################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:28:02 2021 # Report_file: c_1254_10.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00349.pdb # 2: usage_00741.pdb # 3: usage_01069.pdb # 4: usage_01070.pdb # 5: usage_01071.pdb # 6: usage_01072.pdb # 7: usage_01073.pdb # 8: usage_01074.pdb # 9: usage_01075.pdb # 10: usage_01076.pdb # 11: usage_01077.pdb # 12: usage_01078.pdb # 13: usage_01079.pdb # 14: usage_01080.pdb # 15: usage_01081.pdb # # Length: 40 # Identity: 6/ 40 ( 15.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 40 ( 55.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 40 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00349.pdb 1 VAAFLVTTADPL--EVVSVRYLWGSAQQIGLTIGGVIQVS 38 usage_00741.pdb 1 GTSLLVARFG--LNTAKEVSLSMQRLEQAGVNIKGAILNG 38 usage_01069.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01070.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01071.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01072.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01073.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01074.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01075.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01076.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01077.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01078.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01079.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01080.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 usage_01081.pdb 1 GTTLMVARYA--VNTLKEVETSLSRFEQNGIPVKGVILNS 38 gt l Var t keV s r eQ G kGvIlns #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################