################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:16:50 2021
# Report_file: c_0384_9.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00023.pdb
#   2: usage_00024.pdb
#   3: usage_00025.pdb
#   4: usage_00029.pdb
#   5: usage_00053.pdb
#   6: usage_00054.pdb
#   7: usage_00055.pdb
#   8: usage_00072.pdb
#   9: usage_00073.pdb
#  10: usage_00074.pdb
#
# Length:         82
# Identity:       47/ 82 ( 57.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     47/ 82 ( 57.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           26/ 82 ( 31.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00023.pdb         1  ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG   38
usage_00024.pdb         1  ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG   38
usage_00025.pdb         1  ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG   38
usage_00029.pdb         1  ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG   38
usage_00053.pdb         1  ----------------------CELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNG   38
usage_00054.pdb         1  ----------------------CELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNG   38
usage_00055.pdb         1  HFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG   60
usage_00072.pdb         1  ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG   38
usage_00073.pdb         1  ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG   38
usage_00074.pdb         1  ----------------------CELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNG   38
                                                 CELETMTGEKVK VV  EGDNK VTTFK IKSVTE NG

usage_00023.pdb        39  DIITNTMTLGDIVFKRISK---   57
usage_00024.pdb        39  DIITNTMTLGDIVFKRIS----   56
usage_00025.pdb        39  DIITNTMTLGDIVFKRISK---   57
usage_00029.pdb        39  DIITNTMTLGDIVFKRISKRIG   60
usage_00053.pdb        39  DTITNTMTLGDIVYKRVSKR--   58
usage_00054.pdb        39  DTITNTMTLGDIVYKRVSKRI-   59
usage_00055.pdb        61  DIITNTMTLGDIVFKRISKR--   80
usage_00072.pdb        39  DIITNTMTLGDIVFKRISKRIG   60
usage_00073.pdb        39  DIITNTMTLGDIVFKRISKRIG   60
usage_00074.pdb        39  DIITNTMTLGDIVFKRISKR--   58
                           D ITNTMTLGDIV KR S    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################