################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:56 2021 # Report_file: c_1261_165.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01210.pdb # 2: usage_02207.pdb # 3: usage_02690.pdb # 4: usage_02691.pdb # 5: usage_03004.pdb # 6: usage_03005.pdb # 7: usage_03858.pdb # 8: usage_03894.pdb # 9: usage_03895.pdb # # Length: 43 # Identity: 11/ 43 ( 25.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 43 ( 25.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 43 ( 11.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01210.pdb 1 --SRILAVHASPRGERSQSRRLAEVFLAAYREAHPQARVARRE 41 usage_02207.pdb 1 --SRILAVHASPRGERSQSRRLAEVFLAAYREAHPQARVARRE 41 usage_02690.pdb 1 -----LAVHASPRGERSQSRRLAEVFLAAYREAHPQARVARRE 38 usage_02691.pdb 1 -----LAVHASPRGERSQSRRLAEVFLAAYREAHPQARVARRE 38 usage_03004.pdb 1 -MSRILAVHASPRGERSQSRRLAEVFLAAYREAHPQARVARRE 42 usage_03005.pdb 1 -----LAVHASPRGERSQSRRLAEVFLAAYREAHPQARVARRE 38 usage_03858.pdb 1 -MSRILAVHASPRGERSQSRRLAEVFLAAYREAHPQARVARRE 42 usage_03894.pdb 1 ----VLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRD 39 usage_03895.pdb 1 AMSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRD 43 L S SQS LA F AH R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################