################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:30 2021 # Report_file: c_0398_138.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00311.pdb # 2: usage_00312.pdb # 3: usage_00332.pdb # 4: usage_00489.pdb # 5: usage_00490.pdb # 6: usage_00497.pdb # 7: usage_00498.pdb # # Length: 82 # Identity: 10/ 82 ( 12.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 82 ( 37.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 82 ( 18.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00311.pdb 1 DIYNPQAGSVTTA-T-SLDFPALSW-LRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGR 57 usage_00312.pdb 1 DIYNPQAGSVTTA-T-SLDFPALSW-LRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGR 57 usage_00332.pdb 1 -LFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHA-DADFLLFVLSGR 58 usage_00489.pdb 1 DVYKPQLGYISTL-N-SYDLPILRF-LRLSALRGSIRQNAMVLPQWNANANAVLYVTDGE 57 usage_00490.pdb 1 DVYKPQLGYISTL-N-SYDLPILRF-LRLSALRGSIRQNAMVLPQWNANANAVLYVTDGE 57 usage_00497.pdb 1 DIYNPEAGRIKTV-T-SLDLPVLRW-LKLSAEHGSLHKNAMFVPHYNLNANSIIYALKGR 57 usage_00498.pdb 1 DIYNPEAGRIKTV-T-SLDLPVLRW-LKLSAEHGSLHKNAMFVPHYNLNANSIIYALKGR 57 y p G t s d P L l lsa gs Nam P n nAn y G usage_00311.pdb 58 ALIQVVNCNGER------VFDG 73 usage_00312.pdb 58 ALIQVVNCNGER------VFDG 73 usage_00332.pdb 59 AILTLVNNDDRDSYNLHP---- 76 usage_00489.pdb 58 AHVQVVNDNGDR------VFDG 73 usage_00490.pdb 58 AHVQVVNDNGDR------VFDG 73 usage_00497.pdb 58 ARLQVVNCNGNT------VFDG 73 usage_00498.pdb 58 ARLQVVNCNGNT------VFDG 73 A qvVN ng #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################