################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:48 2021 # Report_file: c_0835_43.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00714.pdb # 2: usage_00764.pdb # 3: usage_00837.pdb # 4: usage_01387.pdb # 5: usage_01388.pdb # 6: usage_01402.pdb # # Length: 68 # Identity: 12/ 68 ( 17.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 68 ( 88.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 68 ( 11.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00714.pdb 1 -PKDASAMVTLLDLA---PGMRVLEAGTGSGGLTLFLARAVGEKGLVESYEARPHHLAQA 56 usage_00764.pdb 1 GTVEGQMLQLLIR--MAGI-HSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTA 57 usage_00837.pdb 1 -TVEGQMLQLLIR--MAGI-HSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTA 56 usage_01387.pdb 1 GTVEGQMLQLLIR--MAGI-HSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTA 57 usage_01388.pdb 1 -TVEGQMLQLLIR--MAGI-HSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTA 56 usage_01402.pdb 1 -TVEGQMLQLLIR--MAGI-HSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTA 56 tvegqmlqlLir i hsivEvGTcvGfsaicmAhAlpsKGhiytiEkdyenvvtA usage_00714.pdb 57 ERNVRAF- 63 usage_00764.pdb 58 NQNIVNCK 65 usage_00837.pdb 57 NQNIVNCK 64 usage_01387.pdb 58 NQNIVNCK 65 usage_01388.pdb 57 NQNIVNCK 64 usage_01402.pdb 57 NQNIVNCK 64 nqNivnc #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################