################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:09:37 2021 # Report_file: c_1256_155.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_01211.pdb # 2: usage_01498.pdb # 3: usage_03742.pdb # 4: usage_03743.pdb # # Length: 94 # Identity: 22/ 94 ( 23.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 94 ( 36.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/ 94 ( 34.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01211.pdb 1 DFLGVNYYSPTVS---------------------HSPWPGA--DRVAFHQPPGETTAMGW 37 usage_01498.pdb 1 DFLGVNHYHDDN-VSGHPLPAGQPQPVVPTDSPKSSPFVGS--EYVTFPARDLPRTAMGW 57 usage_03742.pdb 1 DFLGINYYSRMV-VRHKP-----------------GD----NLFNAEVVKMERPSTEMGW 38 usage_03743.pdb 1 DFLGINYYSRMV-VRHKP-----------------------NLFNAEVVKMERPSTEMGW 36 DFLG NyYs v p T MGW usage_01211.pdb 38 AVDPSGLYELLRRLSSDFPA-LPLVITENGAAFH 70 usage_01498.pdb 58 EVNPEGLRVLLNRLNQDYANLPSLYITENGASYT 91 usage_03742.pdb 39 EIYPQGLYDILVRVNKEYTD-KPLYITENGAAFD 71 usage_03743.pdb 37 EIYPQGLYDILVRVNKEYTD-KPLYITENGAAFD 69 e P GLy L R n y pLyITENGAaf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################