################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:27:11 2021 # Report_file: c_1365_20.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00020.pdb # 2: usage_00060.pdb # 3: usage_00061.pdb # 4: usage_00062.pdb # 5: usage_00129.pdb # 6: usage_00274.pdb # 7: usage_00518.pdb # 8: usage_00519.pdb # 9: usage_00531.pdb # 10: usage_00580.pdb # # Length: 46 # Identity: 9/ 46 ( 19.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 46 ( 82.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 46 ( 15.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00020.pdb 1 TEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNS 46 usage_00060.pdb 1 DNEKKDLIQSDIAALHHFYSKHLEFP---DND-SLVVLFAQVNC-- 40 usage_00061.pdb 1 DNEKKDLIQSDIAALHHFYSKHLEFP---DND-SLVVLFAQVNC-- 40 usage_00062.pdb 1 DNEKKDLIQSDIAALHHFYSKHLEFP---DND-SLVVLFAQVNC-- 40 usage_00129.pdb 1 DNEKKDLIQSDIAALHHFYSKHLGFP---DND-SLVVLFAQVNCNG 42 usage_00274.pdb 1 DNEKKDLIQSDIAALHHFYSKHLGFP---DND-SLVVLFAQVNC-- 40 usage_00518.pdb 1 -NEKKDLIQSDIAALHHFYSKHLGFP---DND-SLVVLFAQVNCNG 41 usage_00519.pdb 1 -NEKKDLIQSDIAALHHFYSKHLGFP---DND-SLVVLFAQVNC-- 39 usage_00531.pdb 1 DNEKKDLIQSDIAALHHFYSKHLEFP---DND-SLVVLFAQVNC-- 40 usage_00580.pdb 1 DNEKKDLIQSDIAALHHFYSKHLGFP---DND-SLVVLFAQVNC-- 40 neKKdliqsdiaalhHFyskhl fp dnd sLvvlFAqVnC #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################