################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:24 2021 # Report_file: c_0839_6.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00233.pdb # 2: usage_00234.pdb # 3: usage_00247.pdb # 4: usage_00248.pdb # 5: usage_00249.pdb # 6: usage_00250.pdb # 7: usage_00427.pdb # # Length: 97 # Identity: 75/ 97 ( 77.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 75/ 97 ( 77.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 97 ( 22.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00233.pdb 1 TGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMHVGLQARLMSQALRKMTGALN 60 usage_00234.pdb 1 TGEQALEIADMLIRSGALDIVVIDSVAALVPRAELE-G-HVGLQARLMSQALRKMTGALN 58 usage_00247.pdb 1 TGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGE-HVGLQARLMSQALRKMTGALN 59 usage_00248.pdb 1 TGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGESHVGLQARLMSQALRKMTGALN 60 usage_00249.pdb 1 TGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGE-HVGLQARLMSQALRKMTGALN 59 usage_00250.pdb 1 TGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGE-HVGLQARLMSQALRKMTGALN 59 usage_00427.pdb 1 TGEQALEIADMLIRSGALDIVVIDSVAALVPRAELE----VGLQARLMSQALRKMTGALN 56 TGEQALEIADMLIRSGALDIVVIDSVAALVPRAELE VGLQARLMSQALRKMTGALN usage_00233.pdb 61 NSGTTAIFINQLR-------------T-GGKALKFY- 82 usage_00234.pdb 59 NSGTTAIFINQLRDKIGVMFGSPETTT-GGKALKFY- 93 usage_00247.pdb 60 NSGTTAIFINQLR-------------T-GGKALKFY- 81 usage_00248.pdb 61 NSGTTAIFINQLR----------------GKALKFYA 81 usage_00249.pdb 60 NSGTTAIFINQLR-------------TTGGKALKFY- 82 usage_00250.pdb 60 NSGTTAIFINQL--------------T-GGKALKFY- 80 usage_00427.pdb 57 NSGTTAIFINQLT-------------T-GGKALKFYA 79 NSGTTAIFINQL GKALKFY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################