################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:25 2021 # Report_file: c_1484_55.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_04645.pdb # 2: usage_04646.pdb # 3: usage_04647.pdb # 4: usage_04656.pdb # 5: usage_04711.pdb # 6: usage_04712.pdb # 7: usage_04713.pdb # 8: usage_04714.pdb # 9: usage_04715.pdb # 10: usage_04716.pdb # 11: usage_04717.pdb # # Length: 53 # Identity: 31/ 53 ( 58.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 53 ( 86.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 53 ( 13.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_04645.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQE 53 usage_04646.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEV-- 51 usage_04647.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQE 53 usage_04656.pdb 1 TLAMNFWATIEHSLNYKYHGEFPEDIKRRLELTSKIAFQLDEEMRQ------- 46 usage_04711.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQ- 52 usage_04712.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQE 53 usage_04713.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQ- 52 usage_04714.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQ- 52 usage_04715.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQ- 52 usage_04716.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQ- 52 usage_04717.pdb 1 TLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQE 53 TLAMNFWATIEHSLNYKYsGniPEkvKlRLqraSeaAsrLDEEMse #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################