################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:51:28 2021 # Report_file: c_0787_83.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00479.pdb # 2: usage_00543.pdb # 3: usage_00548.pdb # 4: usage_00552.pdb # 5: usage_00645.pdb # 6: usage_00646.pdb # 7: usage_00648.pdb # 8: usage_00660.pdb # 9: usage_00663.pdb # 10: usage_00701.pdb # 11: usage_00702.pdb # 12: usage_01157.pdb # # Length: 56 # Identity: 53/ 56 ( 94.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 53/ 56 ( 94.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 56 ( 5.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00479.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00543.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00548.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00552.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00645.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00646.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00648.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00660.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00663.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 usage_00701.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALA--- 53 usage_00702.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALA--- 53 usage_01157.pdb 1 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALAHST 56 FTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQTIVEQVKEKTNHIQALA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################