################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:55:33 2021
# Report_file: c_1148_220.html
################################################################################################
#====================================
# Aligned_structures: 17
#   1: usage_00066.pdb
#   2: usage_00067.pdb
#   3: usage_01200.pdb
#   4: usage_01201.pdb
#   5: usage_01336.pdb
#   6: usage_01337.pdb
#   7: usage_01515.pdb
#   8: usage_01516.pdb
#   9: usage_01517.pdb
#  10: usage_01705.pdb
#  11: usage_02038.pdb
#  12: usage_02727.pdb
#  13: usage_02728.pdb
#  14: usage_03116.pdb
#  15: usage_03117.pdb
#  16: usage_03118.pdb
#  17: usage_03871.pdb
#
# Length:         30
# Identity:       10/ 30 ( 33.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     22/ 30 ( 73.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            0/ 30 (  0.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00066.pdb         1  QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE   30
usage_00067.pdb         1  QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE   30
usage_01200.pdb         1  QAYSLTFTEAGTYDYHCTFHPFMRGKVVVE   30
usage_01201.pdb         1  QAYSLTFTEAGTYDYHCTFHPFMRGKVVVE   30
usage_01336.pdb         1  QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE   30
usage_01337.pdb         1  QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE   30
usage_01515.pdb         1  QAYAITFNEAGSYDYFCTPHPFMRGKVIVE   30
usage_01516.pdb         1  QAYAITFNEAGSYDYFCTPHPFMRGKVIVE   30
usage_01517.pdb         1  QAYAITFNEAGSYDYFCTPHPFMRGKVIVE   30
usage_01705.pdb         1  QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE   30
usage_02038.pdb         1  QAYSLTFTEAGTYDYHCTPHPFMRGKVVVE   30
usage_02727.pdb         1  QAYAITFNEAGSYDYFCTPHPFMRGKVIVE   30
usage_02728.pdb         1  QAYAITFNEAGSYDYFCTPHPFMRGKVIVE   30
usage_03116.pdb         1  QAYSLTFTEAGTYDYHCTPHGFMRGKVVVE   30
usage_03117.pdb         1  QAYSLTFTEAGTYDYHCTPHGFMRGKVVVE   30
usage_03118.pdb         1  QAYSLTFTEAGTYDYHCTPHGFMRGKVVVE   30
usage_03871.pdb         1  DRFEHVFEEEGVYKYYCSFHPWRVGLVTVS   30
                           qay  tF EaG YdY Ct H fmrGkV Ve


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################