################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:05 2021 # Report_file: c_1417_93.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00621.pdb # 2: usage_00676.pdb # 3: usage_01214.pdb # 4: usage_01322.pdb # 5: usage_01323.pdb # # Length: 77 # Identity: 19/ 77 ( 24.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 77 ( 46.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 77 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00621.pdb 1 ----RSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLN--PDEATLKAWEVAYGKIA 54 usage_00676.pdb 1 ----LPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDILDAWGKAYGVIA 56 usage_01214.pdb 1 PNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLA 60 usage_01322.pdb 1 ----MDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATPEIINAWGEAYQAIA 56 usage_01323.pdb 1 ----MDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATPEIINAWGEAYQAIA 56 vk i kH l k ehYPIVG LL AIKevLg at i AW AY iA usage_00621.pdb 55 KFYIDIEKKLYD----- 66 usage_00676.pdb 57 DVFIQVEADLYAQA--- 70 usage_01214.pdb 61 DVLMGMESELYERSAEQ 77 usage_01322.pdb 57 DIFITVEKKMYEE---- 69 usage_01323.pdb 57 DIFITVEKKMYEE---- 69 d i E Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################