################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:18:03 2021 # Report_file: c_1387_77.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00442.pdb # 2: usage_00443.pdb # 3: usage_01428.pdb # 4: usage_01429.pdb # 5: usage_01430.pdb # 6: usage_01466.pdb # 7: usage_01467.pdb # 8: usage_01781.pdb # 9: usage_01789.pdb # 10: usage_01790.pdb # 11: usage_01804.pdb # 12: usage_01805.pdb # 13: usage_02049.pdb # 14: usage_02277.pdb # 15: usage_02278.pdb # 16: usage_02279.pdb # 17: usage_02314.pdb # 18: usage_02548.pdb # # Length: 44 # Identity: 34/ 44 ( 77.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 44 ( 77.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 44 ( 22.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00442.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_00443.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_01428.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNH----- 39 usage_01429.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_01430.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNH----- 39 usage_01466.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_01467.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_01781.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_01789.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_01790.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_01804.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_01805.pdb 1 -----LKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 39 usage_02049.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_02277.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_02278.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_02279.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_02314.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 usage_02548.pdb 1 KVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWS 44 LKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################