################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:09:15 2021 # Report_file: c_0875_176.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00231.pdb # 2: usage_00431.pdb # 3: usage_00451.pdb # 4: usage_00452.pdb # # Length: 125 # Identity: 49/125 ( 39.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/125 ( 40.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/125 ( 16.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00231.pdb 1 FYDDLSWAAVWLYLATNDSTYLDKAESYVPNWGKEQQTDIIA---YKWGQCWDDVHYGAE 57 usage_00431.pdb 1 FYDDLSWAAVWLYLATNDSTYLDKAESYVPNWGKEQQTDIIA---Y-KWGQWDDVHYGAE 56 usage_00451.pdb 1 YRDELVWAAAWLYRATNDNTYLNTAESLYDEFG---------LQNWGGGLNWDSKVSGVQ 51 usage_00452.pdb 1 YRDELVWAAAWLYRATNDNTYLNTAESLYDEFG---------LQNWGGGLNWDSKVSGVQ 51 D L WAA WLY ATND TYL AES G g WD G usage_00231.pdb 58 LLLAKLTNKQLYKDSIEMNLDFWTTGVNGTRVSYTPKGLAWLFQWGSLRHATTQAFLAGV 117 usage_00431.pdb 57 LLLAKLTNKQLYKDSIEMNLDFWTTGVNGTRVSYTPKGLAWLFQWGSLRHATTQAFLAGV 116 usage_00451.pdb 52 VLLAKLTNKQAYKDTVQSYVNYLIN-----NQQKTPKGLLYIDMWGTLRHAANAAFIMLE 106 usage_00452.pdb 52 VLLAKLTNKQAYKDTVQSYVNYLIN-----NQQKTPKGLLYIDMWGTLRHAANAAFIMLE 106 LLAKLTNKQ YKD TPKGL WG LRHA AF usage_00231.pdb 118 YAEW- 121 usage_00431.pdb 117 YAEW- 120 usage_00451.pdb 107 AAELG 111 usage_00452.pdb 107 AAE-- 109 AE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################