################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:20 2021 # Report_file: c_1317_16.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00033.pdb # 2: usage_00115.pdb # 3: usage_00117.pdb # 4: usage_00118.pdb # 5: usage_00205.pdb # 6: usage_00206.pdb # 7: usage_00207.pdb # 8: usage_00240.pdb # 9: usage_00293.pdb # 10: usage_00294.pdb # 11: usage_00334.pdb # 12: usage_00463.pdb # 13: usage_00517.pdb # 14: usage_00518.pdb # # Length: 44 # Identity: 3/ 44 ( 6.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 44 ( 31.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 44 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00033.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 usage_00115.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 usage_00117.pdb 1 SKFHYLLKLFQDKDVLKRVYTQNIDT-LERQAGVKDD-LIIEAH 42 usage_00118.pdb 1 -KFHYLLKLFQDKDVLKRVYTQNIDT-LERQAGVKDD-LIIEAH 41 usage_00205.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 usage_00206.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 usage_00207.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 usage_00240.pdb 1 SPLHSFIK-LQ-KGKLLRNYTQNIDN-LESYAGISTD-KLVQCH 40 usage_00293.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 usage_00294.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 usage_00334.pdb 1 -ICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 41 usage_00463.pdb 1 GPFDQMIAGHARS-RGLIIVTNN--TREFERVGG---LRTEDWS 38 usage_00517.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 usage_00518.pdb 1 TICHYFMRLLKDKGLLLRCYTQNIDT-LERIAGLEQE-DLVEAH 42 h k l r yTqN t le aG h #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################