################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:15:55 2021 # Report_file: c_0940_82.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00229.pdb # 2: usage_00367.pdb # 3: usage_00427.pdb # 4: usage_00430.pdb # 5: usage_00436.pdb # 6: usage_00774.pdb # 7: usage_00917.pdb # 8: usage_00918.pdb # 9: usage_00920.pdb # 10: usage_01124.pdb # 11: usage_01168.pdb # 12: usage_01173.pdb # 13: usage_01238.pdb # 14: usage_01479.pdb # # Length: 48 # Identity: 30/ 48 ( 62.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 48 ( 89.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 48 ( 8.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00229.pdb 1 ----WPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 44 usage_00367.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_00427.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_00430.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_00436.pdb 1 TYYEYPIMSDYDVYTGGSPGADRVIFNGDDELAGVITHTGASGDDFVA 48 usage_00774.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITQTGASGNNFVE 48 usage_00917.pdb 1 PYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_00918.pdb 1 PYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_00920.pdb 1 PYYAWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_01124.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_01168.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_01173.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 usage_01238.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITATGASGNNFVE 48 usage_01479.pdb 1 PYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVE 48 wPIlSsgDVYsGGSPGADRVvFNennqLAGVIT TGASGnnFVe #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################