################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:53:12 2021
# Report_file: c_1156_23.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00255.pdb
#   2: usage_00256.pdb
#   3: usage_00416.pdb
#   4: usage_00417.pdb
#   5: usage_00418.pdb
#   6: usage_00534.pdb
#   7: usage_00705.pdb
#   8: usage_00706.pdb
#   9: usage_00794.pdb
#  10: usage_00796.pdb
#  11: usage_00797.pdb
#  12: usage_01072.pdb
#
# Length:         30
# Identity:        8/ 30 ( 26.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      9/ 30 ( 30.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            5/ 30 ( 16.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00255.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
usage_00256.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
usage_00416.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
usage_00417.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
usage_00418.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
usage_00534.pdb         1  QRTLKRIVQATGVGLHTGKKVTLTL-----   25
usage_00705.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
usage_00706.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
usage_00794.pdb         1  EKTVKEKLSFEGVGIHTGEYSKLII-----   25
usage_00796.pdb         1  EKTVKEKLSFEGVGIHTGEYSKLII-----   25
usage_00797.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
usage_01072.pdb         1  QRTLKNIIRATGVGLHSGEKVYLTLKPAPV   30
                             T K      GVG H Ge   L       


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################