################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:34 2021 # Report_file: c_1004_39.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00005.pdb # 2: usage_00006.pdb # 3: usage_00057.pdb # 4: usage_00125.pdb # 5: usage_00337.pdb # 6: usage_00338.pdb # 7: usage_00339.pdb # 8: usage_00340.pdb # # Length: 66 # Identity: 19/ 66 ( 28.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 66 ( 40.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 66 ( 28.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 GIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMT-----HEQLGISDALV 55 usage_00006.pdb 1 GIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMT-----REQLGISDALV 55 usage_00057.pdb 1 GIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMT-----EQLG-ISDALV 54 usage_00125.pdb 1 --LSFTLKND-SEAVAFVESLKLFILGESLGGVESLVGIPAFM-----------T--GLV 44 usage_00337.pdb 1 GMVSVRMRAGRTAAEQLCAKTNIFILAESLGSVESLIEHPSAMT-----GSQLEVPDDLV 55 usage_00338.pdb 1 GMVSVRMRAGRTAAEQLCAKTNIFILAESLGSVESLIEHPSAMTHASTAGSQLEVPDDLV 60 usage_00339.pdb 1 GMVSVRMRAGRTAAEQLCAKTNIFILAESLGSVESLIEHPSAMTH--TAGSQLEVPDDLV 58 usage_00340.pdb 1 GMVSVRMRAGRTAAEQLCAKTNIFILAESLGSVESLIEHPSAM-----------VPDDLV 49 vS g aA c kt F LaESLG VESL hP M LV usage_00005.pdb 56 RLSVGI 61 usage_00006.pdb 56 RLS--- 58 usage_00057.pdb 55 RLSVGI 60 usage_00125.pdb 45 RLS--- 47 usage_00337.pdb 56 RLS--- 58 usage_00338.pdb 61 RLS--- 63 usage_00339.pdb 59 RLS--- 61 usage_00340.pdb 50 RLS--- 52 RLS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################