################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:48:58 2021 # Report_file: c_1385_6.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00065.pdb # 2: usage_00066.pdb # 3: usage_00191.pdb # 4: usage_00192.pdb # 5: usage_00193.pdb # 6: usage_00328.pdb # 7: usage_00448.pdb # 8: usage_00516.pdb # 9: usage_00517.pdb # 10: usage_00518.pdb # 11: usage_00519.pdb # 12: usage_00735.pdb # 13: usage_00736.pdb # 14: usage_00737.pdb # 15: usage_00738.pdb # 16: usage_00739.pdb # 17: usage_00869.pdb # # Length: 53 # Identity: 5/ 53 ( 9.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 53 ( 52.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 53 ( 11.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00065.pdb 1 SMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTI-DFREFIIALSVT--- 49 usage_00066.pdb 1 SMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTI-DFREFIIALSVT--- 49 usage_00191.pdb 1 -AAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVTSRG 51 usage_00192.pdb 1 -AAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVTSRG 51 usage_00193.pdb 1 DAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVTSRG 52 usage_00328.pdb 1 DAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVT--- 49 usage_00448.pdb 1 DKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMR- 52 usage_00516.pdb 1 -AAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVTSR- 50 usage_00517.pdb 1 --AGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVTSR- 49 usage_00518.pdb 1 DAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVTS-- 50 usage_00519.pdb 1 -AAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVTSRG 51 usage_00735.pdb 1 TEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAI-EFEEFIRALSIT--- 49 usage_00736.pdb 1 TEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAI-EFEEFIRALSIT--- 49 usage_00737.pdb 1 TEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAI-EFEEFIRALSITSRG 52 usage_00738.pdb 1 TEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAI-EFEEFIRALSIT--- 49 usage_00739.pdb 1 -EQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAI-EFEEFIRALSITSRG 51 usage_00869.pdb 1 -AAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI-EFSEFIQALSVTSRG 51 f kiy ffp gd kfa VF FD n dG i f efi als t #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################