################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:31 2021 # Report_file: c_1316_88.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00250.pdb # 2: usage_00251.pdb # 3: usage_00469.pdb # 4: usage_00493.pdb # 5: usage_00874.pdb # 6: usage_00875.pdb # 7: usage_00958.pdb # 8: usage_00959.pdb # 9: usage_00960.pdb # 10: usage_01109.pdb # 11: usage_01110.pdb # 12: usage_01501.pdb # # Length: 35 # Identity: 19/ 35 ( 54.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 35 ( 54.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 35 ( 5.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00250.pdb 1 NAEAIADEIEKMIRVYQDDDTNVEPMYDGKRLLVQ 35 usage_00251.pdb 1 NAEAIADEIEKMIRVYQDDDTNVEPMYDGKRLLVQ 35 usage_00469.pdb 1 --ESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 33 usage_00493.pdb 1 -AESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 34 usage_00874.pdb 1 -AESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 34 usage_00875.pdb 1 -AESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 34 usage_00958.pdb 1 --ESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 33 usage_00959.pdb 1 -AESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 34 usage_00960.pdb 1 -AESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 34 usage_01109.pdb 1 --ESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 33 usage_01110.pdb 1 --ESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 33 usage_01501.pdb 1 -AESIAAAAKEMIQVTEDDDTNVELLGGGKRALVQ 34 E IA MI V DDDTNVE GKR LVQ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################