################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:35 2021 # Report_file: c_0677_77.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00151.pdb # 2: usage_00152.pdb # 3: usage_00536.pdb # 4: usage_00537.pdb # 5: usage_00830.pdb # 6: usage_01415.pdb # # Length: 74 # Identity: 10/ 74 ( 13.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 74 ( 17.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 30/ 74 ( 40.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00151.pdb 1 -TLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRIT------------- 46 usage_00152.pdb 1 -TLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRIT------------- 46 usage_00536.pdb 1 AKIMFARHAIVRPFNGRMTLMVRAANARQNVIAEARAKMRLMRRRE------L-MKLHDL 53 usage_00537.pdb 1 AKIMFARHAIVRPFNGRMTLMVRAANARQNVIAEARAKMRLMRRM----------KIHDL 50 usage_00830.pdb 1 -TLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRIT------------- 46 usage_01415.pdb 1 -TLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLEL 59 F A v G LM R N R eA L r usage_00151.pdb -------------- usage_00152.pdb -------------- usage_00536.pdb 54 KLV----------- 56 usage_00537.pdb 51 K------------- 51 usage_00830.pdb -------------- usage_01415.pdb 60 DVGFSTGADQLFLV 73 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################