################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:29 2021 # Report_file: c_1124_49.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00220.pdb # 2: usage_00350.pdb # 3: usage_00351.pdb # 4: usage_00352.pdb # 5: usage_00353.pdb # 6: usage_00539.pdb # 7: usage_00540.pdb # # Length: 69 # Identity: 17/ 69 ( 24.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 69 ( 49.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 69 ( 23.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00220.pdb 1 --TEQILDAAAELLLAGD-ATFSVRKLAASLGTDSSSLYRHFRNKTELLRAVADRILLS- 56 usage_00350.pdb 1 NPREEILDASAELFTHQGFATTSTHQIADAVGIRQASLYYHFPSKTEIFLTLLKSTVEPS 60 usage_00351.pdb 1 --REEILDASAELFTHQGFATTSTHQIADAVGIRQASLYYHFPSKTEIFLTLLKST---- 54 usage_00352.pdb 1 -PREEILDASAELFTHQGFATTSTHQIADAVGIRQASLYYHFPSKTEIFLTLLKST---- 55 usage_00353.pdb 1 -PREEILDASAELFTHQGFATTSTHQIADAVGIRQASLYYHFPSKTEIFLTLLKSTVEPS 59 usage_00539.pdb 1 TAREEILDAAAELFTTHGYGSTSTRRIADEVGVRQASLYHHFATKDDILDALLAGTV--- 57 usage_00540.pdb 1 TAREEILDAAAELFTTHGYGSTSTRRIADEVGVRQASLYHHFATKDDILDALLAGTV--- 57 rEeILDA AELft g tSt iAd vG rqaSLY HF K i ll t usage_00220.pdb 57 -------AD 58 usage_00350.pdb 61 TVLAEDL-- 67 usage_00351.pdb --------- usage_00352.pdb --------- usage_00353.pdb 60 TVLAEDL-- 66 usage_00539.pdb --------- usage_00540.pdb --------- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################