195.pdb # # Length: 66 # Identity: 31/ 66 ( 47.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 66 ( 47.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 66 ( 1.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00080.pdb 1 KADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFD 60 usage_00081.pdb 1 KADAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFD 60 usage_00086.pdb 1 -APAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFD 59 usage_00087.pdb 1 KAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFEFD 60 usage_00100.pdb 1 KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD 60 usage_00172.pdb 1 KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD 60 usage_00192.pdb 1 -ADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD 59 usage_00193.pdb 1 -ADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD 59 usage_00194.pdb 1 -ADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD 59 usage_00195.pdb 1 KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD 60 A A FWR G PW F L H G A AL TIDLTC S FEFD usage_00080.pdb 61 IFTRLF 66 usage_00081.pdb 61 IFTRLF 66 usage_00086.pdb 60 VFTRLF 65 usage_00087.pdb 61 VFTRLF 66 usage_00100.pdb 61 IFTRLF 66 usage_00172.pdb 61 IFTRLF 66 usage_00192.pdb 60 IFTRLF 65 usage_00193.pdb 60 IFTRLF 65 usage_00194.pdb 60 IFTRLF 65 usage_00195.pdb 61 IFTRLF 66 FTRLF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################