################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:38:20 2021 # Report_file: c_1413_5.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00401.pdb # 2: usage_00900.pdb # 3: usage_00901.pdb # 4: usage_01067.pdb # 5: usage_01068.pdb # 6: usage_01433.pdb # 7: usage_01434.pdb # # Length: 98 # Identity: 65/ 98 ( 66.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 65/ 98 ( 66.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 33/ 98 ( 33.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00401.pdb 1 --RAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP-QLLLP-----ALRPF 52 usage_00900.pdb 1 NARAFRDLYSELRLYYRGANLHL------FWARLLERL---------------------- 32 usage_00901.pdb 1 --RAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPE----------ALRPF 48 usage_01067.pdb 1 --RAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLH-L-----GKQAEALRPF 52 usage_01068.pdb 1 --RAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP-QLL-------ALRPF 50 usage_01433.pdb 1 NARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERL---------------------F 39 usage_01434.pdb 1 ---AFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPE----------ALRPF 47 AFRDLYSELRLYYRGANLHL FWARLLERL usage_00401.pdb 53 GEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV 90 usage_00900.pdb 33 --APRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV 68 usage_00901.pdb 49 GEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV 86 usage_01067.pdb 53 GEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV 90 usage_01068.pdb 51 GEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV 88 usage_01433.pdb 40 GEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV 77 usage_01434.pdb 48 GEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV 85 APRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################