################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:01:25 2021 # Report_file: c_0323_5.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00012.pdb # 2: usage_00013.pdb # 3: usage_00025.pdb # 4: usage_00026.pdb # # Length: 131 # Identity: 73/131 ( 55.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 75/131 ( 57.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/131 ( 5.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 -PVNVGLLHYKGREPPFTPCTAKGVIVLLKRCGIEMAGKRAVVLGRSNIVGAPVAALLMK 59 usage_00013.pdb 1 -PVNVGLLHYKGREPPFTPCTAKGVIVLLKRCGIEMAGKRAVVLGRSNIVGAPVAALLMK 59 usage_00025.pdb 1 LPVNVGQLHIRERNPAIVPCTASAVMELLRCSGVEICGKRVVVLGRGDIAGLPVATLLAN 60 usage_00026.pdb 1 LPVNVGQLHIRERNPAIVPCTASAVMELLRCSGVEICGKRVVVLGRGDIAGLPVATLLAN 60 PVNVG LH R P PCTA V LL G E GKR VVLGR I G PVA LL usage_00012.pdb 60 ENATVTIVHSGTSTEDMIDYLRTADIVIAAMGQPGYVKGEWIKEGAAVVDVGTTPVPDPS 119 usage_00013.pdb 60 ENATVTIVHSGTSTEDMIDYLRTADIVIAAMGQPGYVKGEWIKEGAAVVDVGTTPVPDPS 119 usage_00025.pdb 61 EDATVTVVHSATPLCDIADIVRASDIVVSAAGQPGLVRGEWIKLGAAVIDVGTTPVADPS 120 usage_00026.pdb 61 EDATVTVVHSATPLCDIADIVRASDIVVSAAGQPGLVRGEWIKLGAAVIDVGTTPVADPS 120 E ATVT VHS T D D R DIV A GQPG V GEWIK GAAV DVGTTPV DPS usage_00012.pdb 120 RKDGY-RLVGD 129 usage_00013.pdb 120 GYRLVG----- 125 usage_00025.pdb 121 KVPGY-RLVG- 129 usage_00026.pdb 121 KVPGY-RLVG- 129 gy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################