################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:58:34 2021
# Report_file: c_1256_54.html
################################################################################################
#====================================
# Aligned_structures: 8
#   1: usage_02998.pdb
#   2: usage_03000.pdb
#   3: usage_03001.pdb
#   4: usage_03003.pdb
#   5: usage_03004.pdb
#   6: usage_03892.pdb
#   7: usage_03893.pdb
#   8: usage_04182.pdb
#
# Length:         39
# Identity:        8/ 39 ( 20.5%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     21/ 39 ( 53.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           16/ 39 ( 41.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_02998.pdb         1  -RIAYAGLRRKEEFKALAEKLGFTPLLFPVQATEKVPV-   37
usage_03000.pdb         1  MRIAYAGLRRKEEFKALAEKLGFTPLLFPVQ--------   31
usage_03001.pdb         1  -RIAYAGLRRKEEFKALAEKLGFTPLLFPVQ--------   30
usage_03003.pdb         1  -RIAYAGLRRKEEFKALAEKLGFTPLLFPVQ--------   30
usage_03004.pdb         1  -RIAYAGLRRKEEFKALAEKLGFTPLLFPV---------   29
usage_03892.pdb         1  VRVAYAGLRRKEAFKALAEKLGFTPLLFPVQ--------   31
usage_03893.pdb         1  -RVAYAGLRRKEAFKALAEKLGFTPLLFPVQATEKVPVP   38
usage_04182.pdb         1  -EVTFAT---GEGFAGTLRKLGFEPVA------------   23
                            r ayAg   kE FkalaeKLGFtPll            


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################