################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:24:05 2021 # Report_file: c_1003_9.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00012.pdb # 2: usage_00188.pdb # 3: usage_00189.pdb # 4: usage_00190.pdb # 5: usage_00356.pdb # 6: usage_00357.pdb # # Length: 63 # Identity: 21/ 63 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 63 ( 73.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 63 ( 23.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 LWSLVPGVDTVAAEPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALS-- 58 usage_00188.pdb 1 LWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEK----- 55 usage_00189.pdb 1 LWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAG- 59 usage_00190.pdb 1 LWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTF------- 53 usage_00356.pdb 1 LWSCIPGEDTIMNVPGFFLVRRENR-G----SSYWDRCVVGGYLSPKTVADTFEKVVAGS 55 usage_00357.pdb 1 LWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGS 60 LWSciPGeDTimnvPgfflVRRen sSyWDRcvVGGYLSpktvadtf usage_00012.pdb --- usage_00188.pdb --- usage_00189.pdb --- usage_00190.pdb --- usage_00356.pdb 56 INW 58 usage_00357.pdb 61 I-- 61 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################