################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:29 2021 # Report_file: c_1394_10.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00096.pdb # 2: usage_00274.pdb # 3: usage_00420.pdb # 4: usage_00598.pdb # 5: usage_00813.pdb # 6: usage_01081.pdb # 7: usage_01201.pdb # # Length: 73 # Identity: 0/ 73 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 73 ( 19.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 73 ( 31.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00096.pdb 1 TGRPEWIWLALGTALMGLGTLYFLVKGMGV--------------SDPDAKKFYAITTLVP 46 usage_00274.pdb 1 TGRPEWIWLALGTALMGLGTLYFLVKGMGV--------------SDPDAKKFYAITTLVP 46 usage_00420.pdb 1 D-PLLASSLYINIALAGLSILLFVFMTRGL--------------DDPRAKLIAVSTILVP 45 usage_00598.pdb 1 -----WIWLALGTALMGLGTLYFLVKGMGV--------------SDPDAKKFYAITTLVP 41 usage_00813.pdb 1 -----GIWLALGTIGMLLGMLYFIADGLDV--------------QDPRQKEFYVITILIP 41 usage_01081.pdb 1 --DPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPI-YWARYADWLFTTPL 57 usage_01201.pdb 1 TGRPEWIWLALGTALMGLGTLYFLVKGMGV--------------SDPDAKKFYAITTLVP 46 l t l l l f p ak t l p usage_00096.pdb 47 AIAFTMYLSMLLG 59 usage_00274.pdb 47 AIAFTMYLSMLLG 59 usage_00420.pdb 46 VVSIASYTGLASG 58 usage_00598.pdb 42 AIAFTMYLSMLLG 54 usage_00813.pdb 42 AIAAASYLSMFFG 54 usage_01081.pdb 58 LLLGLALLVD--- 67 usage_01201.pdb 47 AIAFTMYLSMLLG 59 yl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################