################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:20:08 2021
# Report_file: c_1428_138.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00202.pdb
#   2: usage_00371.pdb
#   3: usage_00990.pdb
#   4: usage_01434.pdb
#   5: usage_02001.pdb
#
# Length:         68
# Identity:        8/ 68 ( 11.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     15/ 68 ( 22.1%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           23/ 68 ( 33.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00202.pdb         1  PPDHTRLRRLVGKAFTARRVEEMRPRVRSLVDSLLDDMVAHGS---PADLVEFLAVPFPV   57
usage_00371.pdb         1  ---------------TPEAVKNLQPYIQRTVDDLLEQMKQKGCANGPVDLVKEFALPVPS   45
usage_00990.pdb         1  ---------------TMRRVEALRPRIQEITDGLLDEMLPR-G---RADLVDSFAYPLPI   41
usage_01434.pdb         1  ---------------TPRRITAVQPFVRSTVEQLIDKL--PQG---DFDFVQHFPHPLPA   40
usage_02001.pdb         1  ---------------TPRRITAVQPFVRSTVEQLIDKL--PQG---DFDFVQHFPHPLPA   40
                                          T rr     P     v  L d            D V  f  P P 

usage_00202.pdb        58  AVICELLG   65
usage_00371.pdb        46  YIIYTLLG   53
usage_00990.pdb        42  TVICELL-   48
usage_01434.pdb        41  LVMCQL--   46
usage_02001.pdb        41  LVMCQLL-   47
                            v c L  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################