################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:13:05 2021
# Report_file: c_1171_152.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00082.pdb
#   2: usage_00341.pdb
#   3: usage_00935.pdb
#   4: usage_01246.pdb
#   5: usage_01248.pdb
#   6: usage_01249.pdb
#   7: usage_01257.pdb
#   8: usage_01258.pdb
#   9: usage_01546.pdb
#  10: usage_01547.pdb
#  11: usage_01548.pdb
#  12: usage_01861.pdb
#  13: usage_01956.pdb
#
# Length:         34
# Identity:        0/ 34 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      2/ 34 (  5.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           15/ 34 ( 44.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00082.pdb         1  ---------AYQVMATEGYQ-S--SGSSNVTVW-   21
usage_00341.pdb         1  VSFLIPREDYRIDDVWNVVG-LRGTGSNTVVVED   33
usage_00935.pdb         1  ---------NLHLEEAYREGDN--TYYRVNE---   20
usage_01246.pdb         1  ---------DYQIMATKGWQ-S--SGSSTVSISE   22
usage_01248.pdb         1  ---------YYMIMATEGYQ-S--SGSSSINVGG   22
usage_01249.pdb         1  ---------YYMIMATEGYQ-S--SGSSSINVGG   22
usage_01257.pdb         1  ---------DYQIMATEGYQ-S--SGSSTVSISE   22
usage_01258.pdb         1  ---------DYQIMATEGYQ-S--SGSSTVSISE   22
usage_01546.pdb         1  ---------NYMIVSTEGYE-S--SGSSTITVS-   21
usage_01547.pdb         1  ---------NYMIVSTEGYE-S--SGSSTIT---   19
usage_01548.pdb         1  ---------NYMIVSTEGYE-S--SGSSTITVS-   21
usage_01861.pdb         1  ---------AYQVMATEGYQ-S--SGSSNVTVW-   21
usage_01956.pdb         1  ---------AYQVMATEGYQ-S--SGSSNVTVW-   21
                                                    gs       


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################