################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:01 2021 # Report_file: c_0707_46.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00128.pdb # 2: usage_00129.pdb # 3: usage_00440.pdb # 4: usage_00535.pdb # 5: usage_00725.pdb # 6: usage_00780.pdb # 7: usage_00781.pdb # # Length: 61 # Identity: 6/ 61 ( 9.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 61 ( 34.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 61 ( 24.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00128.pdb 1 -----PWFWSDQYEIGLKMVGLSEGYDRIIVRGSLAQ-----PDFSVFYLQGDRVLAVDT 50 usage_00129.pdb 1 -----PWFWSDQYEIGLKMVGLSEGYDRIIVRGSLAQ-----PDFSVFYLQGDRVLAVDT 50 usage_00440.pdb 1 ----LPWYWSDQGALRIQVAGLAS-GDEEIVRGEVS---LDAPKFTLIELQKGRIVGATC 52 usage_00535.pdb 1 -------FWSDQYEIGLKMVGLSEGYDRIIVRGSLAQ-----PDFSVFYLQGDRVLAVDT 48 usage_00725.pdb 1 EYDYLPYFFSRSFDLGWQFYGDN--VGDTILFGDSD-PTSAKPKFGSYWIKDGKVLGAFL 57 usage_00780.pdb 1 -----PWFWSDQYEIGLKMVGLSEGYDRIIVRGSLAQ-----PDFSVFYLQGDRVLAVDT 50 usage_00781.pdb 1 -----PWFWSDQYEIGLKMVGLSEGYDRIIVRGSLAQ-----PDFSVFYLQGDRVLAVDT 50 fwSdq g Gl d IvrG P F lq rvl usage_00128.pdb 51 V 51 usage_00129.pdb 51 V 51 usage_00440.pdb 53 V 53 usage_00535.pdb 49 V 49 usage_00725.pdb 58 E 58 usage_00780.pdb 51 V 51 usage_00781.pdb 51 V 51 v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################