################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:18:01 2021 # Report_file: c_1459_42.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00080.pdb # 2: usage_00257.pdb # 3: usage_00572.pdb # 4: usage_00610.pdb # 5: usage_00611.pdb # 6: usage_00612.pdb # 7: usage_00613.pdb # 8: usage_00614.pdb # 9: usage_00910.pdb # 10: usage_01514.pdb # 11: usage_02108.pdb # 12: usage_02521.pdb # 13: usage_02522.pdb # 14: usage_02732.pdb # # Length: 32 # Identity: 12/ 32 ( 37.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 32 ( 53.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 32 ( 12.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00080.pdb 1 -IYAIGDVTNRVMLTPVAINEAAALVDTV--- 28 usage_00257.pdb 1 -IYAIGDVTNRVMLTPVAINEAAALVDTV--- 28 usage_00572.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_00610.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_00611.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_00612.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_00613.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_00614.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_00910.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_01514.pdb 1 NIYAIGDVTNRVMLTPVAINEGAAFVETVFGG 32 usage_02108.pdb 1 GIYALGDVTDRVQLTPVAIHEACFIETEYKN- 31 usage_02521.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_02522.pdb 1 NIYAIGDVTDRVMLTPVAINEGAAFVDTVFAN 32 usage_02732.pdb 1 HIWAVGDVTGHIQLTPVAIHDAMCFVKNAFE- 31 IyA GDVT rv LTPVAI e v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################