################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:53 2021 # Report_file: c_0832_17.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00004.pdb # 2: usage_00128.pdb # 3: usage_00129.pdb # 4: usage_00162.pdb # 5: usage_00164.pdb # 6: usage_00316.pdb # 7: usage_00317.pdb # 8: usage_00795.pdb # # Length: 74 # Identity: 70/ 74 ( 94.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 71/ 74 ( 95.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 74 ( 4.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 PDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG 60 usage_00128.pdb 1 PDSFSETWLNDSEWLREKI--QQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG 58 usage_00129.pdb 1 PDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG 60 usage_00162.pdb 1 PDSFSETWLNDSEWLREKQ---QPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG 57 usage_00164.pdb 1 PDSFSETWLNDSEWLREKI---QPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG 57 usage_00316.pdb 1 PDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG 60 usage_00317.pdb 1 PDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG 60 usage_00795.pdb 1 PDSFSETWLNDSEWLREKI--QQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG 58 PDSFSETWLNDSEWLREKi QPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVG usage_00004.pdb 61 DFKANKRPTDLIVH 74 usage_00128.pdb 59 DFKANKRPTDLIVH 72 usage_00129.pdb 61 DFKANKRPTDLIVH 74 usage_00162.pdb 58 DFKANKRPTDLIVH 71 usage_00164.pdb 58 DFKANKRPTDLIVH 71 usage_00316.pdb 61 DFKANKRPTDLIVH 74 usage_00317.pdb 61 DFKANKRPTDLIVH 74 usage_00795.pdb 59 DFKANKRPTDLIVH 72 DFKANKRPTDLIVH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################