################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:48 2021 # Report_file: c_1135_40.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00842.pdb # 2: usage_00843.pdb # 3: usage_00844.pdb # 4: usage_00845.pdb # 5: usage_00881.pdb # 6: usage_00882.pdb # # Length: 90 # Identity: 26/ 90 ( 28.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 90 ( 28.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 90 ( 17.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00842.pdb 1 PLLLNNMWRSWLNLHNGTD--ARALIEIYNDTQSDLAEVHSQFATGVLTLEHRAWAEQTS 58 usage_00843.pdb 1 PLLLNNMWRSWLNLHNGTD--ARALIEIYNDTQSDLAEVHSQFATGVLTLEHRAWAEQTS 58 usage_00844.pdb 1 -LLLNNMWRSWLNLHNGTDAR--ALIEIYNDTQSDLAEVHSQFATGVLTLEHRAWAEQTS 57 usage_00845.pdb 1 -LLLNNMWRSWLNLHNGTD--ARALIEIYNDTQSDLAEVHSQFATGVLTLEHRAWAEQTS 57 usage_00881.pdb 1 -RALQSMWETWQEMHEPGT--RRSLREWLHDSQMDLHDIHIGYSSGIFSLQERAWAEQLY 57 usage_00882.pdb 1 -RALQSMWETWQEMHEPGT--RRSLREWLHDSQMDLHDIHIGYSSGIFSLQERAWAEQLY 57 L MW W H L E D Q DL H G L RAWAEQ usage_00842.pdb 59 LRIYYELNRLMSTKNRFHRPILDELSERLA 88 usage_00843.pdb 59 LRIYYELNRLMSTKNRFHRPILDELSERL- 87 usage_00844.pdb 58 LRIYYELNRLMSTKNRFHRPILDELSERLA 87 usage_00845.pdb 58 LRIYYELNRLMSTKNRFHRPILDELSERLA 87 usage_00881.pdb 58 LSMCHEVQKQLDPQNRAHRPIIDELQERM- 86 usage_00882.pdb 58 LSMCHEVQKQLDPQNRAHR----------- 76 L E NR HR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################