################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:41:11 2021
# Report_file: c_1255_141.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00489.pdb
#   2: usage_00914.pdb
#   3: usage_00934.pdb
#   4: usage_00935.pdb
#   5: usage_00968.pdb
#   6: usage_00969.pdb
#   7: usage_00988.pdb
#   8: usage_01220.pdb
#   9: usage_01221.pdb
#  10: usage_01486.pdb
#  11: usage_01735.pdb
#
# Length:         35
# Identity:        3/ 35 (  8.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      8/ 35 ( 22.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            7/ 35 ( 20.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00489.pdb         1  -----LVLIGFMGSGKSSLAQELGLALKLEVLDT-   29
usage_00914.pdb         1  --MLLHLIYGPTCSGKTDMAIQIAQETGWPVVA--   31
usage_00934.pdb         1  ----KAIFLGPTASGKTALAIELRKILPVELISVD   31
usage_00935.pdb         1  ---PKAIFLGPTASGKTALAIELRKILPVELISVD   32
usage_00968.pdb         1  ---KAIFLMGPTASGKTALAIELRKILPVELISVD   32
usage_00969.pdb         1  --PKAIFLMGPTASGKTALAIELRKILPVELISVD   33
usage_00988.pdb         1  RKEKLLVLMGATGTGKSRLSIDLAAHFPLEVINSD   35
usage_01220.pdb         1  --PPAIFLMGPTAAGKTDLAMALADALPCELISVD   33
usage_01221.pdb         1  --PPAIFLMGPTAAGKTDLAMALADALPCELISVD   33
usage_01486.pdb         1  --PKAIFLMGPTASGKTALAIELRKILPVELISVD   33
usage_01735.pdb         1  ---PAIFLMGPTAAGKTDLAMALADALPCELISVD   32
                                    G t  GK  la  l      e     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################