################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:18 2021 # Report_file: c_1197_95.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00015.pdb # 2: usage_00016.pdb # 3: usage_00111.pdb # 4: usage_00112.pdb # 5: usage_00120.pdb # 6: usage_00227.pdb # 7: usage_00342.pdb # 8: usage_00403.pdb # 9: usage_00476.pdb # 10: usage_00739.pdb # 11: usage_00740.pdb # 12: usage_00747.pdb # # Length: 37 # Identity: 26/ 37 ( 70.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 37 ( 73.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 37 ( 27.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYE------- 29 usage_00016.pdb 1 VAYRMPDGREVTTTPLAAD-DWKGVEPIYETMP---- 32 usage_00111.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMP---- 32 usage_00112.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMPGWSE 36 usage_00120.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMP---- 32 usage_00227.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMPGWSE 36 usage_00342.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMPGWSE 36 usage_00403.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMPGWSE 36 usage_00476.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMP---- 32 usage_00739.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMP---- 32 usage_00740.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIYETMP---- 32 usage_00747.pdb 1 VAYRMPDGREVTTTPLA-ADDWKGVEPIY-------- 28 VAYRMPDGREVTTTPLA a DWKGVEPIY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################