################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:20 2021 # Report_file: c_1380_116.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00009.pdb # 2: usage_00396.pdb # 3: usage_00526.pdb # 4: usage_00529.pdb # 5: usage_00530.pdb # 6: usage_00573.pdb # 7: usage_00929.pdb # 8: usage_00930.pdb # 9: usage_01571.pdb # 10: usage_02236.pdb # # Length: 57 # Identity: 4/ 57 ( 7.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 57 ( 14.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 20/ 57 ( 35.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00009.pdb 1 -EEVYFDVIRKKTAALFAACAEAAALSVQVGEEEVAFARLLGEYIGICFQIKDDIFD 56 usage_00396.pdb 1 -KQKYWRILEDKTAHFIEASLKSMAILLNK---DAKIYADFGLNFGMAFQIIDDLLD 53 usage_00526.pdb 1 TEESYMEVIYSKTARLFEAATLLAGVLTKQSEAIENAMQDYGKYLGTAFQLVDDIMD 57 usage_00529.pdb 1 ---------YSKTARLFEAATLLAGVLTKQSEAIENAMQDYGKYLGTAFQLVDDIMD 48 usage_00530.pdb 1 ---------YSKTARLFEAATLLAGVLTKQSEAIENAMQDYGKYLGTAFQLVDDIMD 48 usage_00573.pdb 1 -LETLEMIHKTKTGALLTFAVMSAADIANVDDTTKEHLESYSYHLGMMF-------- 48 usage_00929.pdb 1 TEENYMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLD 57 usage_00930.pdb 1 -EENYMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLD 56 usage_01571.pdb 1 TEDIYLRVIRGKTAALFSAATEVGGIIGGAPEDQVQALFDYGDALGIAFQIVDDLLD 57 usage_02236.pdb 1 ----YMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLD 53 KTa l a g G F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################