################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:22:37 2021
# Report_file: c_0417_7.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00016.pdb
#   2: usage_00024.pdb
#   3: usage_00085.pdb
#   4: usage_00086.pdb
#   5: usage_00087.pdb
#   6: usage_00088.pdb
#
# Length:         76
# Identity:       18/ 76 ( 23.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     53/ 76 ( 69.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           23/ 76 ( 30.3%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00016.pdb         1  RQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEV   60
usage_00024.pdb         1  --------------------LESHIYYSRLPELK--GKIVVILDPMLATGGTLEVALREI   38
usage_00085.pdb         1  ---------------------DVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEV   39
usage_00086.pdb         1  --------------------MDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEV   40
usage_00087.pdb         1  ---------------------DVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEV   39
usage_00088.pdb         1  --------------------MDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEV   40
                                                dvyIYYkkiPdir  vdnViIaDPMiATasTmlkvLeEv

usage_00016.pdb        61  VKANPKRIYIVSIISS   76
usage_00024.pdb        39  LKHSPLKVKSVHAIAA   54
usage_00085.pdb        40  VKANPKRIYIVSIISS   55
usage_00086.pdb        41  VKANPKRIYIVSIISS   56
usage_00087.pdb        40  VKANPKRIYIVSIISS   55
usage_00088.pdb        41  VKANPKRIYIVSIISS   56
                           vKanPkriyiVsiIss


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################