################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:05 2021 # Report_file: c_1334_35.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00157.pdb # 2: usage_00286.pdb # 3: usage_00308.pdb # 4: usage_00551.pdb # 5: usage_00552.pdb # 6: usage_00553.pdb # 7: usage_00580.pdb # 8: usage_00590.pdb # 9: usage_00750.pdb # 10: usage_00751.pdb # 11: usage_00792.pdb # 12: usage_00793.pdb # 13: usage_00804.pdb # # Length: 45 # Identity: 9/ 45 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 45 ( 40.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 45 ( 46.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00157.pdb 1 PTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNS 45 usage_00286.pdb 1 NTLLFHSITSNIICSIVFGKRFDYKD------------------- 26 usage_00308.pdb 1 PTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFSLISS 45 usage_00551.pdb 1 -TFLFQCITANIICSIVFGERYDYKDRQFLRLLDLFYRTFSLMSS 44 usage_00552.pdb 1 -TFLFQCITANIICSIVFGERYDYKDRQFLRLLDLFYRTFSLMSS 44 usage_00553.pdb 1 PTFLFQCITANIICSIVFGERYDYKDRQFLRLLDLFYRTFSLMSS 45 usage_00580.pdb 1 NTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISS 45 usage_00590.pdb 1 NTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISS 45 usage_00750.pdb 1 --LLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISS 43 usage_00751.pdb 1 --LLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLF--------- 34 usage_00792.pdb 1 NTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQ------- 38 usage_00793.pdb 1 NTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLF--------- 36 usage_00804.pdb 1 -TLLFHSITSNIICSIVFGKRFDYKD------------------- 25 lf it NiICSiVFg R dYkD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################