################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:41:33 2021 # Report_file: c_0581_43.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00053.pdb # 2: usage_00054.pdb # 3: usage_00055.pdb # 4: usage_00236.pdb # 5: usage_00287.pdb # 6: usage_00296.pdb # 7: usage_00523.pdb # # Length: 77 # Identity: 3/ 77 ( 3.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 77 ( 11.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 77 ( 23.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00053.pdb 1 -NLYVTNLPRT-ITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI 58 usage_00054.pdb 1 -NLYVTNLPRT-ITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI 58 usage_00055.pdb 1 -NLYVTNLPRT-ITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI 58 usage_00236.pdb 1 NTVFVGGIDVR-MDETEIRSFFARYGSVKEVKIITDR-TGVSKGYGFVSFYNDVDVQKIV 58 usage_00287.pdb 1 -VLYVGGLAEE-VDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAI 58 usage_00296.pdb 1 -RVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHK-------G-FAFVQYVNERNARAAV 51 usage_00523.pdb 1 --LYISGLPRT-MTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAI 57 l F G i aFv a a usage_00053.pdb 59 SALNNVP---LSVRL-- 70 usage_00054.pdb 59 SALNNVP---LSVRL-- 70 usage_00055.pdb 59 SALNNVP---LSVRL-- 70 usage_00236.pdb 59 ES--QINFHGKKLKLGP 73 usage_00287.pdb 59 DNMNESELFGRTIRVNL 75 usage_00296.pdb 52 AGEDGRMIAGQVLDINL 68 usage_00523.pdb 58 TSFNGHKGSSEPITV-- 72 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################