################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:51:31 2021 # Report_file: c_0793_22.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00408.pdb # 2: usage_00409.pdb # 3: usage_00410.pdb # 4: usage_00411.pdb # 5: usage_00412.pdb # 6: usage_00413.pdb # 7: usage_00414.pdb # 8: usage_00415.pdb # 9: usage_00432.pdb # 10: usage_00433.pdb # 11: usage_00434.pdb # 12: usage_00435.pdb # # Length: 66 # Identity: 64/ 66 ( 97.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 64/ 66 ( 97.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 66 ( 3.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00408.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00409.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00410.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00411.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00412.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00413.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00414.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00415.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00432.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00433.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00434.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 usage_00435.pdb 1 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI 60 KRYTITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETI usage_00408.pdb 61 SAAKES 66 usage_00409.pdb 61 SAAKES 66 usage_00410.pdb 61 SAAKES 66 usage_00411.pdb 61 SAAKES 66 usage_00412.pdb 61 SAAKES 66 usage_00413.pdb 61 SAAKES 66 usage_00414.pdb 61 SAAKES 66 usage_00415.pdb 61 SAAKES 66 usage_00432.pdb 61 SAAKES 66 usage_00433.pdb 61 SAAKES 66 usage_00434.pdb 61 SAAKE- 65 usage_00435.pdb 61 SAAK-- 64 SAAK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################