################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:36 2021 # Report_file: c_0777_56.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00471.pdb # 2: usage_00480.pdb # 3: usage_00668.pdb # 4: usage_01170.pdb # 5: usage_01249.pdb # 6: usage_01587.pdb # # Length: 66 # Identity: 58/ 66 ( 87.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/ 66 ( 87.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 66 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00471.pdb 1 RVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQ--FPRTPDDDLAQLRAEGVE 58 usage_00480.pdb 1 RVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQ--F--TPDDDLAQLRAEGVE 56 usage_00668.pdb 1 RVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNP--------PDDDLAQLRAEGVE 52 usage_01170.pdb 1 RVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQAY-PRTPDDDLAQLRAEGVE 59 usage_01249.pdb 1 RVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQ-----TPDDDLAQLRAEGVE 55 usage_01587.pdb 1 RVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNP--------PDDDLAQLRAEGVE 52 RVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNP PDDDLAQLRAEGVE usage_00471.pdb 59 IAFTPT 64 usage_00480.pdb 57 IAFTPT 62 usage_00668.pdb 53 IAFTPT 58 usage_01170.pdb 60 IAFTPT 65 usage_01249.pdb 56 IAFTPT 61 usage_01587.pdb 53 IAFTPT 58 IAFTPT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################