################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:51:27 2021 # Report_file: c_0645_55.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00061.pdb # 2: usage_00165.pdb # 3: usage_00199.pdb # 4: usage_00200.pdb # 5: usage_00248.pdb # 6: usage_00249.pdb # 7: usage_00260.pdb # 8: usage_00401.pdb # 9: usage_00570.pdb # 10: usage_00571.pdb # 11: usage_00580.pdb # 12: usage_00581.pdb # 13: usage_00583.pdb # 14: usage_00599.pdb # 15: usage_00600.pdb # 16: usage_00980.pdb # 17: usage_00981.pdb # # Length: 56 # Identity: 11/ 56 ( 19.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 56 ( 28.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 56 ( 28.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00061.pdb 1 N-SAIQ-GSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKW-------------- 40 usage_00165.pdb 1 N-SAIQ-GSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQ------------- 41 usage_00199.pdb 1 N-SAIQ-GSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQ------------- 41 usage_00200.pdb 1 N-SAIQ-GSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQ------------- 41 usage_00248.pdb 1 N-SAIQ-GSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKW-------------- 40 usage_00249.pdb 1 N-SAIQ-GSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKW-------------- 40 usage_00260.pdb 1 NAVLTNGGRTLRAECRNADGNWVTSELDLDTIIGNNDGHFQWG------------- 43 usage_00401.pdb 1 N-SAIQ-GSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKW-------------- 40 usage_00570.pdb 1 D-ICLD-GARLRAECRRGDGGYSTSVIDLNRYLSNDNGHFRW-------------- 40 usage_00571.pdb 1 D-ICLD-GARLRAECRRGDGGYSTSVIDLNRYLSNDNGHFRW-------------- 40 usage_00580.pdb 1 N-SAIQ-GSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQL 54 usage_00581.pdb 1 N-SAIQ-GSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQP------------ 42 usage_00583.pdb 1 N-SAIQ-GSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQP------------ 42 usage_00599.pdb 1 N-SAIQ-GSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQ------------- 41 usage_00600.pdb 1 N-SAIQ-GSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQ------------- 41 usage_00980.pdb 1 N-SAIQ-GSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQ------------- 41 usage_00981.pdb 1 N-SAIQ-GSVLTSTCIRTNGGYNTSSIDLNSVIENVDGSLKWQ------------- 41 G L C r Ggy TS iDLn N G W #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################