################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:16:51 2021
# Report_file: c_1143_36.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_00300.pdb
#   2: usage_00426.pdb
#   3: usage_00427.pdb
#   4: usage_00428.pdb
#   5: usage_00429.pdb
#   6: usage_00486.pdb
#   7: usage_00549.pdb
#   8: usage_00550.pdb
#   9: usage_00578.pdb
#  10: usage_00579.pdb
#  11: usage_00580.pdb
#  12: usage_00599.pdb
#  13: usage_00600.pdb
#  14: usage_00675.pdb
#
# Length:         30
# Identity:        6/ 30 ( 20.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      8/ 30 ( 26.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 30 ( 13.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00300.pdb         1  FKVALKRPAYVVVYDYYNTNLNAIKVYEVD   30
usage_00426.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMF----   26
usage_00427.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMF----   26
usage_00428.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMF----   26
usage_00429.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMF----   26
usage_00486.pdb         1  FNVELIQPGAVKVYAYYNLEESCTRFYHP-   29
usage_00549.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMF----   26
usage_00550.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMF----   26
usage_00578.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMFYSTS   30
usage_00579.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMFYSTS   30
usage_00580.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMF----   26
usage_00599.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMFYST-   29
usage_00600.pdb         1  FEVGFLSPATFTVYEYHRPDKQCTMFYST-   29
usage_00675.pdb         1  FNVGLIQPGAVKVYSYYNLDETCIRFYHP-   29
                           F V    P    VY Y      c  f    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################