################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:05:23 2021 # Report_file: c_1300_5.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00063.pdb # 2: usage_00067.pdb # 3: usage_00108.pdb # 4: usage_00243.pdb # 5: usage_00473.pdb # 6: usage_00494.pdb # 7: usage_00603.pdb # 8: usage_00616.pdb # 9: usage_00634.pdb # # Length: 50 # Identity: 8/ 50 ( 16.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 50 ( 60.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 50 ( 18.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00063.pdb 1 ---RMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSD--CTLKILD-- 43 usage_00067.pdb 1 DHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSD--CTLKILD-- 46 usage_00108.pdb 1 -ESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKL-- 47 usage_00243.pdb 1 DHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSD--CTLKILDFG 48 usage_00473.pdb 1 -HERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSD--CTLKI---- 43 usage_00494.pdb 1 -DDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED--CELKILD-- 45 usage_00603.pdb 1 -HERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSD--CTLKILD-- 45 usage_00616.pdb 1 ---RMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSD--CTLKILD-- 43 usage_00634.pdb 1 ---RMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSD--CTLKILD-- 43 llyq l G khlhsagIiHRDlKPsNi v d c lki #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################