################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:00 2021 # Report_file: c_1021_72.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00043.pdb # 2: usage_00056.pdb # 3: usage_00086.pdb # 4: usage_00141.pdb # 5: usage_00142.pdb # 6: usage_00512.pdb # 7: usage_00658.pdb # # Length: 65 # Identity: 15/ 65 ( 23.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 65 ( 58.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 65 ( 16.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00043.pdb 1 -PKLFINAEPGALTTGRMRDFCRTW-PNQTEITV-AGAHFIQEDSPDEIGAAIAAFVRRL 57 usage_00056.pdb 1 -PKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL 59 usage_00086.pdb 1 MPKLFINAEPGAIITGRIRDYVRSW-PNQTEITV-PGVHFVQEDSPEEIGAAIAQFVRRL 58 usage_00141.pdb 1 -PKLFINAEPGALTTGRMRDFCRTW-PNQTEITV-AGAHFIQEDSPDEIGAAIAAFV--- 54 usage_00142.pdb 1 -PKLFINAEPGALTTGRMRDFCRTW-PNQTEITV-AGAHFIQEDSPDEIGAAIAAFV--- 54 usage_00512.pdb 1 -PKLFINADPGVLITGEVRDRVRSW-PNLTEVTV-AGLHFIQEDSPDEIGAAVRDWHASL 57 usage_00658.pdb 1 -PKLFINAEPGALTTGRMRDFCRTW-PNQTEITV-AGAHFIQEDSPDEIGAAIAAFV--- 54 PKLfina PG l tg rd r w PN te tv G Hf QEDsPdeIGaaia usage_00043.pdb ----- usage_00056.pdb 60 H---- 60 usage_00086.pdb 59 RSAAG 63 usage_00141.pdb ----- usage_00142.pdb ----- usage_00512.pdb ----- usage_00658.pdb ----- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################