################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:07 2021 # Report_file: c_1396_58.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00226.pdb # 2: usage_00227.pdb # 3: usage_00228.pdb # 4: usage_00229.pdb # 5: usage_01116.pdb # 6: usage_01117.pdb # 7: usage_01322.pdb # 8: usage_01732.pdb # 9: usage_01791.pdb # # Length: 67 # Identity: 64/ 67 ( 95.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 64/ 67 ( 95.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 67 ( 4.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00226.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ---GGTDLMNFLKT 57 usage_00227.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ---GGTDLMNFLKT 57 usage_00228.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ---GGTDLMNFLKT 57 usage_00229.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ---GGTDLMNFLKT 57 usage_01116.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQ--GGTDLMNFLKT 58 usage_01117.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ---GGTDLMNFLKT 57 usage_01322.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ-QPGGTDLMNFLKT 59 usage_01732.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ---GGTDLMNFLKT 57 usage_01791.pdb 1 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ-QPGGTDLMNFLKT 59 SVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQ GGTDLMNFLKT usage_00226.pdb 58 VRSTTEK 64 usage_00227.pdb 58 VRSTTEK 64 usage_00228.pdb 58 VRSTTEK 64 usage_00229.pdb 58 VRSTTEK 64 usage_01116.pdb 59 VRSTTEK 65 usage_01117.pdb 58 VRSTTEK 64 usage_01322.pdb 60 VRSTTEK 66 usage_01732.pdb 58 VRSTTEK 64 usage_01791.pdb 60 VRSTTEK 66 VRSTTEK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################