################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:09 2021 # Report_file: c_1084_19.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00759.pdb # 2: usage_00760.pdb # 3: usage_00770.pdb # 4: usage_01117.pdb # 5: usage_01166.pdb # 6: usage_01410.pdb # 7: usage_01785.pdb # # Length: 70 # Identity: 3/ 70 ( 4.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 70 ( 24.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 70 ( 34.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00759.pdb 1 DGATLTGTVQDIIRELARHGARRLVLMNGHY---ENSMFIVEGIDLALRELRYAG---IQ 54 usage_00760.pdb 1 DGATLTGTVQDIIRELARHGARRLVLMNGHY---ENSMFIVEGIDLALRELRYAG---IQ 54 usage_00770.pdb 1 DGATLTGTVQDIIRELARHGARRLVLMNGHY---ENSMFIVEGIDLALRELRYAG---IQ 54 usage_01117.pdb 1 ----TEGFIIDRIHEAKRQGVGFVVINAGA-YTHT-SVGIRDALLGTA------------ 42 usage_01166.pdb 1 DGATLTGTVQDIIRELARHGARRLVLMNGHY---ENSMFIVEGIDLALRELRYAG---IQ 54 usage_01410.pdb 1 RPSTLIQVVRDYVTCLAKAGFSKFYFINGHG---GNIATLKAAFSETYAHLEDLQIANAQ 57 usage_01785.pdb 1 DGATLTGTVQDIIRELARHGARRLVLMNGHY---ENSMFIVEGIDLALRELRYAG---IQ 54 l g v D i elar G v nGh s i usage_00759.pdb 55 DFKVVVLS-- 62 usage_00760.pdb 55 DFKVVVLS-- 62 usage_00770.pdb 55 DFKVVVLS-- 62 usage_01117.pdb 43 -IPFIEVHIT 51 usage_01166.pdb 55 DFKVVVLS-- 62 usage_01410.pdb 58 QVQCQVAN-- 65 usage_01785.pdb 55 DFKVVVLS-- 62 v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################