################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:05 2021 # Report_file: c_0900_129.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00210.pdb # 2: usage_00321.pdb # 3: usage_00416.pdb # 4: usage_00482.pdb # 5: usage_00483.pdb # 6: usage_00484.pdb # 7: usage_00485.pdb # 8: usage_00859.pdb # 9: usage_01118.pdb # 10: usage_01220.pdb # # Length: 41 # Identity: 7/ 41 ( 17.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 41 ( 26.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 41 ( 22.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00210.pdb 1 GVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF-P 40 usage_00321.pdb 1 GVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF-P 40 usage_00416.pdb 1 GVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISF-P 40 usage_00482.pdb 1 GVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISF-P 40 usage_00483.pdb 1 GVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISF-P 40 usage_00484.pdb 1 GVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISF-P 40 usage_00485.pdb 1 GVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISF-P 40 usage_00859.pdb 1 GVDLHHAKDSEGVEIMLGVCASGLLIYRLR-----INRF-A 35 usage_01118.pdb 1 --DLHKAKDLEGVDIILGVCSSGLLVYKDKLR---INR-FP 35 usage_01220.pdb 1 GVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF-P 40 G e LGV a GL iY p #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################