################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:01 2021 # Report_file: c_1327_25.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00241.pdb # 2: usage_00284.pdb # 3: usage_00797.pdb # 4: usage_00885.pdb # 5: usage_00963.pdb # 6: usage_00987.pdb # 7: usage_01027.pdb # # Length: 64 # Identity: 34/ 64 ( 53.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 64 ( 53.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 30/ 64 ( 46.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00241.pdb 1 ----------------------LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 38 usage_00284.pdb 1 FWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 60 usage_00797.pdb 1 FWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 60 usage_00885.pdb 1 FWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 60 usage_00963.pdb 1 FWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 60 usage_00987.pdb 1 ----------------------LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQK 38 usage_01027.pdb 1 FWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRI---- 56 LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRI usage_00241.pdb 39 LQKY 42 usage_00284.pdb 61 LQKY 64 usage_00797.pdb 61 LQKY 64 usage_00885.pdb 61 LQK- 63 usage_00963.pdb 61 LQK- 63 usage_00987.pdb 39 LQK- 41 usage_01027.pdb ---- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################