################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:08 2021 # Report_file: c_0553_43.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00517.pdb # 2: usage_01150.pdb # 3: usage_01759.pdb # 4: usage_01760.pdb # 5: usage_01761.pdb # # Length: 68 # Identity: 31/ 68 ( 45.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 68 ( 45.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 68 ( 10.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00517.pdb 1 -TMNVTWGKSGKDITTVNFPPALA-SGGRYTMSNQLTLPAVECPEGESVKCSVQHDSNPV 58 usage_01150.pdb 1 GTMNVTWGKSGKDITTVNFPPALA-SGGRYTMSNQLTLPAVECPEGESVKCSVQHDSNPV 59 usage_01759.pdb 1 -PLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPS 59 usage_01760.pdb 1 --LSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPS 58 usage_01761.pdb 1 --LSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPS 58 VTW SG T NFPP SG YT S QLTLPA C G SV C V H NP usage_00517.pdb 59 QELD---- 62 usage_01150.pdb 60 QELDVN-- 65 usage_01759.pdb 60 QDVTVP-- 65 usage_01760.pdb 59 QDVTVPCP 66 usage_01761.pdb 59 QDVTVPCP 66 Q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################