################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:00:00 2021 # Report_file: c_1371_112.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00981.pdb # 2: usage_01263.pdb # 3: usage_01264.pdb # 4: usage_01265.pdb # 5: usage_01573.pdb # 6: usage_01574.pdb # 7: usage_01621.pdb # 8: usage_01831.pdb # # Length: 70 # Identity: 46/ 70 ( 65.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 70 ( 65.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 70 ( 1.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00981.pdb 1 DQEAAAVLMARIAVHKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLY 60 usage_01263.pdb 1 DQEAAAVLMARIAVHKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLY 60 usage_01264.pdb 1 DQEAAAVLMARIAVHKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLY 60 usage_01265.pdb 1 DQEAAAVLMARIAVHKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLY 60 usage_01573.pdb 1 DQEAAAILMARLAIYRAETEEGPDVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLY 60 usage_01574.pdb 1 -QEAAAILMARLAIYRAETEEGPDVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLY 59 usage_01621.pdb 1 DQEAAAVLMARIAVHKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLY 60 usage_01831.pdb 1 DQEAAAILMARLAIYRAETEEGPDVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLY 60 QEAAA LMAR A AET G DV RWLDR LI LCQK Y KDDP SFR FSLY usage_00981.pdb 61 PQFTYYLRRS 70 usage_01263.pdb 61 PQFTYYLRRS 70 usage_01264.pdb 61 PQFTYYLRRS 70 usage_01265.pdb 61 PQFTYYLRRS 70 usage_01573.pdb 61 PQFMFHLRRS 70 usage_01574.pdb 60 PQFMFHLRRS 69 usage_01621.pdb 61 PQFTYYLRRS 70 usage_01831.pdb 61 PQFMFHLRRS 70 PQF LRRS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################