################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:12 2021 # Report_file: c_1484_277.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00050.pdb # 2: usage_00325.pdb # 3: usage_00326.pdb # 4: usage_00327.pdb # 5: usage_00489.pdb # 6: usage_00490.pdb # 7: usage_00981.pdb # 8: usage_03234.pdb # 9: usage_03369.pdb # 10: usage_04328.pdb # # Length: 33 # Identity: 2/ 33 ( 6.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 33 ( 36.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 33 ( 15.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00050.pdb 1 -DAFAKVVAQADARGEFLTNAQFDALSNLVKEG 32 usage_00325.pdb 1 -DAFAKVVAQADARGEFLSNTQLDALANMIAEG 32 usage_00326.pdb 1 -DAFAKVVAQADARGEFLSNTQLDALANMIAEG 32 usage_00327.pdb 1 -DAFAKVVAQADARGEFLSNTQLDALANMIAEG 32 usage_00489.pdb 1 -DAFSRVVEQADKKGAYLSNDEINALQAIVADS 32 usage_00490.pdb 1 -DAFSRVVEQADKKGAYLSNDEINALQAIVADS 32 usage_00981.pdb 1 -DAFTKVVSQADARGAYLTTDQIDALTALVSDG 32 usage_03234.pdb 1 DEICREVKTASIIIGNST----LHMKMSRAQEL 29 usage_03369.pdb 1 -DAFAKVVAQADARGEFLTNAQFDALSNLVKEG 32 usage_04328.pdb 1 -DAFAKVVAQADARGEFLSNTQIDALLAIVSEG 32 daf Vv qad G l al #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################