################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:48 2021 # Report_file: c_1484_622.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_01489.pdb # 2: usage_01490.pdb # 3: usage_02597.pdb # 4: usage_03257.pdb # 5: usage_04180.pdb # # Length: 68 # Identity: 0/ 68 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 2/ 68 ( 2.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/ 68 ( 47.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01489.pdb 1 GGKLFKELEETKEQVIK-AKLVQEAIDKATEALNKQNVELAEEVI-KGDDTIDLLEVDIE 58 usage_01490.pdb 1 --KLFKELEETKEQVIK-AKLVQEAIDKATEALNKQNVELAEEVI-KGDDTIDLLEVDIE 56 usage_02597.pdb 1 --TFADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVI-DGDGSIDALEEEVN 57 usage_03257.pdb 1 -------PCIFKMMEKWKNQLFKYK-------------NIEKYN-CDIHKYIKESDKFIK 39 usage_04180.pdb 1 -EKLDNLMDLMGELVIARS-------RILETLKKYN---IKELDE-SLSHLSRITLDLQN 48 i i usage_01489.pdb 59 RRCIRIA- 65 usage_01490.pdb 57 RRCIRIA- 63 usage_02597.pdb 58 DFALWLIA 65 usage_03257.pdb 40 FMKVYSKS 47 usage_04180.pdb 49 VVMKIR-- 54 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################