################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:54:41 2021 # Report_file: c_1305_61.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00007.pdb # 2: usage_00033.pdb # 3: usage_00070.pdb # 4: usage_00089.pdb # 5: usage_00091.pdb # 6: usage_00185.pdb # 7: usage_00186.pdb # 8: usage_00187.pdb # 9: usage_00268.pdb # 10: usage_00272.pdb # 11: usage_00643.pdb # 12: usage_00794.pdb # 13: usage_00973.pdb # 14: usage_00974.pdb # 15: usage_01178.pdb # 16: usage_01198.pdb # 17: usage_01378.pdb # # Length: 31 # Identity: 20/ 31 ( 64.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 31 ( 64.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 31 ( 29.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00007.pdb 1 -PYFTWPLIAADGGYAFKYENGKYDIK---- 26 usage_00033.pdb 1 EPYFTWPLIAADGGYAFKYENGKYDIK---- 27 usage_00070.pdb 1 -PYFTWPLIAADGGYAFKYAAGKYDIK---- 26 usage_00089.pdb 1 EPYFTWPLIAADGGYAFKYENGKYDIK---- 27 usage_00091.pdb 1 -PYFTWPLIAADGGYAFKYAAGKYDIK---- 26 usage_00185.pdb 1 -PYFTWPLIAADGGYAFKYAAGKYDIK---- 26 usage_00186.pdb 1 EPYFTWPLIAADGGYAFKYAAGKYDIK---- 27 usage_00187.pdb 1 -PYFTWPLIAADGGYAFKYAAGKYDIK---- 26 usage_00268.pdb 1 EPYFTWPLIAADGGYAFKYENGKYDIK---- 27 usage_00272.pdb 1 -PYFTWPLIAADGGYAFKYAAGKYDIKDVGV 30 usage_00643.pdb 1 EPYFTWPLIAADGGYAFKYENGKYDIKDVGV 31 usage_00794.pdb 1 EPYFTWPLIAADGGYAFKYENGKYDIK---- 27 usage_00973.pdb 1 -PYFTWPLIAADGGYAFKYENGKYDIK---- 26 usage_00974.pdb 1 -PYFTWPLIAADGGYAFKYENGKYDIK---- 26 usage_01178.pdb 1 -PYFTWPLIAADGGYAFKYENGKYDIK---- 26 usage_01198.pdb 1 EPYFTWPLIAADGGYAFKYENGKYDIK---- 27 usage_01378.pdb 1 -----WPLIAADGGYAFKYENGKYDIK---- 22 WPLIAADGGYAFKY GKYDIK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################