################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:12:11 2021
# Report_file: c_0581_6.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00361.pdb
#   2: usage_00362.pdb
#   3: usage_00363.pdb
#   4: usage_00393.pdb
#   5: usage_00394.pdb
#
# Length:         97
# Identity:       71/ 97 ( 73.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     72/ 97 ( 74.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           24/ 97 ( 24.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00361.pdb         1  --KLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGKLMFNED---D----------ALI   45
usage_00362.pdb         1  --KLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGK---GSH-GMY----------ALI   44
usage_00363.pdb         1  LKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGK---GSH-GMYEGHLMFNEDDALI   56
usage_00393.pdb         1  LKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGK---G-MF-------------ALI   43
usage_00394.pdb         1  LKKLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGK---GSH-GMY----------ALI   46
                             KLEIILEGAHKEFATDLLDRAGVKGYTIVGNLSGK   g                ALI

usage_00361.pdb        46  MIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHD----   78
usage_00362.pdb        45  MIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHD----   77
usage_00363.pdb        57  MIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHDIQVG   93
usage_00393.pdb        44  MIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHD----   76
usage_00394.pdb        47  MIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHD----   79
                           MIIAAVPEELVGPLLEGFQPFFEAHSGVVFVHD    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################