################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:42 2021 # Report_file: c_1483_40.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00165.pdb # 2: usage_00197.pdb # 3: usage_00650.pdb # 4: usage_00651.pdb # 5: usage_00764.pdb # 6: usage_01184.pdb # 7: usage_01257.pdb # 8: usage_01365.pdb # 9: usage_01371.pdb # 10: usage_01377.pdb # 11: usage_01892.pdb # 12: usage_02625.pdb # # Length: 40 # Identity: 1/ 40 ( 2.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 40 ( 7.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 40 ( 35.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00165.pdb 1 -NEAIYDICRRNLDIERPTYTNLNRLIGQIVSSIT----- 34 usage_00197.pdb 1 -NEALFDLAHRKWNIESPTVDDLNLLITEALAGIT----- 34 usage_00650.pdb 1 -NEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRF 39 usage_00651.pdb 1 -NEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRF 39 usage_00764.pdb 1 -NEAIYDICRRNLDIERPTYTNLNRLISQIVSSIT----- 34 usage_01184.pdb 1 DNEAIYDICRRNLDIERPTYTNLNRLISQIVSSIT----- 35 usage_01257.pdb 1 DAYGRWLAKNKDVEEPSFAYDYVLSLD------------- 27 usage_01365.pdb 1 DNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVT----- 35 usage_01371.pdb 1 DNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVT----- 35 usage_01377.pdb 1 DNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVT----- 35 usage_01892.pdb 1 -NASLLNISGKVFRNPNIDLQHTNQLISTIISSVTN---- 35 usage_02625.pdb 1 -NEAIYDICRRNLDIERPTYTNLNRLISQIVSSIT----- 34 n n L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################