################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:12 2021 # Report_file: c_1403_131.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00741.pdb # 2: usage_00742.pdb # 3: usage_00826.pdb # 4: usage_00828.pdb # 5: usage_00988.pdb # 6: usage_01304.pdb # # Length: 97 # Identity: 13/ 97 ( 13.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 97 ( 21.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 43/ 97 ( 44.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00741.pdb 1 ---EA--RWF----IDAYA---------------RRPDMNPLIFELAKLNFNIIQATHQQ 36 usage_00742.pdb 1 ---EA--RWF----IDAYA---------------RRPDMNPLIFELAKLNFNIIQATHQQ 36 usage_00826.pdb 1 ----------------IYD---------------KEQSKNNVLLRFAKLDFNLLQMLHKQ 29 usage_00828.pdb 1 -----PRVETRFFISSIYD---------------KEQSKNNVLLRFAKLDFNLLQMLHKQ 40 usage_00988.pdb 1 PRLEA--RSY----IDSYDDNYVWQRKTLYRMPS---LSNSKCLELAKLDFNIVQSLHQE 51 usage_01304.pdb 1 ----A--RSF----IDAYK---------------RRPDMNPTVLELAKLDFNMVQAQFQQ 35 Y N AKL FN Q h q usage_00741.pdb 37 ELKDLSRWWSRLCFPEKLPFVRDRLVESFFWAVGM-- 71 usage_00742.pdb 37 ELKDLSRWWSRLCFPEKLPFVRDRLVESFFWAVGM-- 71 usage_00826.pdb 30 ELAQVSRWWKDLDFVTTLPYARDRVVECYFWTLGVY- 65 usage_00828.pdb 41 ELAQVSRWWKDLDFVTTLPYARDRVVECYFWALGVY- 76 usage_00988.pdb 52 ELKLLTRWWKESGMAD-------FTRHRVAEVYFSS- 80 usage_01304.pdb 36 ELKEASRWWNSTGLVHELPFVRDRIVECYYWTTGVVE 72 EL sRWW r ve w g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################