################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:58:52 2021 # Report_file: c_0967_5.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00056.pdb # 2: usage_00121.pdb # 3: usage_00127.pdb # 4: usage_00151.pdb # 5: usage_00174.pdb # 6: usage_00215.pdb # 7: usage_00222.pdb # 8: usage_00248.pdb # 9: usage_00282.pdb # 10: usage_00317.pdb # 11: usage_00335.pdb # 12: usage_00348.pdb # 13: usage_00390.pdb # # Length: 36 # Identity: 3/ 36 ( 8.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 36 ( 13.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 36 ( 19.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00056.pdb 1 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR-- 34 usage_00121.pdb 1 DFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH-- 34 usage_00127.pdb 1 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLD 36 usage_00151.pdb 1 NFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQ-- 34 usage_00174.pdb 1 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR-- 34 usage_00215.pdb 1 DYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL--- 33 usage_00222.pdb 1 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR-- 34 usage_00248.pdb 1 -FQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR-- 33 usage_00282.pdb 1 -YDTGEELGSGKFAVVKKCREKSTGLQYAAKFIK-- 33 usage_00317.pdb 1 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR-- 34 usage_00335.pdb 1 DYEVLYTIGTGSYGRCQKIRR---GKILVWKELDYG 33 usage_00348.pdb 1 -YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIK-- 33 usage_00390.pdb 1 -YELCEVIGKGAFSVVRRCINRETGQQFAVKIVD-- 33 G G v g K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################