################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:58 2021 # Report_file: c_1261_76.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00025.pdb # 2: usage_00492.pdb # 3: usage_00781.pdb # 4: usage_00782.pdb # 5: usage_03983.pdb # 6: usage_03984.pdb # 7: usage_03985.pdb # 8: usage_03986.pdb # 9: usage_04166.pdb # 10: usage_04795.pdb # # Length: 37 # Identity: 24/ 37 ( 64.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 37 ( 64.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 37 ( 2.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEAVKREDLFIVSK- 36 usage_00492.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEAVKREDLFIVSK- 36 usage_00781.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEAVKREDLFIVSK- 36 usage_00782.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEAVKREDLFIVSK- 36 usage_03983.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEAVKREDLFIVSK- 36 usage_03984.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEKAVKREDLFIVSK 37 usage_03985.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEAVKREDLFIVSK- 36 usage_03986.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEKAVKREDLFIVSK 37 usage_04166.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEAVKREDLFIVSK- 36 usage_04795.pdb 1 RHIDCAYVYQNEHEVGEAIQEIQEAVKREDLFIVSK- 36 RHIDCAYVYQNEHEVGEAIQEIQE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################