################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:14 2021 # Report_file: c_0739_2.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00031.pdb # 2: usage_00044.pdb # 3: usage_00068.pdb # 4: usage_00218.pdb # 5: usage_00219.pdb # 6: usage_00225.pdb # 7: usage_00226.pdb # # Length: 84 # Identity: 10/ 84 ( 11.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 84 ( 35.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 84 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00031.pdb 1 -EVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYH-KS-LYRLSTSFPRRALE--- 54 usage_00044.pdb 1 -TIARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNT-YGNFSLATMFPRREFTRE- 57 usage_00068.pdb 1 EPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFP-WD-EYKLLSTFPRRDVT--Q 56 usage_00218.pdb 1 -PVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFP-WD-EYKLLSTFPRRDVT--Q 55 usage_00219.pdb 1 -PVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFP-WD-EYKLLSTFPRRDVT--Q 55 usage_00225.pdb 1 -PVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFP-WD-EYKLLSTFPRRDVT--Q 55 usage_00226.pdb 1 -PVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFP-WD-EYKLLSTFPRRDVT--Q 55 v R P G l rrF s lq df a g y L FPRR t usage_00031.pdb 55 VEGGSSLEDIGITVDTVLNV---- 74 usage_00044.pdb 58 -DYKRRLLDLELAPSASVVLLPAG 80 usage_00068.pdb 57 LDPNKSLLEVKLFPQETLFL---- 76 usage_00218.pdb 56 LDPNKSLLEVKLFPQETLFLEA-- 77 usage_00219.pdb 56 LDPNKSLLEVKLFPQETLFLEA-- 77 usage_00225.pdb 56 LDPNKSLLEVKLFPQETLFLEA-- 77 usage_00226.pdb 56 LDPNKSLLEVKLFPQETLFLEA-- 77 d sLl l p l l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################