################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:02 2021 # Report_file: c_1275_23.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00018.pdb # 2: usage_00099.pdb # 3: usage_00110.pdb # 4: usage_00135.pdb # 5: usage_00136.pdb # 6: usage_00350.pdb # 7: usage_00456.pdb # 8: usage_00457.pdb # 9: usage_00458.pdb # 10: usage_00479.pdb # 11: usage_00480.pdb # # Length: 35 # Identity: 19/ 35 ( 54.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 35 ( 82.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 35 ( 17.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQAN 30 usage_00099.pdb 1 DESYQVGRGPHLRDLGPIESYLSIDEVIRVAKLS- 34 usage_00110.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQA- 29 usage_00135.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQAN 30 usage_00136.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQAN 30 usage_00350.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQAN 30 usage_00456.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQAN 30 usage_00457.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQAN 30 usage_00458.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQAN 30 usage_00479.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQAN 30 usage_00480.pdb 1 DESYLVGS-----DLGPAESYLNIERIIDVAKQA- 29 DESYlVGs DLGPaESYLnIeriIdVAKqa #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################