################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:12 2021 # Report_file: c_1156_23.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00255.pdb # 2: usage_00256.pdb # 3: usage_00416.pdb # 4: usage_00417.pdb # 5: usage_00418.pdb # 6: usage_00534.pdb # 7: usage_00705.pdb # 8: usage_00706.pdb # 9: usage_00794.pdb # 10: usage_00796.pdb # 11: usage_00797.pdb # 12: usage_01072.pdb # # Length: 30 # Identity: 8/ 30 ( 26.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 30 ( 30.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 30 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00255.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 usage_00256.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 usage_00416.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 usage_00417.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 usage_00418.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 usage_00534.pdb 1 QRTLKRIVQATGVGLHTGKKVTLTL----- 25 usage_00705.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 usage_00706.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 usage_00794.pdb 1 EKTVKEKLSFEGVGIHTGEYSKLII----- 25 usage_00796.pdb 1 EKTVKEKLSFEGVGIHTGEYSKLII----- 25 usage_00797.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 usage_01072.pdb 1 QRTLKNIIRATGVGLHSGEKVYLTLKPAPV 30 T K GVG H Ge L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################