################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:03:29 2021 # Report_file: c_0413_3.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00123.pdb # 2: usage_00124.pdb # 3: usage_00125.pdb # 4: usage_00126.pdb # 5: usage_00137.pdb # 6: usage_00138.pdb # 7: usage_00199.pdb # 8: usage_00200.pdb # 9: usage_00204.pdb # # Length: 63 # Identity: 32/ 63 ( 50.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 63 ( 50.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 63 ( 3.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00123.pdb 1 RGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQ 60 usage_00124.pdb 1 --EIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQ 58 usage_00125.pdb 1 SGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQ 60 usage_00126.pdb 1 --EIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQ 58 usage_00137.pdb 1 --ELEFKNVSFAYQGEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGE 58 usage_00138.pdb 1 --ELEFKNVSFAYQGEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGE 58 usage_00199.pdb 1 RGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQ 60 usage_00200.pdb 1 --EIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQ 58 usage_00204.pdb 1 RGEIEFKNVWFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQ 60 E EFKNV F Y L I F G VALVG GSGK TI NL RFYD G usage_00123.pdb 61 ILV 63 usage_00124.pdb 59 ILV 61 usage_00125.pdb 61 ILV 63 usage_00126.pdb 59 ILV 61 usage_00137.pdb 59 ILL 61 usage_00138.pdb 59 ILL 61 usage_00199.pdb 61 ILV 63 usage_00200.pdb 59 ILV 61 usage_00204.pdb 61 ILV 63 IL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################