################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:30 2021 # Report_file: c_1394_60.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00339.pdb # 2: usage_00340.pdb # 3: usage_00385.pdb # 4: usage_00601.pdb # 5: usage_00602.pdb # 6: usage_00985.pdb # 7: usage_01023.pdb # # Length: 73 # Identity: 21/ 73 ( 28.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 73 ( 34.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 73 ( 6.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00339.pdb 1 TLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLC 60 usage_00340.pdb 1 TLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLC 60 usage_00385.pdb 1 TVTNYFITSLACADLVMGLAVVPFGAAHILTKTWTFGNFWCEFWTSIDVLCVTASIETLC 60 usage_00601.pdb 1 TLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLC 60 usage_00602.pdb 1 TLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWGSFLCELWTSLDVLCVTASIETLC 60 usage_00985.pdb 1 NVTNYFVVSAAAADILVGVLAIPFAIAISTG-F-CAACHGCLFIACFVLVLTASSIFSLL 58 usage_01023.pdb 1 NVTNYFVVSLAAADIAVGVLAIPFAITISTG-F-CAACHGCLFIACFVLVLTQSSIFSLL 58 TN F SlA AD vG l PF C SI L usage_00339.pdb 61 VIAIDRYLAITSP 73 usage_00340.pdb 61 VIAIDRYLAITSP 73 usage_00385.pdb 61 VIAVDRYFAITSP 73 usage_00601.pdb 61 VIAIDRYLAI--- 70 usage_00602.pdb 61 VIAIDRYLAI--- 70 usage_00985.pdb 59 AIAIDRYIAIRIP 71 usage_01023.pdb 59 AIAIDRYIAIRI- 70 IAiDRY AI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################