################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:12 2021 # Report_file: c_0582_37.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00046.pdb # 2: usage_00061.pdb # 3: usage_00206.pdb # 4: usage_00235.pdb # 5: usage_00300.pdb # # Length: 78 # Identity: 7/ 78 ( 9.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 78 ( 39.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 78 ( 21.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 -FHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAI 59 usage_00061.pdb 1 -FHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAI 59 usage_00206.pdb 1 ENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVY-------RDGTGVVEFVRKEDMTYAV 53 usage_00235.pdb 1 -FHVFVGDLSPEITTAAIAAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAI 59 usage_00300.pdb 1 --NLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAI 58 vfv L pe d f pfG A V skg GfVsf nk da Ai usage_00046.pdb 60 QQMGGQWLGG-RQIRTN- 75 usage_00061.pdb 60 QQMGGQWLGG-RQIRTN- 75 usage_00206.pdb 54 RKLDNTKFRSH------- 64 usage_00235.pdb 60 QQMGGQWLGG-RQIRTNW 76 usage_00300.pdb 59 QSMNGFQIGM-KRLKVQ- 74 q m g g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################