################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:21 2021 # Report_file: c_0650_91.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00254.pdb # 2: usage_00357.pdb # 3: usage_00612.pdb # 4: usage_00682.pdb # 5: usage_00683.pdb # # Length: 81 # Identity: 34/ 81 ( 42.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 81 ( 50.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 81 ( 1.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00254.pdb 1 MGWEASTERLYPRDGVLKGEIHKALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDSKLD 60 usage_00357.pdb 1 QGWEPSTERLFARDGMLIGNDYMALKLEGGGHYLCEFKSTYKAKKPVRMPGRHEIDRKLD 60 usage_00612.pdb 1 MGWEASTERLYPRDGVLKGEIHKALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDSKLD 60 usage_00682.pdb 1 LKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDYHFVDHRIE 60 usage_00683.pdb 1 LKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDYHFVDHRIE 60 WE STE L RDG L G i AL L GGHYL FK Y AKK VqlP y vD usage_00254.pdb 61 ITSHNEDYTIVEQYERTEGR- 80 usage_00357.pdb 61 VTSHNRDYTSVEQCEIAIAR- 80 usage_00612.pdb 61 ITSHNEDYTIVEQYERTEGR- 80 usage_00682.pdb 61 ILSNDSDYNKVKLYEHGVARY 81 usage_00683.pdb 61 ILSNDSDYNKVKLYEHGVAR- 80 i S DY V yE R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################