################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 03:16:15 2021
# Report_file: c_1254_18.html
################################################################################################
#====================================
# Aligned_structures: 25
#   1: usage_00006.pdb
#   2: usage_00561.pdb
#   3: usage_00562.pdb
#   4: usage_00563.pdb
#   5: usage_00564.pdb
#   6: usage_00565.pdb
#   7: usage_00566.pdb
#   8: usage_00567.pdb
#   9: usage_00568.pdb
#  10: usage_00569.pdb
#  11: usage_00673.pdb
#  12: usage_00674.pdb
#  13: usage_00675.pdb
#  14: usage_00676.pdb
#  15: usage_00678.pdb
#  16: usage_00679.pdb
#  17: usage_01009.pdb
#  18: usage_01032.pdb
#  19: usage_01034.pdb
#  20: usage_01046.pdb
#  21: usage_01047.pdb
#  22: usage_01048.pdb
#  23: usage_01049.pdb
#  24: usage_01092.pdb
#  25: usage_01093.pdb
#
# Length:         34
# Identity:        1/ 34 (  2.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      3/ 34 (  8.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           11/ 34 ( 32.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00006.pdb         1  I--VSWTGGWGGYDVASSKLLAEKGHQILNTND-   31
usage_00561.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNGD   33
usage_00562.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00563.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00564.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00565.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00566.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00567.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00568.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00569.pdb         1  -IVSMWTGGWGGYDVASSKLLAEKGHQILNTND-   32
usage_00673.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00674.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00675.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00676.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00678.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_00679.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_01009.pdb         1  ----TGYVAPWWEFSNITNELLLKHGFKY-DHS-   28
usage_01032.pdb         1  -VIEYWYGA-----GRKPQELVQDGYTLMNATQ-   27
usage_01034.pdb         1  -VIEYWYGA-----GRKPQELVQDGYTLMNATQ-   27
usage_01046.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_01047.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_01048.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_01049.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_01092.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
usage_01093.pdb         1  -LISYWSKGWWGYNLASPQYLASKGYKFLNTNG-   32
                                w              L   g         


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################