################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:43 2021 # Report_file: c_0787_112.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00018.pdb # 2: usage_00263.pdb # 3: usage_00264.pdb # 4: usage_00926.pdb # 5: usage_00927.pdb # 6: usage_00931.pdb # 7: usage_00932.pdb # 8: usage_01040.pdb # # Length: 81 # Identity: 23/ 81 ( 28.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 81 ( 29.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 81 ( 4.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 LAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVAYVNAAGTSTPANEKG 60 usage_00263.pdb 1 LAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVAYVNAHGTSTPANEKG 60 usage_00264.pdb 1 LAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVAYVNAHGTSTPANEKG 60 usage_00926.pdb 1 HAEIVGFGCNSDGAHMTQPT--ASTMARAMQLALEDAKLDANAIAYVNAHGTSTDRGDVA 58 usage_00927.pdb 1 HAEIVGFGCNSDGAHMTQPT--ASTMARAMQLALEDAKLDANAIAYVNAHGTSTDRGDVA 58 usage_00931.pdb 1 IAEIIGYGTTADAYHMTAGPDDGSGAMRAMKLALRMGDVAPEQVDYVNAHATSTPVGDAG 60 usage_00932.pdb 1 IAEIIGYGTTADAYHMTAGPDDGSGAMRAMKLALRMGDVAPEQVDYVNAHATSTPVGDAG 60 usage_01040.pdb 1 LAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEAEISPEQVAYVNAHGTSTPANEKG 60 AE G G D HMT A LAL YVNAh TST usage_00018.pdb 61 ESGAIVAVLGKEVPVSS--TK 79 usage_00263.pdb 61 ESGAIVAVLGKAVPVSS--TK 79 usage_00264.pdb 61 ESGAIVAVLGKAVPVSS--TK 79 usage_00926.pdb 59 ESQATARTFGERMPISS--LK 77 usage_00927.pdb 59 ESQATARTFGERMPISS--LK 77 usage_00931.pdb 61 EIEALKTVFGVGAGPAISSTK 81 usage_00932.pdb 61 EIEALKTVFGVGAGPAISSTK 81 usage_01040.pdb 61 ESGAIVAVLGKEVPVSS--TK 79 E A G K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################