################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:45 2021 # Report_file: c_1076_200.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00014.pdb # 2: usage_00125.pdb # 3: usage_00126.pdb # 4: usage_00127.pdb # 5: usage_00363.pdb # 6: usage_01012.pdb # 7: usage_01295.pdb # 8: usage_01296.pdb # 9: usage_01434.pdb # # Length: 51 # Identity: 5/ 51 ( 9.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 51 ( 52.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 51 ( 3.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00014.pdb 1 NPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSG 51 usage_00125.pdb 1 NTERIKMAIEKKACNSLLLKINQIGTISEAIASSKLCMENGWSVMVSHRSG 51 usage_00126.pdb 1 NTERIKMAIEKKACNSLLLKINQIGTISEAIASSKLCMENGWSVMVSHRSG 51 usage_00127.pdb 1 NTERIKMAIEKKACNSLLLKINQIGTISEAIASSKLCMENGWSVMVSHRSG 51 usage_00363.pdb 1 -PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSG 50 usage_01012.pdb 1 -AQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAE 50 usage_01295.pdb 1 -ILRIEKALKDKACNCLLLKVNQIGSVTEAIEACLLAQKSGWGVQVSHRSG 50 usage_01296.pdb 1 -ILRIEKALKDKACNCLLLKVNQIGSVTEAIEACLLAQKSGWGVQVSHRS- 49 usage_01434.pdb 1 NTERIKMAIEKKACNSLLLKINQIGTISEAIASSKLCMENGWSVMVSHRSG 51 ri a kacn lllK nqiG EAi l Gw v vshrs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################