################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:02 2021 # Report_file: c_1377_117.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01035.pdb # 2: usage_01036.pdb # 3: usage_01037.pdb # 4: usage_01038.pdb # 5: usage_01039.pdb # 6: usage_01278.pdb # # Length: 68 # Identity: 3/ 68 ( 4.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/ 68 ( 80.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 68 ( 19.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01035.pdb 1 MLDIQREAREKLEQLD-------YAN---PEDIDKIYFYKSVIETAEGVMIYARRLSAYA 50 usage_01036.pdb 1 MLDIQREAREKLEQLD-------YAN---PEDIDKIYFYKSVIETAEGVMIYARRLSAYA 50 usage_01037.pdb 1 MLDIQREAREKLEQLD-------YAN---PEDIDKIYFYKSVIETAEGVMIYARRLSAYA 50 usage_01038.pdb 1 MLDIQREAREKLEQLD-------YAN---PEDIDKIYFYKSVIETAEGVMIYARRLSAYA 50 usage_01039.pdb 1 -AIDVDRTLAVLRRKLEALGYSDPLEPASLQLVQKLVEDLVHTTDSYTAVKQQCAKQAQE 59 usage_01278.pdb 1 MLDIQREAREKLEQLD-------YAN---PEDIDKIYFYKSVIETAEGVMIYARRLSAYA 50 ldiqrearekLeqld yan pedidKiyfyksvietaegvmiyarrlsAya usage_01035.pdb 51 AELAAR-- 56 usage_01036.pdb 51 AELAARE- 57 usage_01037.pdb 51 AELAARE- 57 usage_01038.pdb 51 AELAARE- 57 usage_01039.pdb 60 IAAFDTRL 67 usage_01278.pdb 51 AELAAR-- 56 aelaar #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################