################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:33:22 2021 # Report_file: c_1429_105.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00066.pdb # 2: usage_00067.pdb # 3: usage_00915.pdb # 4: usage_00916.pdb # 5: usage_01666.pdb # 6: usage_01708.pdb # # Length: 73 # Identity: 8/ 73 ( 11.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 73 ( 27.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 28/ 73 ( 38.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00066.pdb 1 -TSFATPIVSGVAALLLSEQVRRGETPDPQKVRQLLLQSALPCDDDAPEQARRC--LAGR 57 usage_00067.pdb 1 -TSMAAPVMTGISALLMSLQVQQGKPVDAEAVRTALLKT--------------C--LRGF 43 usage_00915.pdb 1 -TSFATPIVSGVAALLLSEQVRRGETPDPQKVRQLLLQSALPC-------ARRC--LAGR 50 usage_00916.pdb 1 -TAFATPIVSGVAALLLSEQVRRGETPDPQKVRQLLLQSALPC-------ARRC--LAGR 50 usage_01666.pdb 1 -NSFATPKVSGALALVVDKYG---I-KNPNQLKRFLLMNSPEV-------N---GN--RV 43 usage_01708.pdb 1 GTSMAAPVMTGISALLMSLQVQQGKPVDAEAVRTALLKTAIP--------------LRGF 46 ts A P G ALl s qv d vr LL g usage_00066.pdb 58 LNVSGAFTLL--- 67 usage_00067.pdb 44 VNIPGAMKVL--- 53 usage_00915.pdb 51 LNVSGAFTLLKG- 62 usage_00916.pdb 51 LNVSGAFTLLKGG 63 usage_01666.pdb 44 LNIVDLLNG---- 52 usage_01708.pdb 47 VNIPGAMKV---- 55 N ga #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################