################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:28 2021 # Report_file: c_0696_15.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00354.pdb # 2: usage_00355.pdb # 3: usage_00356.pdb # 4: usage_00357.pdb # 5: usage_00358.pdb # 6: usage_00359.pdb # 7: usage_00360.pdb # 8: usage_00529.pdb # 9: usage_00530.pdb # 10: usage_00531.pdb # 11: usage_00532.pdb # # Length: 75 # Identity: 58/ 75 ( 77.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/ 75 ( 77.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 75 ( 22.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00354.pdb 1 CMTFVPGSHLLPDPDT-------GAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 53 usage_00355.pdb 1 CMTFVPGSHLLPDPDT----GDEGAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 56 usage_00356.pdb 1 CMTFVPGSHLLPD----------------GEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 44 usage_00357.pdb 1 CMTFVPGSHLLP---------------RPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 45 usage_00358.pdb 1 CMTFVPGSHLLPDPDTGDEP-WAGAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 59 usage_00359.pdb 1 CMTFVPGSHLLPDPDTGDEP-WAGAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 59 usage_00360.pdb 1 CMTFVPGSHLLPDPDTGDEP-WAGAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 59 usage_00529.pdb 1 CMTFVPGSHLLPDPDTGDEP-WAGAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 59 usage_00530.pdb 1 CMTFVPGSHLLPDPDTGDEP-WAGAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 59 usage_00531.pdb 1 CMTFVPGSHLLPDPDTGDEP-WAGAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 59 usage_00532.pdb 1 CMTFVPGSHLLPDPDTGDEP-WAGAFTRPGEIWMPRVTVPLRAGDCTFHHARTVHSAGAN 59 CMTFVPGSHLLP GEIWMPRVTVPLRAGDCTFHHARTVHSAGAN usage_00354.pdb 54 STDEPRLSTSAVYMD 68 usage_00355.pdb 57 STDEPRLSTSAVYMD 71 usage_00356.pdb 45 STDEPRLSTSAVYMD 59 usage_00357.pdb 46 STDEPRLSTSAVYMD 60 usage_00358.pdb 60 STDEPRLSTSAVYMD 74 usage_00359.pdb 60 STDEPRLSTSAVYMD 74 usage_00360.pdb 60 STDEPRLSTSAVYMD 74 usage_00529.pdb 60 STDEPRLSTSAVYMD 74 usage_00530.pdb 60 STDEPRLSTSAVYMD 74 usage_00531.pdb 60 STDEPRLSTSAVYMD 74 usage_00532.pdb 60 STDEPRLSTSAVYMD 74 STDEPRLSTSAVYMD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################