################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:58 2021 # Report_file: c_0832_79.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00236.pdb # 2: usage_00292.pdb # 3: usage_00295.pdb # 4: usage_00362.pdb # 5: usage_00854.pdb # # Length: 70 # Identity: 10/ 70 ( 14.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 70 ( 21.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 70 ( 15.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00236.pdb 1 --GVFDRLANLRELHLWGNQLVS--L-PPGVFDNLANLEKLWLNSNQLTSLP-AGLFDRL 54 usage_00292.pdb 1 ETGAFNGLANLEVLTLTQCNLDGAVL-SGNFFKPLTSLEMLVLRDNNIKKIQPASFFLNM 59 usage_00295.pdb 1 ETGAFNGLANLEVLTLTQCNLDGAVL-SGNFFKPLTSLEMLVLRDNNIKKIQPASFFLNM 59 usage_00362.pdb 1 --RAFSGLNSLEQLTLEKCNLTS--I-PTEALSHLHGLIVLRLRHLNINAIR-DYSFKRL 54 usage_00854.pdb 1 -----AQLSRLQCLRLSHNSISQ--AVNGSQFVPLTSLQVLDLSHNKLDLYH-GRSFTEL 52 L L L L l f L L L L n F usage_00236.pdb 55 VNLEHLGL-- 62 usage_00292.pdb 60 RRFHVLDLTF 69 usage_00295.pdb 60 RRFHVLDL-- 67 usage_00362.pdb 55 YRLKVLEIS- 63 usage_00854.pdb 53 PRLEALDL-- 60 r L l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################