################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:20 2021 # Report_file: c_0459_11.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00066.pdb # 2: usage_00087.pdb # 3: usage_00088.pdb # 4: usage_00267.pdb # 5: usage_00268.pdb # 6: usage_00269.pdb # 7: usage_00270.pdb # 8: usage_00271.pdb # # Length: 79 # Identity: 62/ 79 ( 78.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 65/ 79 ( 82.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 79 ( 2.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00066.pdb 1 -AKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDD 59 usage_00087.pdb 1 -AKLGYWKIRGLQQPVRLLLEYLGEKYEEQIYERDDGEKWFSKKFELGLDLPNLPYYIDD 59 usage_00088.pdb 1 -AKLGYWKIRGLQQPVRLLLEYLGEKYEEQIYERDDGEKWFSKKFELGLDLPNLPYYIDD 59 usage_00267.pdb 1 PAKLGYWKIRGLQQPVRLLLEYLGEEYEEHLYGRDDREKWLGDKFNMGLDLPNLPYYIDD 60 usage_00268.pdb 1 PAKLGYWKIRGLQQPVRLLLEYLGEEYEEHLYGRDDREKWLGDKFNMGLDLPNLPYYIDD 60 usage_00269.pdb 1 PAKLGYWKIRGLQQPVRLLLEYLGEEYEEHLYGRDDREKWLGDKFNMGLDLPNLPYYIDD 60 usage_00270.pdb 1 -AKLGYWKIRGLQQPVRLLLEYLGEEYEEHLYGRDDREKWLGDKFNMGLDLPNLPYYIDD 59 usage_00271.pdb 1 -AKLGYWKIRGLQQPVRLLLEYLGEEYEEHLYGRDDREKWLGDKFNMGLDLPNLPYYIDD 59 AKLGYWKiRGLqQPVRLlLEYLGE YEE Y RDD EKW KF GLDLPNLPYYIDD usage_00066.pdb 60 KCKLTQSVAIMRYIADKH- 77 usage_00087.pdb 60 KCKLTQSLAILRYIADKHG 78 usage_00088.pdb 60 KCKLTQSLAILRYIADKHG 78 usage_00267.pdb 61 KCKLTQSVAIMRYIADKHG 79 usage_00268.pdb 61 KCKLTQSVAIMRYIADKHG 79 usage_00269.pdb 61 KCKLTQSVAIMRYIADKHG 79 usage_00270.pdb 60 KCKLTQSVAIMRYIADKHG 78 usage_00271.pdb 60 KCKLTQSVAIMRYIADKHG 78 KCKLTQS AI RYIADKH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################