################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:33:43 2021 # Report_file: c_1083_4.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00407.pdb # 2: usage_00738.pdb # 3: usage_00739.pdb # 4: usage_00784.pdb # 5: usage_00785.pdb # 6: usage_00786.pdb # 7: usage_00787.pdb # 8: usage_00788.pdb # 9: usage_00789.pdb # 10: usage_00790.pdb # 11: usage_00791.pdb # # Length: 40 # Identity: 0/ 40 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 40 ( 12.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 40 ( 20.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00407.pdb 1 ----AETLVATGKADFGISYQEQVTYAKTSEDPLPIKA-- 34 usage_00738.pdb 1 -ADEMKGYMIQNNVAIGVTFSGEASQMLEKNE--NLRYVV 37 usage_00739.pdb 1 ----MKGYMIQNNVAIGVTFSGEASQMLEKNE--NLRYVV 34 usage_00784.pdb 1 SGAQAAQLIKDGEVDMIITWGGRVQGAINDGA--NFAYTF 38 usage_00785.pdb 1 SGAQAAQLIKDGEVDMIITWGGRVQGAINDGA--NFAYTF 38 usage_00786.pdb 1 SGAQAAQLIKDGEVDMIITWGGRVQGAINDGA--NFAYTF 38 usage_00787.pdb 1 SGAQAAQLIKDGEVDMIITWGGRVQGAINDGA--NFAYTF 38 usage_00788.pdb 1 SGAQAAQLIKDGEVDMIITWGGRVQGAINDGA--NFAYTF 38 usage_00789.pdb 1 SGAQAAQLIKDGEVDMIITWGGRVQGAINDGA--NFAYTF 38 usage_00790.pdb 1 SGAQAAQLIKDGEVDMIITWGGRVQGAINDGA--NFAYTF 38 usage_00791.pdb 1 SGAQAAQLIKDGEVDMIITWGGRVQGAINDGA--NFAYTF 38 v t g n y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################