################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:27 2021 # Report_file: c_1368_87.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00001.pdb # 2: usage_00002.pdb # 3: usage_00118.pdb # 4: usage_00246.pdb # 5: usage_00516.pdb # 6: usage_00572.pdb # 7: usage_00573.pdb # 8: usage_00842.pdb # 9: usage_00843.pdb # 10: usage_00964.pdb # 11: usage_00966.pdb # 12: usage_01049.pdb # 13: usage_01395.pdb # 14: usage_01542.pdb # # Length: 33 # Identity: 32/ 33 ( 97.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 33 ( 97.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 33 ( 3.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_00002.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_00118.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIF- 32 usage_00246.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_00516.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_00572.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIF- 32 usage_00573.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIF- 32 usage_00842.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_00843.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_00964.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_00966.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_01049.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK 33 usage_01395.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIF- 32 usage_01542.pdb 1 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIF- 32 PPWVNIWLLGSICLSMSLHFLILYVDPLPMIF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################