################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:47 2021 # Report_file: c_1115_109.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00866.pdb # 2: usage_00954.pdb # 3: usage_00955.pdb # 4: usage_00956.pdb # 5: usage_00957.pdb # 6: usage_00958.pdb # 7: usage_00959.pdb # 8: usage_00960.pdb # 9: usage_00961.pdb # # Length: 73 # Identity: 40/ 73 ( 54.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/ 73 ( 57.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 73 ( 15.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00866.pdb 1 ---PMIKKIMSRLFSAFDVTHLGYLTPDKVEEVCRYLGRNMSDGDVKAMKAEINAID-GH 56 usage_00954.pdb 1 TL-SMEKRVMARMFSAFDVTQLGYLEERKIEHMCKYLGRVMNEDDVKQMKSEIN-AIDGH 58 usage_00955.pdb 1 TL-SMEKRVMARMFSAFDVTQLGYLEERKIEHMCKYLGRVMNEDDVKQMKSEIN-AIDGH 58 usage_00956.pdb 1 --TLSEKRV-AR-FSAFDVTQLGYLEERKIEH-CKYLGRV-NEDDVKQ-KSEIN-AIDGH 52 usage_00957.pdb 1 ---LSEKRV-AR-FSAFDVTQLGYLEERKIEH-CKYLGRV-NEDDVKQ-KSEIN-AIDGH 51 usage_00958.pdb 1 TQ-PMIKKIMSRLFSAFDVTHLGYLTPDKVEEVCRYLGRNMSDGDVKAMKAEIN-AIDGH 58 usage_00959.pdb 1 TQ-PMIKKIMSRLFSAFDVTHLGYLTPDKVEEVCRYLGRNMSDGDVKAMKAEIN-AIDGH 58 usage_00960.pdb 1 TQ-PMIKKIMSRLFSAFDVTHLGYLTPDKVEEVCRYLGRNMSDGDVKAMKAEIN-AIDGH 58 usage_00961.pdb 1 -Q-PMIKKIMSRLFSAFDVTHLGYLTPDKVEEVCRYLGRNMSDGDVKAMKAEIN-AIDGH 57 K R FSAFDVT LGYL K E C YLGR DVK K EIN ai GH usage_00866.pdb 57 VTFEKFWAWWCSH 69 usage_00954.pdb 59 ITFEKFWAWWCSH 71 usage_00955.pdb 59 ITFEKFWAWWCSH 71 usage_00956.pdb 53 ITFEKFWAWWCSH 65 usage_00957.pdb 52 ITFEKFWAWWCS- 63 usage_00958.pdb 59 VTFEKFWAWWCSH 71 usage_00959.pdb 59 VTFEKFWAWWCSH 71 usage_00960.pdb 59 VTFEKFWAWWCSH 71 usage_00961.pdb 58 VTFEKFWAWWCSH 70 TFEKFWAWWCS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################