################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:01:56 2021 # Report_file: c_0730_22.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00087.pdb # 2: usage_00120.pdb # 3: usage_00121.pdb # 4: usage_00122.pdb # 5: usage_00123.pdb # 6: usage_00124.pdb # 7: usage_00125.pdb # 8: usage_00126.pdb # 9: usage_00127.pdb # 10: usage_00247.pdb # 11: usage_00281.pdb # 12: usage_00282.pdb # 13: usage_00372.pdb # # Length: 42 # Identity: 3/ 42 ( 7.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 42 ( 11.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 42 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00087.pdb 1 -MALIVDPMLATGGSVIATIDLLKKAGCSSIKVLVLVAA--- 38 usage_00120.pdb 1 -DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLI- 40 usage_00121.pdb 1 -DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLI- 40 usage_00122.pdb 1 -DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLI- 40 usage_00123.pdb 1 -DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLI- 40 usage_00124.pdb 1 -DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLI- 40 usage_00125.pdb 1 -DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLI- 40 usage_00126.pdb 1 -DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLI- 40 usage_00127.pdb 1 -DVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLI- 40 usage_00247.pdb 1 --VMVLDPMVATGGSMTHTLGLLISRGAADITVLCVVAA--- 37 usage_00281.pdb 1 -TCVIMDDMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLS- 40 usage_00282.pdb 1 --CVIMDDMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSG 40 usage_00372.pdb 1 DVVLVDD-GVATGAS-EAALSVVFQEGPRRVVVAVPVAS--- 37 D T g l G #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################