################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:23 2021 # Report_file: c_1115_10.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00631.pdb # 2: usage_00632.pdb # 3: usage_01276.pdb # 4: usage_01277.pdb # 5: usage_01438.pdb # 6: usage_01439.pdb # 7: usage_01643.pdb # # Length: 64 # Identity: 14/ 64 ( 21.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 64 ( 71.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 64 ( 23.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00631.pdb 1 --RDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALG-PAATLEEMMTA- 56 usage_00632.pdb 1 ----YVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALG-PAATLEEMMTA- 54 usage_01276.pdb 1 --RDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALG-PGATLEEMMTAC 57 usage_01277.pdb 1 --RDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALG-PGATLEEMMTAC 57 usage_01438.pdb 1 -FRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALG-PGATLEEMMTAC 58 usage_01439.pdb 1 -FRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALG-PGATLEEMMTAC 58 usage_01643.pdb 1 SYVEFVNRLQISLADN-L----KEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQAC 55 yVdRfyktLrae a Kn tetLlvqNANpdCktILkalG p AtleemmtA usage_00631.pdb ---- usage_00632.pdb ---- usage_01276.pdb ---- usage_01277.pdb ---- usage_01438.pdb 59 QGVG 62 usage_01439.pdb 59 QGVG 62 usage_01643.pdb ---- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################