################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:54 2021 # Report_file: c_1211_34.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00324.pdb # 2: usage_00326.pdb # 3: usage_00623.pdb # 4: usage_00624.pdb # 5: usage_01000.pdb # 6: usage_01055.pdb # 7: usage_01096.pdb # 8: usage_01143.pdb # 9: usage_01144.pdb # 10: usage_01145.pdb # 11: usage_01172.pdb # # Length: 45 # Identity: 13/ 45 ( 28.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 45 ( 35.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 45 ( 35.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00324.pdb 1 DFTFGFEESLE-VDTNPLLGAGKFATDPAVTLAHELIHAGHRLYG 44 usage_00326.pdb 1 DFTFGFEESLE-VDTNPLLGAGKFATDPAVTLAHELIHAEHRLYG 44 usage_00623.pdb 1 DFTFGFEESLE-VDTNPLLGAGKFATDPAVTLAHQLIHAGHRLYG 44 usage_00624.pdb 1 DFTFGFEESLE-VDTNPLLGAGKFATDPAVTLAHQLIHAGHRLYG 44 usage_01000.pdb 1 DFTFGFEE-------------GKFATDPAVTLAHELIHAGHRLYG 32 usage_01055.pdb 1 -YSFRFNDN--C--------MNEFIQDPALTLMHELIHSLHGLYG 34 usage_01096.pdb 1 --VSVFNNV---QEASIFN-RRGYFSDPALILMHELIHVLHGLYG 39 usage_01143.pdb 1 DFTFGFEESLE-VDTNPLLGAGKFATDPAVTLAHELIHAGHRLYG 44 usage_01144.pdb 1 DFTFGFEESLE-VDTNPLLGAGKFATDPAVTLAHELIHAGHRLYG 44 usage_01145.pdb 1 DFTFGFEESLE-VDTNPLLGAGKFATDPAVTLAHELIHAGHRLYG 44 usage_01172.pdb 1 ---FGFEE------------SGKFATDPAVTLAHELIHAGHRLYG 30 f F f DPA tL H LIH H LYG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################