################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:01 2021 # Report_file: c_1119_14.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00118.pdb # 2: usage_00119.pdb # 3: usage_00238.pdb # 4: usage_00239.pdb # 5: usage_00300.pdb # 6: usage_00316.pdb # 7: usage_00317.pdb # 8: usage_00346.pdb # # Length: 72 # Identity: 27/ 72 ( 37.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 72 ( 41.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 72 ( 19.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00118.pdb 1 -EQ-VMQIAQVLSGYTLGGADMLRRA--MGKKKPEEMAKQRSVFAEGAEKNGINAELAMK 56 usage_00119.pdb 1 QEQ-IMQIASQVAGYSLGEADLLRRA--MGKKRVEEMQKHRERFVRGAKERGVPEEEANR 57 usage_00238.pdb 1 -EQ-VMQIAQVLSGYTLGGADMLRRA--MGKKKPEEMAKQRSVFAEGAEKNGINAELAMK 56 usage_00239.pdb 1 -EQ-VMQIAQVLSGYTLGGADMLRRA--MGKKKPEEMAKQRSVFAEGAEKNGINAELAMK 56 usage_00300.pdb 1 -EQ-VMQIAQVLSGYTLGGADMLRRA--MGKKKPEEMAKQRSVFAEGAEKNGINAELAMK 56 usage_00316.pdb 1 QEQ-IMQIASQVAGYSLGEADLLRRA--MGKKRVEEMQKHRERFVRGAKERGVPEEEANR 57 usage_00317.pdb 1 -YQEQVQIAQVLSGYTLGGADL----RRAGKKKPEE-AKQRSVFAEGAEKNGINAELA-K 53 usage_00346.pdb 1 -EQ-VMQIAQVLSGYTLGGADMLRRA--MGKKKPEEMAKQRSVFAEGAEKNGINAELAMK 56 eQ mQIA GY LG AD mGKK EE K R F GA G E A usage_00118.pdb 57 IFDLVEKF---- 64 usage_00119.pdb 58 LFDMLEAFANYG 69 usage_00238.pdb 57 IFDLVEKF---- 64 usage_00239.pdb 57 IFDLVEKF---- 64 usage_00300.pdb 57 IFDLVEKFAGYG 68 usage_00316.pdb 58 LFDMLEAF---- 65 usage_00317.pdb 54 IFDLVEKFAG-- 63 usage_00346.pdb 57 IFDLVEKF---- 64 FD E F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################