################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:06 2021 # Report_file: c_0863_82.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00091.pdb # 2: usage_00092.pdb # 3: usage_00093.pdb # 4: usage_00457.pdb # 5: usage_00768.pdb # 6: usage_00994.pdb # 7: usage_01123.pdb # 8: usage_01208.pdb # # Length: 54 # Identity: 5/ 54 ( 9.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 54 ( 42.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 54 ( 18.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00091.pdb 1 TEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICE- 53 usage_00092.pdb 1 TEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICE- 53 usage_00093.pdb 1 TEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDIC-- 52 usage_00457.pdb 1 TEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICE- 53 usage_00768.pdb 1 TERDECAYQE-ITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASIEQIDC--- 50 usage_00994.pdb 1 TEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICE- 53 usage_01123.pdb 1 ----SRELVKARLRRYIPYFKGCRRVLDIGCGRGEFLELCKEEG-I-ESIGVDI 48 usage_01208.pdb 1 TEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEI 54 e ay e th p k pk VLv GgGdGg re id #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################