################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:00 2021 # Report_file: c_1419_1.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00048.pdb # 2: usage_00049.pdb # 3: usage_00418.pdb # 4: usage_00480.pdb # 5: usage_00592.pdb # 6: usage_00593.pdb # 7: usage_00816.pdb # 8: usage_00880.pdb # # Length: 63 # Identity: 18/ 63 ( 28.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 63 ( 76.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 63 ( 23.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00048.pdb 1 PVRDAVVLNAAGAIVAHA---GLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFG 57 usage_00049.pdb 1 PVRDAVVLNAAGAIVAHA---GLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFG 57 usage_00418.pdb 1 PVRDAVVLNAAGAIVAHA---GLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFG 57 usage_00480.pdb 1 PLADAVALAAGAGFYAAGKTP----------SLKEGVALAREVLASGEAYLLLERYVAFL 50 usage_00592.pdb 1 PVRDAVVLNAAGAIVAHA---GLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFG 57 usage_00593.pdb 1 PVRDAVVLNAAGAIVAHA---GLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFG 57 usage_00816.pdb 1 PVRDAVVLNAAGAIVAHA---GLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFG 57 usage_00880.pdb 1 PVRDAVVLNAAGAIVAHA---GLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFG 57 PvrDAVvLnAagaivAha aweEGlrrAsaaidtGaAeqLLaRwVrFg usage_00048.pdb 58 RQ- 59 usage_00049.pdb 58 R-- 58 usage_00418.pdb 58 RQ- 59 usage_00480.pdb 51 RA- 52 usage_00592.pdb 58 RQ- 59 usage_00593.pdb 58 RQ- 59 usage_00816.pdb 58 RQI 60 usage_00880.pdb 58 R-- 58 R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################