################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:09 2021 # Report_file: c_0876_13.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00096.pdb # 2: usage_00132.pdb # 3: usage_00254.pdb # 4: usage_00336.pdb # 5: usage_00337.pdb # # Length: 110 # Identity: 55/110 ( 50.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/110 ( 50.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/110 ( 28.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00096.pdb 1 --PVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWP------------ 46 usage_00132.pdb 1 ATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDW------------- 47 usage_00254.pdb 1 --PVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFH- 57 usage_00336.pdb 1 ATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGA--F 58 usage_00337.pdb 1 ATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGA--F 58 PVD WSVGCIFAEMFRRKPLF G S DQLGKI D IGLP E DW usage_00096.pdb 47 ----AQPIEKFV-TDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDL 91 usage_00132.pdb 48 ------------VPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL--- 82 usage_00254.pdb 58 ---SAQPIEKFV-TDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF--- 100 usage_00336.pdb 59 PPRGPRPVQSVV-PEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL--- 104 usage_00337.pdb 59 PPRGPRPVQSVV-PEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL--- 104 E G LLL LTFNP KRISA AL H Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################