################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:40:52 2021
# Report_file: c_1459_90.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00598.pdb
#   2: usage_01080.pdb
#   3: usage_01183.pdb
#   4: usage_01286.pdb
#   5: usage_01564.pdb
#   6: usage_01565.pdb
#   7: usage_01566.pdb
#   8: usage_01567.pdb
#   9: usage_01587.pdb
#  10: usage_01596.pdb
#  11: usage_01597.pdb
#
# Length:         33
# Identity:       11/ 33 ( 33.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     11/ 33 ( 33.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 33 ( 12.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00598.pdb         1  NTLRLSYATLDREGIAEGVRRLGRALKGLLA--   31
usage_01080.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEEL---   30
usage_01183.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEELKA-   32
usage_01286.pdb         1  NTLRLSYATLDREGIAEGVRRLGRALKGLLALV   33
usage_01564.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEEL---   30
usage_01565.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEE----   29
usage_01566.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEE----   29
usage_01567.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEEL---   30
usage_01587.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEEL---   30
usage_01596.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEEL---   30
usage_01597.pdb         1  NTMRLNFTYVDEDKIMEGIKRLAETIKEEL---   30
                           NT RL     D   I EG  RL    K      


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################