################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:48 2021 # Report_file: c_1484_32.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_01767.pdb # 2: usage_01768.pdb # 3: usage_01769.pdb # 4: usage_02168.pdb # 5: usage_04858.pdb # # Length: 77 # Identity: 31/ 77 ( 40.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 57/ 77 ( 74.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 77 ( 11.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01767.pdb 1 ----STLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETK 56 usage_01768.pdb 1 ---MSTLKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETK 57 usage_01769.pdb 1 ------LKEVQDNITLHEQRLVTTRQKLKDAERAVELDPDDVNKSTLQSRRAAVSALETK 54 usage_02168.pdb 1 PFTMSTLQELQENITAHEQQLVTARQKLKDAEKAVEVDPDDVNKSTLQNRRAAVSTLETK 60 usage_04858.pdb 1 -----TMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDREGVAVSIQAK 55 l E Q nIt HEq LVt RQKlkDAE avE DPDdvNKsTLq Rraavs letK usage_01767.pdb 57 LGELKRELADLIAAQ-- 71 usage_01768.pdb 58 LGELKRELADLIAAQKL 74 usage_01769.pdb 55 LGELKRELADLIAA--- 68 usage_02168.pdb 61 LGELKRQLADLVAAQ-- 75 usage_04858.pdb 56 IDELKRQLADRIAT--- 69 lgELKR LADliAa #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################