################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:35 2021 # Report_file: c_0786_20.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00138.pdb # 2: usage_00139.pdb # 3: usage_00140.pdb # 4: usage_00141.pdb # 5: usage_00473.pdb # 6: usage_00474.pdb # 7: usage_00682.pdb # 8: usage_00683.pdb # 9: usage_01144.pdb # # Length: 77 # Identity: 25/ 77 ( 32.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 77 ( 35.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 77 ( 5.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00138.pdb 1 ---IGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEATETR 57 usage_00139.pdb 1 ---IGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEATETR 57 usage_00140.pdb 1 ---IGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEATETR 57 usage_00141.pdb 1 TKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEATETR 60 usage_00473.pdb 1 ---IGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEATETR 57 usage_00474.pdb 1 -KKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEATETR 59 usage_00682.pdb 1 -LNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEV 59 usage_00683.pdb 1 ALNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEV 60 usage_01144.pdb 1 GKKIGVVLSGCGVYDGTEIHEAVLTLLAIARSGAQAVCFAPDKPQADVINHLTGEAMAET 60 ViL GCG DGsEI EAVL L R CFAP K Q V H E usage_00138.pdb 58 NVLIEAARITR-GEIRP 73 usage_00139.pdb 58 NVLIEAARITR-GEIRP 73 usage_00140.pdb 58 NVLIEAARITR-GEIRP 73 usage_00141.pdb 61 NVLIEAARITR-GEIRP 76 usage_00473.pdb 58 NVLIEAARITR-GEIRP 73 usage_00474.pdb 60 NVLIEAARITR-GEIRP 75 usage_00682.pdb 60 RNILVESARIARGSVYD 76 usage_00683.pdb 61 RNILVESARIARGSVYD 77 usage_01144.pdb 61 RNVLIEAARITRGDIRP 77 G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################