################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:05:39 2021 # Report_file: c_0504_11.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00048.pdb # 2: usage_00073.pdb # 3: usage_00122.pdb # 4: usage_00124.pdb # # Length: 129 # Identity: 13/129 ( 10.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/129 ( 30.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/129 ( 18.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00048.pdb 1 -TSDLCHQVAKQLLEKSGKQASEIDFILVATVTPD---------FNMPSVACQVQGAIGA 50 usage_00073.pdb 1 TLADLAHQAGSRALDAAGVTPEEVDLVVLGTATPD---------RLMPTTATVVADRLGI 51 usage_00122.pdb 1 -LMQRLLPAVREALDEAAVKPEEIDLIVGLALS--PDHLIENRDIMAPKIGHPLQKVLGA 57 usage_00124.pdb 1 -LMQRLLPAVREALDEAAVKPEEIDLIVGLALS--PDHLIENRDIMAPKIGHPLQKVLGA 57 l a aLd a v peEiDliv P q lGa usage_00048.pdb 51 TEAFAFDISAACS-GFVYALSMAEKLVLSGRYQTGLVIGGETFSKMLDWTDRSTAVLFGD 109 usage_00073.pdb 52 DGVPAYQLQSGCS-GAVQALAVTRSLLLGGTARTALVLGGDVVARFY-----VNYVLFGD 105 usage_00122.pdb 58 NRAHVFDLTD---SSLARALYVVDTLASDQGYRNVLVVRGESSQGLE-VD-SESGFALAD 112 usage_00124.pdb 58 NRAHVFDLTD---SSLARALYVVDTLASDQGYRNVLVVRGESSQGLE-VD-SESGFALAD 112 a fdl AL v L yr LV Ge D usage_00048.pdb 110 GAAGVLIEA 118 usage_00073.pdb 106 GVGAAVLRV 114 usage_00122.pdb 113 GALALL--- 118 usage_00124.pdb 113 GALALL--- 118 Ga a l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################