################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:41 2021 # Report_file: c_1437_74.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00353.pdb # 2: usage_00354.pdb # 3: usage_00355.pdb # 4: usage_00356.pdb # 5: usage_00358.pdb # 6: usage_00359.pdb # 7: usage_00853.pdb # # Length: 64 # Identity: 36/ 64 ( 56.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 44/ 64 ( 68.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 64 ( 31.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00353.pdb 1 --------------RRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLS 46 usage_00354.pdb 1 --------------RRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLS 46 usage_00355.pdb 1 ---------------RSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLS 45 usage_00356.pdb 1 ----KEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLS 56 usage_00358.pdb 1 --------------RRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLS 46 usage_00359.pdb 1 --------------RRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLS 46 usage_00853.pdb 1 SERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLL- 59 RSKEtEVFYELAHeLPLPHsVSSHLDKASiMRLaISfLRthKLL usage_00353.pdb 47 SVC- 49 usage_00354.pdb 47 SV-- 48 usage_00355.pdb 46 SVC- 48 usage_00356.pdb 57 SV-- 58 usage_00358.pdb 47 SVCS 50 usage_00359.pdb 47 SVC- 49 usage_00853.pdb ---- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################