################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:11:30 2021
# Report_file: c_1281_19.html
################################################################################################
#====================================
# Aligned_structures: 9
#   1: usage_00563.pdb
#   2: usage_00567.pdb
#   3: usage_00568.pdb
#   4: usage_00569.pdb
#   5: usage_00571.pdb
#   6: usage_00572.pdb
#   7: usage_00705.pdb
#   8: usage_00892.pdb
#   9: usage_00998.pdb
#
# Length:         36
# Identity:       10/ 36 ( 27.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     19/ 36 ( 52.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            5/ 36 ( 13.9%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00563.pdb         1  GIKTGSADLLKFVEANMGY-Q-GDAALKSAIALTHT   34
usage_00567.pdb         1  GIKTGSADLLKFVEANMGY-Q-GDAALKSAIALTHT   34
usage_00568.pdb         1  GIKTGSADLLKFVEANMGY-Q-GDAALKSAIALTHT   34
usage_00569.pdb         1  GIKTGSADLLKFVEANMGY-Q-GDAALKSAIALTHT   34
usage_00571.pdb         1  GIKTGSADLLKFVEANMGY-Q-GDAALKSAIALT--   32
usage_00572.pdb         1  GIKTGSADLLKFVEANMGY-Q-GDAALKSAIALTHT   34
usage_00705.pdb         1  GVKSSSRDLIRFVEANIGLGQ-YDAPLQRALSDTRI   35
usage_00892.pdb         1  GVKTSAADLLRFVDANLHP-ERLDRPWAQALDA---   32
usage_00998.pdb         1  GIKTGSADLLKFVEANMGY-Q-GDAALKSAIALT--   32
                           G Kt saDLl FVeAN g  q  Da l  A      


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################