################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:23:57 2021 # Report_file: c_0897_4.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00046.pdb # 2: usage_00121.pdb # 3: usage_00124.pdb # 4: usage_00125.pdb # 5: usage_00282.pdb # 6: usage_00283.pdb # # Length: 82 # Identity: 8/ 82 ( 9.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 82 ( 32.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 82 ( 17.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 -SSQNKKAIEELGNLIKA-----NAEAWGADALARLFELHPQTKTYFSKFSGF-----EA 49 usage_00121.pdb 1 NRQEISDLCVKSLEGRM-VGTEAQNIENGNAFYRYFFTNFPDLRVYFKGAEKY-TADDVK 58 usage_00124.pdb 1 -SEAERKAVQAMWARLYA-----NSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEME 54 usage_00125.pdb 1 -SEAERKAVQAMWARLYA-----NSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEME 54 usage_00282.pdb 1 -SEAERKAVQAMWARLYA-----NSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEME 54 usage_00283.pdb 1 -SEAERKAVQAMWARLYA-----NSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEME 54 s ka n e G a l rfF nfP k YFs f usage_00046.pdb 50 CNEQVKKHGKRVMNALADAT-- 69 usage_00121.pdb 59 KSERFDKQGQRILLACHLLAN- 79 usage_00124.pdb 55 RSPQLRKHASRVMGALNTVVEN 76 usage_00125.pdb 55 RSPQLRKHASRVMGALNTVVEN 76 usage_00282.pdb 55 RSPQLRKQASRVMGALNTVVEN 76 usage_00283.pdb 55 RSPQLRKQASRVMGALNTVVEN 76 s q K Rvm Al #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################