################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:09 2021 # Report_file: c_1128_33.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00057.pdb # 2: usage_00058.pdb # 3: usage_00125.pdb # 4: usage_00126.pdb # 5: usage_00229.pdb # 6: usage_00238.pdb # 7: usage_00239.pdb # 8: usage_00275.pdb # # Length: 76 # Identity: 8/ 76 ( 10.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 76 ( 21.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 76 ( 19.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00057.pdb 1 ---ES-RALLQVLDNVP-GPALDIVALNAGAALYVAGVAD--SIADGIVRARQVLADGSA 53 usage_00058.pdb 1 DAAES-RALLQVLDNVP-GPALDIVALNAGAALYVAGVAD--SIADGIVRARQVLADGSA 56 usage_00125.pdb 1 GPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTP--SLKEGVALAREVLASGEA 58 usage_00126.pdb 1 GPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTP--SLKEGVALAREVLASGEA 58 usage_00229.pdb 1 GPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTP--SLKEGVALAREVLASGEA 58 usage_00238.pdb 1 DVQENAEILKAVLQGKGTQAQQDAVALNAALALQVAGAVPLLDHAQGVSVAKEILQTGTA 60 usage_00239.pdb 1 DVQENAEILKAVLQGKGTQAQQDAVALNAALALQVAGAVPLLDHAQGVSVAKEILQTGTA 60 usage_00275.pdb 1 TPEENRDILARLLQGKGDAAHARQVAANVALLLKLFG-QD--NLRHNAQLALETIRSGTA 57 E L d VAl a aG g A l G A usage_00057.pdb 54 RACLDAYVAFTQQATA 69 usage_00058.pdb 57 RACLDAYVAFTQQAT- 71 usage_00125.pdb 59 YLLLERYVAFLRA--- 71 usage_00126.pdb 59 YLLLERYVAFLR---- 70 usage_00229.pdb 59 YLLLERYVAFLR---- 70 usage_00238.pdb 61 WAKLAQLVYFLGN--- 73 usage_00239.pdb 61 WAKLAQLVYFLG---- 72 usage_00275.pdb 58 FERVTALAA------- 66 l v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################