################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:03 2021 # Report_file: c_1276_79.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00126.pdb # 2: usage_00158.pdb # 3: usage_00224.pdb # 4: usage_00225.pdb # 5: usage_00467.pdb # 6: usage_00865.pdb # 7: usage_00923.pdb # 8: usage_01034.pdb # 9: usage_01273.pdb # 10: usage_01333.pdb # 11: usage_01418.pdb # # Length: 42 # Identity: 23/ 42 ( 54.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 42 ( 61.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 42 ( 9.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00126.pdb 1 GVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLS- 41 usage_00158.pdb 1 GVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSH 42 usage_00224.pdb 1 GEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQL-- 40 usage_00225.pdb 1 GEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQL-- 40 usage_00467.pdb 1 GEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQL-- 40 usage_00865.pdb 1 GEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQL-- 40 usage_00923.pdb 1 GVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYES---- 38 usage_01034.pdb 1 GEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQL-- 40 usage_01273.pdb 1 GVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLS- 41 usage_01333.pdb 1 GEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQL-- 40 usage_01418.pdb 1 GEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQ--- 39 G VDiL CQLR DRGGMiQT EQYqF HH LY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################