################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:17 2021 # Report_file: c_1413_25.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00368.pdb # 2: usage_00378.pdb # 3: usage_00801.pdb # 4: usage_00902.pdb # 5: usage_01170.pdb # 6: usage_01422.pdb # 7: usage_01423.pdb # 8: usage_01494.pdb # # Length: 84 # Identity: 16/ 84 ( 19.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 84 ( 39.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 84 ( 23.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00368.pdb 1 -DTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQ--PYMFPRMLM 57 usage_00378.pdb 1 --TEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHV--THFWPKLLM 56 usage_00801.pdb 1 ---ETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRP-----HMFPKILM 52 usage_00902.pdb 1 -NAEYALLTAIVIFSE-RPSLIEGWKVEKIQEIYLEALKVYVDNRRK-PRSGTIFAKLLS 57 usage_01170.pdb 1 DDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRP----PHMFPKILM 56 usage_01422.pdb 1 -DTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSK--PHMFPKILM 57 usage_01423.pdb 1 -DTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSK--PHMFPKILM 57 usage_01494.pdb 1 DDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSK--PHMFPKILM 58 E LL Ai l R L e kv K Qe LeAl Y Rr fpk Lm usage_00368.pdb 58 KITDLRGISTKGAERAITLKMEI- 80 usage_00378.pdb 57 KVTDLRMIGACHASRFLHMKVE-- 78 usage_00801.pdb 53 KITDLRSISAKGAERVITLKME-- 74 usage_00902.pdb 58 VLTELRTLGNLNSEMCFSLKLKNK 81 usage_01170.pdb 57 KITDLRSISAKGA----------- 69 usage_01422.pdb 58 KITDLRSISAKGAERVITLKMEI- 80 usage_01423.pdb 58 KITDLRSISAKGAERVITLKMEI- 80 usage_01494.pdb 59 KITDLRSISAKGAERVITLKME-- 80 k TdLR i a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################