################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:17:05 2021 # Report_file: c_1260_47.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00207.pdb # 2: usage_00208.pdb # 3: usage_00209.pdb # 4: usage_00489.pdb # 5: usage_00490.pdb # 6: usage_00491.pdb # 7: usage_00492.pdb # 8: usage_00493.pdb # 9: usage_00494.pdb # 10: usage_00495.pdb # 11: usage_00496.pdb # 12: usage_00497.pdb # 13: usage_00849.pdb # 14: usage_00850.pdb # 15: usage_01257.pdb # 16: usage_01258.pdb # 17: usage_01259.pdb # # Length: 32 # Identity: 11/ 32 ( 34.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 32 ( 34.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 32 ( 3.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00207.pdb 1 NYILVGEI-RDKEGNVAFQAMQTGHSVMATFH 31 usage_00208.pdb 1 NYILVGEI-RDKEGNVAFQAMQTGHSVMATFH 31 usage_00209.pdb 1 NYILVGEI-RDKEGNVAFQAMQTGHSVMATFH 31 usage_00489.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00490.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00491.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00492.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00493.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00494.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00495.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00496.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00497.pdb 1 DVVMVGEIRDLETAQIAVQASLTGHLVMSTLH 32 usage_00849.pdb 1 DIILVGEMRDLETIRLALTAAETGHLVFGTLH 32 usage_00850.pdb 1 DIILVGEMRDLETIRLALTAAETGHLVFGTLH 32 usage_01257.pdb 1 DIIMVGEIRDSETAKIATEAALTGHLVIATLH 32 usage_01258.pdb 1 DIIMVGEIRDSETAKIATEAALTGHLVIATLH 32 usage_01259.pdb 1 DIIMVGEIRDSETAKIATEAALTGHLVIATLH 32 VGE A A TGH V T H #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################