################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:15 2021 # Report_file: c_1178_16.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00070.pdb # 2: usage_00089.pdb # 3: usage_00094.pdb # 4: usage_00096.pdb # 5: usage_00097.pdb # 6: usage_00098.pdb # 7: usage_00142.pdb # 8: usage_00143.pdb # 9: usage_00145.pdb # 10: usage_00147.pdb # 11: usage_00148.pdb # 12: usage_00187.pdb # # Length: 36 # Identity: 0/ 36 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 36 ( 41.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 36 ( 36.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00070.pdb 1 -ERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHV-- 33 usage_00089.pdb 1 -ERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHV-- 33 usage_00094.pdb 1 L-----INDPP--AWNTFNLVLR-DESVLEFV---- 24 usage_00096.pdb 1 ------QKYCLMGVQDSYTDFHIDFGGTSVWYHV-- 28 usage_00097.pdb 1 ------QKYCLMGVQDSYTDFHIDFGGTSVWYHV-- 28 usage_00098.pdb 1 -PKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLW 35 usage_00142.pdb 1 ------QKYCLMSVRGCYTDFHVDFGGTSVWYHI-- 28 usage_00143.pdb 1 ------QKYCLMSVRGCYTDFHVDFGGTSVWYHI-- 28 usage_00145.pdb 1 -ERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHV-- 33 usage_00147.pdb 1 ------TKYCLICVKDSYTDFHIDSGGASAWYHV-- 28 usage_00148.pdb 1 ------TKYCLICVKDSYTDFHIDSGGASAWYHVLK 30 usage_00187.pdb 1 ------TKYCLICVKDSYTDFHIDSGGASAWYHV-- 28 kycl v ytdfh gg s wy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################