################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:51 2021 # Report_file: c_1376_16.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00018.pdb # 2: usage_00510.pdb # 3: usage_00511.pdb # 4: usage_00512.pdb # 5: usage_00513.pdb # 6: usage_01083.pdb # 7: usage_01084.pdb # 8: usage_01390.pdb # 9: usage_01401.pdb # # Length: 60 # Identity: 8/ 60 ( 13.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 60 ( 71.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 60 ( 11.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 -TREAIQVVQNKGKDALPFLHALGELTQQAEIAISQKDAEGLGQILSQAHLHLKEIG--- 56 usage_00510.pdb 1 -SRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHATNLGS 59 usage_00511.pdb 1 -SRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHATNLGS 59 usage_00512.pdb 1 -SRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHATNLGS 59 usage_00513.pdb 1 -SRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHATNLGS 59 usage_01083.pdb 1 SSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHATNLGA 60 usage_01084.pdb 1 ---SGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHATNLGA 57 usage_01390.pdb 1 SSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHATNLGA 60 usage_01401.pdb 1 ----GMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHATNLGA 56 gmsltr tsrfyqywLdh dEdl eAk A Df rLGevie ngLrmhatn #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################