################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:18:34 2021 # Report_file: c_1235_4.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00001.pdb # 2: usage_00068.pdb # 3: usage_00085.pdb # 4: usage_00088.pdb # 5: usage_00106.pdb # 6: usage_00135.pdb # 7: usage_00188.pdb # 8: usage_00216.pdb # 9: usage_00235.pdb # 10: usage_00268.pdb # # Length: 63 # Identity: 37/ 63 ( 58.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 52/ 63 ( 82.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 63 ( 1.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 GLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYH 60 usage_00068.pdb 1 GLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKENYQKCATAGCHDNMDKKDKSAKGYYH 60 usage_00085.pdb 1 GLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYH 60 usage_00088.pdb 1 GLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYH 60 usage_00106.pdb 1 GLKMDKTKQPVVFNHSVHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGYYH 60 usage_00135.pdb 1 GLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGYYH 60 usage_00188.pdb 1 GLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKEDLQKCATAGCHDNMDKKDKSAKGYYH 60 usage_00216.pdb 1 GLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKKDYQKCATAGCHDNMDKKDKSAKGYYH 60 usage_00235.pdb 1 GLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGYLH 60 usage_00268.pdb 1 GLKMENTKMPVIFNHSSHSSYQCADCHHPVDGKENLAKCATAGCHDVFDKKDKSVHSYYK 60 GLKM TKqPVvFNHS Hk vkCgDCHHPVnGKe KC TAGCHD mDKKDKSakgYyh usage_00001.pdb 61 VMH 63 usage_00068.pdb 61 AMH 63 usage_00085.pdb 61 VMH 63 usage_00088.pdb 61 VMH 63 usage_00106.pdb 61 AMH 63 usage_00135.pdb 61 AMH 63 usage_00188.pdb 61 AMH 63 usage_00216.pdb 61 AMH 63 usage_00235.pdb 61 AMH 63 usage_00268.pdb 61 II- 62 m #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################