################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:28 2021 # Report_file: c_1390_67.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00069.pdb # 2: usage_00072.pdb # 3: usage_00073.pdb # 4: usage_00673.pdb # 5: usage_00874.pdb # 6: usage_00875.pdb # 7: usage_00876.pdb # 8: usage_00877.pdb # 9: usage_00896.pdb # 10: usage_00924.pdb # 11: usage_01036.pdb # 12: usage_01037.pdb # # Length: 31 # Identity: 15/ 31 ( 48.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 31 ( 96.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 31 ( 3.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00069.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00072.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00073.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00673.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00874.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00875.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00876.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00877.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00896.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_00924.pdb 1 NSADQINNPNSVFNYYRKLINIRHDIPALTY 31 usage_01036.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 usage_01037.pdb 1 -AAREIGDPKSVYSFYRNLISIRHETPALST 30 aAreIgdPkSVysfYRnLIsIRHetPALst #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################