################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:35 2021 # Report_file: c_1151_2.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00133.pdb # 2: usage_00168.pdb # 3: usage_00279.pdb # 4: usage_00440.pdb # 5: usage_00664.pdb # 6: usage_00665.pdb # 7: usage_00744.pdb # 8: usage_01314.pdb # # Length: 59 # Identity: 3/ 59 ( 5.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 59 ( 11.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 35/ 59 ( 59.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00133.pdb 1 -HLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKN-- 56 usage_00168.pdb 1 GHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND- 58 usage_00279.pdb 1 -NHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFEVYQKSV- 57 usage_00440.pdb 1 ---------------------------YKLLPEYPGVLSDVQEEKGIKYKFEVYEKN-- 30 usage_00664.pdb 1 -HLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKFEVYEKKD- 57 usage_00665.pdb 1 --LKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND- 56 usage_00744.pdb 1 --KKIYFTRINSTYECDVFFPEINENEYQIIS-V----SDVYTSNNTTLDFIIYKK--- 49 usage_01314.pdb 1 --KKIYFTRINSTYECDVFFPEINENEYQIIS-V----SDVYTSNNTTLDFIIYKKTNN 52 y sdv F Y K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################