################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:29 2021 # Report_file: c_0760_108.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00087.pdb # 2: usage_00375.pdb # 3: usage_00376.pdb # 4: usage_00734.pdb # 5: usage_00786.pdb # # Length: 77 # Identity: 32/ 77 ( 41.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 77 ( 42.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 77 ( 16.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00087.pdb 1 ---HVLLASFKDGVSPEKIEELIKGYANLVNLIEP-KAFHWGKDVSIENLH---QGYTHI 53 usage_00375.pdb 1 AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQK---NKEEGYTHI 57 usage_00376.pdb 1 AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQK---NKEEGYTHI 57 usage_00734.pdb 1 -VKHVLLASFKDGVSPEKIEELIKGYANLVNLIEPMKAFHWGKDVSIENLH---QGYTHI 56 usage_00786.pdb 1 AVKHLFVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVT---------GYTHI 51 H FKD EE K Y NLVN I K WGKDV GYTHI usage_00087.pdb 54 FESTFESKEAVAEYIAH 70 usage_00375.pdb 58 VEVTFESVETIQDFIIH 74 usage_00376.pdb 58 VEVTFESVETIQDYIIH 74 usage_00734.pdb 57 FESTFESKEAVAEYIAH 73 usage_00786.pdb 52 VEVTFESVETIQDYIIH 68 E TFES E yI H #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################