################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:23:35 2021 # Report_file: c_0467_51.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00025.pdb # 2: usage_00026.pdb # 3: usage_00027.pdb # 4: usage_00084.pdb # 5: usage_00590.pdb # 6: usage_00591.pdb # 7: usage_00592.pdb # 8: usage_00597.pdb # 9: usage_00598.pdb # 10: usage_00661.pdb # # Length: 96 # Identity: 7/ 96 ( 7.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 96 ( 30.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/ 96 ( 30.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 -------------------------GISYCSVCDAPLFKNRVVAVIGGGDSALEGAEILS 35 usage_00026.pdb 1 --------VKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEILS 52 usage_00027.pdb 1 -------------------------GISYCSVCDAPLFKNRVVAVIGGGDSALEGAEILS 35 usage_00084.pdb 1 ------G-VVDELPELEGLEERWGESVFHCPYCHGYELDGGRIGVLGSGPLSYLSAMLMP 53 usage_00590.pdb 1 -------------------------GISYCSVADAPLFKNRVVAVIGGGDSALEGAEILS 35 usage_00591.pdb 1 -------------------------GISYCSVADAPLFKNRVVAVIGGGDSALEGAEILS 35 usage_00592.pdb 1 --------VKRRKLGVPGEQEFAGRGISYCSVADAPLFKNRVVAVIGGGDSALEGAEILS 52 usage_00597.pdb 1 --------GSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLA 52 usage_00598.pdb 1 --------GSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLA 52 usage_00661.pdb 1 KAVIVCTGSAPKKAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLA 60 g s C d kn vaV GgGd a e A l usage_00025.pdb 36 SYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVL- 70 usage_00026.pdb 53 SYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVL- 87 usage_00027.pdb 36 SYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVL- 70 usage_00084.pdb 54 EWG-QTVFLTDASF-EPDEEQREALARRG-VEIVR- 85 usage_00590.pdb 36 SYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLN 71 usage_00591.pdb 36 SYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVL- 70 usage_00592.pdb 53 SYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVL- 87 usage_00597.pdb 53 NICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLT- 87 usage_00598.pdb 53 NICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLT- 87 usage_00661.pdb 61 NICSKIYLIHRRDEFRAAPSTVEKVKKNEKIELIT- 95 k ylihrrd p E k E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################