################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:56 2021 # Report_file: c_1245_92.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00077.pdb # 2: usage_00172.pdb # 3: usage_00341.pdb # 4: usage_00428.pdb # 5: usage_00494.pdb # 6: usage_00495.pdb # 7: usage_00505.pdb # 8: usage_00634.pdb # 9: usage_00635.pdb # 10: usage_00667.pdb # # Length: 30 # Identity: 17/ 30 ( 56.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 30 ( 56.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 30 ( 20.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00077.pdb 1 ----EVAVFEPSEAEISHTQKATLVCLAT- 25 usage_00172.pdb 1 ----KVSLFEPSKAEIANKQKATLVCLAR- 25 usage_00341.pdb 1 ----EVAVFEPSEAEISHTQKATLVCLAT- 25 usage_00428.pdb 1 VFPPEVAVFEPSEAEISHTQKATLVCLAT- 29 usage_00494.pdb 1 VTPPKVSLFEPSKAEIANKQKATLVCLAR- 29 usage_00495.pdb 1 VTPPKVSLFEPSKAEIANKQKATLVCLAR- 29 usage_00505.pdb 1 ----EVAVFEPSEAEISHTQKATLVCLATG 26 usage_00634.pdb 1 ----EVAVFEPSEAEISHTQKATLVCLAT- 25 usage_00635.pdb 1 ----EVAVFEPSEAEISHTQKATLVCLA-- 24 usage_00667.pdb 1 ----KVSLFEPSKAEIANKQKATLVCLA-- 24 V FEPS AEI QKATLVCLA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################