################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:41:06 2021
# Report_file: c_1142_163.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00074.pdb
#   2: usage_00076.pdb
#   3: usage_00286.pdb
#   4: usage_00287.pdb
#   5: usage_00288.pdb
#   6: usage_00537.pdb
#   7: usage_00921.pdb
#   8: usage_00922.pdb
#   9: usage_00923.pdb
#  10: usage_00924.pdb
#  11: usage_00925.pdb
#
# Length:         31
# Identity:        9/ 31 ( 29.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      9/ 31 ( 29.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 31 ( 12.9%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00074.pdb         1  -L-AARPVEAIPGMLEFDIPVHGDNRGWFKE   29
usage_00076.pdb         1  -L-AARPVEAIPGMLEFDIPVHGDNRGWFKE   29
usage_00286.pdb         1  ---MIVIKTAIPDVLILEPKVFGDERGFFFE   28
usage_00287.pdb         1  ---MIVIKTAIPDVLILEPKVFGDERGFFFE   28
usage_00288.pdb         1  --MMIVIKTAIPDVLILEPKVFGDERGFFFE   29
usage_00537.pdb         1  ---MKATRLAIPDVILFEPRVFGDDRGFFF-   27
usage_00921.pdb         1  ---MKATRLAIPDVILFEPRVFGDDRGFFFE   28
usage_00922.pdb         1  SMSMKATRLAIPDVILFEPRVFGDDRGFFFE   31
usage_00923.pdb         1  ---MKATRLAIPDVILFEPRVFGDDRGFFF-   27
usage_00924.pdb         1  ---MKATRLAIPDVILFEPRVFGDDRGFFFE   28
usage_00925.pdb         1  ---MKATRLAIPDVILFEPRVFGDDRGFFFE   28
                                    AIP        V GD RG F  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################