################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:15 2021 # Report_file: c_0603_12.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00002.pdb # 2: usage_00028.pdb # 3: usage_00029.pdb # 4: usage_00036.pdb # 5: usage_00057.pdb # # Length: 78 # Identity: 7/ 78 ( 9.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 78 ( 19.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 78 ( 19.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00002.pdb 1 --G-KALRFLRERMNWKKEEIVVFGDNENDLFMFEEAGLRVAMENAIEKVKEASDIVTLT 57 usage_00028.pdb 1 HKA-NGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDD 59 usage_00029.pdb 1 -KA-NGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGNAAENIKQIARYATDD 58 usage_00036.pdb 1 --G-SGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVAVAQAPKILKENADYVTKK 57 usage_00057.pdb 1 ---KGELLVLQRLLNISKTNTLVVGDGANDLS-FKHAHIKIAF-NAKEVLKQHATHCINE 55 l GD ND k a A nA e K a t usage_00002.pdb 58 NNDSGVSYVLERI----- 70 usage_00028.pdb 60 NNHEGALNVIQAVLD-N- 75 usage_00029.pdb 59 NNHEGALNVIQAVLD-N- 74 usage_00036.pdb 58 EYGEGGAEAIYHILEKFG 75 usage_00057.pdb 56 P---DLALIKPL------ 64 g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################