################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:24:15 2021 # Report_file: c_1100_7.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00012.pdb # 2: usage_00026.pdb # 3: usage_00027.pdb # 4: usage_00248.pdb # 5: usage_00249.pdb # 6: usage_00663.pdb # # Length: 80 # Identity: 36/ 80 ( 45.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 80 ( 51.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 33/ 80 ( 41.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 ----YQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN 56 usage_00026.pdb 1 --TAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN 58 usage_00027.pdb 1 ---FEQVVNELF-------VNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN 50 usage_00248.pdb 1 ----YQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN 56 usage_00249.pdb 1 ----YQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLN 56 usage_00663.pdb 1 FSFGGALCVESV------------------------DKE----MQVLVSRIAAWMATYLN 32 q v ves MQVLVSRIAAWMATYLN usage_00012.pdb 57 DHLEPWIQENGGWDTFVEL- 75 usage_00026.pdb 59 DHLEPWIQENGGWDTFVELY 78 usage_00027.pdb 51 DHLEPWIQENGGWDTFVELY 70 usage_00248.pdb 57 DHLEPWIQENGGWDTFVEL- 75 usage_00249.pdb 57 DHLEPWIQENGGWDTFVEL- 75 usage_00663.pdb 33 DHLEPWIQENGGWDTFVEL- 51 DHLEPWIQENGGWDTFVEL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################