################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:53 2021 # Report_file: c_1164_58.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00218.pdb # 2: usage_00503.pdb # 3: usage_00668.pdb # 4: usage_00669.pdb # 5: usage_00978.pdb # 6: usage_01054.pdb # 7: usage_01055.pdb # 8: usage_01056.pdb # 9: usage_01270.pdb # 10: usage_01296.pdb # 11: usage_01543.pdb # 12: usage_01718.pdb # 13: usage_01874.pdb # 14: usage_02020.pdb # # Length: 38 # Identity: 12/ 38 ( 31.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 38 ( 34.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 38 ( 21.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00218.pdb 1 PVTVSWNSGALTSGVHTFPAVLQSSG-LYSLSSVVT-- 35 usage_00503.pdb 1 SVTVTWNSGSLSSSVHTFPALLQSALYTMSSSVTVP-- 36 usage_00668.pdb 1 PVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVT---- 34 usage_00669.pdb 1 PVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVT---- 34 usage_00978.pdb 1 PVTVSWNSGALTSGVHTFPAVLQSSG-LYSLSSVVT-- 35 usage_01054.pdb 1 PVTVSWNSGALTSGVHTFPAVLQSSG-LYSLSSVVT-- 35 usage_01055.pdb 1 PVTVSWNSGALTSGVHTFPAVLQSSG-LYSLSSVVT-- 35 usage_01056.pdb 1 PVTVSWNSGALTSGVHTFPAVLQSSG-LYSLSSVVT-- 35 usage_01270.pdb 1 PVTVSWNSGALTSGVHTFPAVLQSSG-LYSLSSVVT-- 35 usage_01296.pdb 1 SVTVTWNSGSL---VHTFPALLQSGLYTMSSSVT---- 31 usage_01543.pdb 1 PVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVT---- 34 usage_01718.pdb 1 PVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVT---- 34 usage_01874.pdb 1 PVTVSWNSGALTSGVHTFPAVLQSSG-LYSHSSVVTVP 37 usage_02020.pdb 1 PVTVSWNSGALTSGVHTFPAVLQSSG-LYSLSSVVT-- 35 VTv WN G L V T LQS S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################