################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:47 2021 # Report_file: c_1370_45.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00037.pdb # 2: usage_00038.pdb # 3: usage_00174.pdb # 4: usage_00175.pdb # 5: usage_00176.pdb # 6: usage_00804.pdb # 7: usage_00805.pdb # 8: usage_00806.pdb # 9: usage_00807.pdb # 10: usage_01644.pdb # # Length: 73 # Identity: 67/ 73 ( 91.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 67/ 73 ( 91.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 73 ( 8.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00037.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 usage_00038.pdb 1 GDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 60 usage_00174.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 usage_00175.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 usage_00176.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 usage_00804.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 usage_00805.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 usage_00806.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 usage_00807.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 usage_01644.pdb 1 ---KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV 57 KLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNV usage_00037.pdb 58 IQNYNEGIIDNLS 70 usage_00038.pdb 61 IQNYNEGIIDN-- 71 usage_00174.pdb 58 IQNYNEGIIDN-- 68 usage_00175.pdb 58 IQNYNEGIIDN-- 68 usage_00176.pdb 58 IQNYNEGIIDNLS 70 usage_00804.pdb 58 IQNYNEGIIDN-- 68 usage_00805.pdb 58 IQNYNEGIIDN-- 68 usage_00806.pdb 58 IQNYNEGIIDN-- 68 usage_00807.pdb 58 IQNYNEGIIDNLS 70 usage_01644.pdb 58 IQNYNEGIID--- 67 IQNYNEGIID #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################