################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:13:14 2021 # Report_file: c_1481_138.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00971.pdb # 2: usage_01398.pdb # 3: usage_01399.pdb # 4: usage_01564.pdb # 5: usage_02264.pdb # 6: usage_02265.pdb # 7: usage_03112.pdb # 8: usage_03113.pdb # 9: usage_03114.pdb # # Length: 36 # Identity: 6/ 36 ( 16.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 36 ( 77.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 36 ( 22.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00971.pdb 1 ----AESVAQFSISWNETHGKPPTRREIIEGY---- 28 usage_01398.pdb 1 ----AESVAQFSISWNETHGKPPTRREIIEGY---- 28 usage_01399.pdb 1 ----AESVAQFSISWNETHGKPPTRREIIEGY---- 28 usage_01564.pdb 1 TPIVAGNVAQLREHFVKNRGITPKPSLLKAALIAGA 36 usage_02264.pdb 1 ----AESVAQFSISWNETHGKPPTRREIIEGY---- 28 usage_02265.pdb 1 ---AAESVAQFSISWNETHGKPPTRREIIEGY---- 29 usage_03112.pdb 1 ----AESVAQFSISWNETHGKPPTRREIIEGY---- 28 usage_03113.pdb 1 ----AESVAQFSISWNETHGKPPTRREIIEGYYG-- 30 usage_03114.pdb 1 ----AESVAQFSISWNETHGKPPTRREIIEGY---- 28 AesVAQfsiswnethGkpPtrreiiegy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################