################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:04 2021 # Report_file: c_1308_13.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00113.pdb # 2: usage_00157.pdb # 3: usage_00158.pdb # 4: usage_00217.pdb # 5: usage_00387.pdb # 6: usage_00465.pdb # 7: usage_00466.pdb # 8: usage_00473.pdb # 9: usage_00753.pdb # 10: usage_00774.pdb # # Length: 40 # Identity: 30/ 40 ( 75.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 40 ( 75.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 40 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00113.pdb 1 FRSLYPSIIITHNVSPDTLNREGCKEYDVAPEVGHKFCKD 40 usage_00157.pdb 1 ----YPSIIITHNVSPDTLNREGCKEYDVAPEVGHKFCKD 36 usage_00158.pdb 1 ----YPSIIITHNVSPDTLNREGCKEYDVAPQVGHRFCKD 36 usage_00217.pdb 1 ----YPSIIITHNVSPDTLNREGCEEYDVAPQVGHKFCKD 36 usage_00387.pdb 1 ---LYPSIIITHNVSPDTLNREGCKEYDVAPQVGHRFCKD 37 usage_00465.pdb 1 ---LYPSIIITHNVSPDTLNLEGCKNYDIAPQVGHKFCKD 37 usage_00466.pdb 1 ----YPSIIITHNVSPDTLNLEGCKNYDIAPQVGHKFCKD 36 usage_00473.pdb 1 ---LYPSIIITHNVSPDTLNLEGCKNYDIAPQVGHKFCKD 37 usage_00753.pdb 1 ----YPSIIITHNVSPDTLNREGCREYDVAPQVGHRFCKD 36 usage_00774.pdb 1 FRSLYPSIIITHNVSPDTLNREGCEEYDVAPQVGHKFCKD 40 YPSIIITHNVSPDTLN EGC YD AP VGH FCKD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################