################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:28:50 2021
# Report_file: c_1410_68.html
################################################################################################
#====================================
# Aligned_structures: 15
#   1: usage_00117.pdb
#   2: usage_00320.pdb
#   3: usage_00321.pdb
#   4: usage_00322.pdb
#   5: usage_00448.pdb
#   6: usage_00564.pdb
#   7: usage_00570.pdb
#   8: usage_00826.pdb
#   9: usage_01161.pdb
#  10: usage_01374.pdb
#  11: usage_01375.pdb
#  12: usage_01406.pdb
#  13: usage_01417.pdb
#  14: usage_01420.pdb
#  15: usage_01421.pdb
#
# Length:         32
# Identity:        9/ 32 ( 28.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     21/ 32 ( 65.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 32 (  6.2%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00117.pdb         1  SAPLALLHKILVENPSARITIPDIKKDRWYNK   32
usage_00320.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_00321.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_00322.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_00448.pdb         1  TDCENLLKKFLILNPSKRGTLEQIMKDRWMNV   32
usage_00564.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_00570.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_00826.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_01161.pdb         1  AEVKFLIHRILDPNPKTRIQIQGIKKDPWFRK   32
usage_01374.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_01375.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_01406.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_01417.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_01420.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
usage_01421.pdb         1  --PLALLHKILVENPSARITIPDIKKDRWYNK   30
                                LlhkiL  NPs Riti  IkKDrW nk


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################