################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:04 2021 # Report_file: c_0732_76.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00293.pdb # 2: usage_00365.pdb # 3: usage_00428.pdb # 4: usage_00429.pdb # 5: usage_00545.pdb # 6: usage_00572.pdb # 7: usage_00755.pdb # # Length: 65 # Identity: 15/ 65 ( 23.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 65 ( 33.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 65 ( 21.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00293.pdb 1 NASPIIEHD--P-RMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQC-- 55 usage_00365.pdb 1 --SYIDGYK--E--KNKFIAAQGPKQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQ 54 usage_00428.pdb 1 NASLIKMEE----AQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQ 56 usage_00429.pdb 1 NASLIKMEE----AQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQ 56 usage_00545.pdb 1 NASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKC-- 58 usage_00572.pdb 1 NASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQ 60 usage_00755.pdb 1 NASLIKMEE----AQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQ 56 S yI tQGPl T FW VW qk VML E g kC usage_00293.pdb ----- usage_00365.pdb 55 YW--- 56 usage_00428.pdb 57 YWPQK 61 usage_00429.pdb 57 YWPQK 61 usage_00545.pdb ----- usage_00572.pdb 61 YW--- 62 usage_00755.pdb 57 YWPQK 61 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################