################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:15:50 2021 # Report_file: c_0677_85.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00104.pdb # 2: usage_00248.pdb # 3: usage_00705.pdb # 4: usage_01023.pdb # 5: usage_01024.pdb # 6: usage_01025.pdb # 7: usage_01026.pdb # 8: usage_01027.pdb # 9: usage_01028.pdb # 10: usage_01029.pdb # 11: usage_01030.pdb # 12: usage_01205.pdb # 13: usage_01206.pdb # 14: usage_01417.pdb # 15: usage_01573.pdb # 16: usage_01574.pdb # # Length: 41 # Identity: 34/ 41 ( 82.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 41 ( 95.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 41 ( 4.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00104.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_00248.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_00705.pdb 1 VAEV-CITFDQANLTVKLPDGYEFKFPNHLNLEAINYMAAD 40 usage_01023.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01024.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01025.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01026.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01027.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01028.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01029.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01030.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01205.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01206.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01417.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01573.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 usage_01574.pdb 1 -SVAEVITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAAD 40 sva vITFDQANLTVKLPDGYEFKFPNrLNLEAINYMAAD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################