################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:18:17 2021
# Report_file: c_1046_5.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00058.pdb
#   2: usage_00059.pdb
#   3: usage_00060.pdb
#   4: usage_00061.pdb
#   5: usage_00062.pdb
#   6: usage_00063.pdb
#   7: usage_00100.pdb
#   8: usage_00155.pdb
#   9: usage_00156.pdb
#  10: usage_00264.pdb
#
# Length:         31
# Identity:        4/ 31 ( 12.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     10/ 31 ( 32.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            1/ 31 (  3.2%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00058.pdb         1  DTVVLTGVWTNVCVRSTATDALANAYKVITL   31
usage_00059.pdb         1  DTVVLTGVWTNVCVRSTATDALANAYKVITL   31
usage_00060.pdb         1  DTVVLTGVWTNVCVRSTATDALANAYKVITL   31
usage_00061.pdb         1  DTVVLTGVWTNVCVRSTATDALANAYKVITL   31
usage_00062.pdb         1  DTVVLTGVWTNVCVRSTATDALANAYKVITL   31
usage_00063.pdb         1  DTVVLTGVWTNVCVRSTATDALANAYKVITL   31
usage_00100.pdb         1  DTLLVSGTQYPNCIRGTAVDAFALDYDVVVV   31
usage_00155.pdb         1  KRVYICGVATEYCVRATALDALKHGFEVYL-   30
usage_00156.pdb         1  KRVYICGVATEYCVRATALDALKHGFEVYL-   30
usage_00264.pdb         1  DTIVLGGFLTNCCVESTMRTGYERGFRVITL   31
                                 G  t  Cvr Ta da      V   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################