################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:06 2021 # Report_file: c_0758_68.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00363.pdb # 2: usage_00370.pdb # 3: usage_00371.pdb # 4: usage_00372.pdb # 5: usage_00382.pdb # 6: usage_00383.pdb # 7: usage_00384.pdb # # Length: 63 # Identity: 36/ 63 ( 57.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 63 ( 57.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 63 ( 6.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00363.pdb 1 PILLFDEATSALDTRTEQDILSTR-A--VASHRTTISIAHRLSTIADSDTILVLDQGRLA 57 usage_00370.pdb 1 -ILLFDEATSALDTRTEQDILSTR-A--VASHRTTISIAHRLSTIADSDTILVLDQGRLA 56 usage_00371.pdb 1 PILLFDEATSALDTRTEQDILSTR-A--VASHRTTISIAHRLSTIADSDTILVLDQGRLA 57 usage_00372.pdb 1 -ILLFDEATSALDTRTEQDILSTR-A--VASHRTTISIAHRLSTIADSDTILVLDQGRLA 56 usage_00382.pdb 1 -IMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDNGRVR 59 usage_00383.pdb 1 -IMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDNGRVR 59 usage_00384.pdb 1 -IMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDNGRVR 59 I FDEATSALDT TEQ L T RT IAHRL TIAD D I VLD GR usage_00363.pdb 58 EQG 60 usage_00370.pdb 57 EQG 59 usage_00371.pdb 58 EQG 60 usage_00372.pdb 57 EQG 59 usage_00382.pdb 60 EEG 62 usage_00383.pdb 60 EEG 62 usage_00384.pdb 60 EEG 62 E G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################