################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:18:49 2021 # Report_file: c_1380_77.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00270.pdb # 2: usage_01316.pdb # 3: usage_01318.pdb # 4: usage_01340.pdb # 5: usage_02281.pdb # # Length: 89 # Identity: 62/ 89 ( 69.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 62/ 89 ( 69.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/ 89 ( 30.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00270.pdb 1 -IHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKR--IS 57 usage_01316.pdb 1 -IHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAA---------------------WE-- 36 usage_01318.pdb 1 PIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAA---------------------WEIS 39 usage_01340.pdb 1 PIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAA----------------W-IKR--IS 41 usage_02281.pdb 1 -IHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAA---------------------WE-- 36 IHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAA usage_00270.pdb 58 TKEWAKSTGYDPVKLFTKLFKDDIRYLL- 85 usage_01316.pdb 37 TKEWAKSTGYDPVKLFTKLFKDDIRYLLT 65 usage_01318.pdb 40 TKEWAKSTGYDPVKLFTKLFKDDIRYLL- 67 usage_01340.pdb 42 TKEWAKSTGYDPVKLFTKLFKDDIRYLL- 69 usage_02281.pdb 37 TKEWAKSTGYDPVKLFTKLFKDDIRYLLT 65 TKEWAKSTGYDPVKLFTKLFKDDIRYLL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################