################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:20 2021 # Report_file: c_0732_30.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00053.pdb # 2: usage_00054.pdb # 3: usage_00322.pdb # 4: usage_00323.pdb # 5: usage_00355.pdb # 6: usage_00383.pdb # 7: usage_00413.pdb # 8: usage_00441.pdb # 9: usage_00442.pdb # # Length: 45 # Identity: 8/ 45 ( 17.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 45 ( 55.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 45 ( 6.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00053.pdb 1 KYQLSIHKNPNTAE--PRHLLVMKGAPERILDRCSSILIHGKEQP 43 usage_00054.pdb 1 KYQLSIHKNPNTAE--PRHLLVMKGAPERILDRCSSILIHGKEQP 43 usage_00322.pdb 1 KYQLSIHKNPNTAE--PRHLLVMKGAPERILDRCSSILIHGKEQP 43 usage_00323.pdb 1 -YQLSIHKNPNTAE--PRHLLVMKGAPERILDRCSSILIHGKEQP 42 usage_00355.pdb 1 -YQLSIHENEKSSE--SRYLLVMKGAPERILDRCSTILLNGAEEP 42 usage_00383.pdb 1 -SMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVP 44 usage_00413.pdb 1 -FQLSIHTLEDPRD--PRHVLVMKGAPERVLERCSSILIKGQELP 42 usage_00441.pdb 1 -YQLSIHKNPNTAE--PRHLLVMKGAPERILDRCSSILIHGKEQP 42 usage_00442.pdb 1 -YQLSIHKNPNTAE--PRHLLVMKGAPERILDRCSSILIHGKEQP 42 qlsih r lvmKGAPEr ldRCs il g e P #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################