################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:30:47 2021 # Report_file: c_1104_43.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00137.pdb # 2: usage_00138.pdb # 3: usage_00139.pdb # 4: usage_00529.pdb # 5: usage_00703.pdb # 6: usage_00869.pdb # # Length: 78 # Identity: 11/ 78 ( 14.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 78 ( 61.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 78 ( 20.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00137.pdb 1 MFDKITSRIQKLCYGLNMDFVDPAQITMKVI-QGLYSGVTTVELDTLAAETAATLTTKHP 59 usage_00138.pdb 1 --DKITSRIQKLCYGLNMDFVDPAQITMKVI-QGLYSGVTTVELDTLAAETAATLTTKHP 57 usage_00139.pdb 1 --DKITSRIQKLCYGLNMDFVDPAQITMKVI-QGLYSGVTTVELDTLAAETAATLTTKHP 57 usage_00529.pdb 1 -----TARISRLCYGLDPKHIDAVKVTQRIIS-------TTIELDNLAAETCAYMTTVHP 48 usage_00703.pdb 1 -MGRLNTIISEACEGLA--EVDGALIERETL-KNLYDGVAEKDVNTALVMTARTLVEREP 56 usage_00869.pdb 1 MFDKITSRIQKLCYGLNMDFVDPAQITMKVI-QGLYSGVTTVELDTLAAETAATLTTKHP 59 t rI lCyGL vD a it i tt eldtlaaeTaatltt hP usage_00137.pdb 60 DYAILAARIAVSNLHKE- 76 usage_00138.pdb 58 DYAILAARIAVSNLHKET 75 usage_00139.pdb 58 DYAILAARIAVSNLHKET 75 usage_00529.pdb 49 DYATLAARIAISNLHKQ- 65 usage_00703.pdb 57 NYSYVTARLLMDTLRAE- 73 usage_00869.pdb 60 DYAILAARIAVSNLHKE- 76 dYa laARia snLhke #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################