################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:55 2021 # Report_file: c_0820_18.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00022.pdb # 2: usage_00071.pdb # 3: usage_00710.pdb # 4: usage_00711.pdb # 5: usage_00712.pdb # # Length: 67 # Identity: 21/ 67 ( 31.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 67 ( 52.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 67 ( 28.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00022.pdb 1 SEESRRDIDYFMDKLYDKFVSKGIPVVIGEFGARDKNGNLQSRVEFAAYYVRAARARGIT 60 usage_00071.pdb 1 SDYDKASLTSELDAIYNRFVKNGRAVIIGEFGTIDK-NNLSSRVAHAEHYAREAVSRGIA 59 usage_00710.pdb 1 SDYDKSSLDSEFDAVYNKFVKNGRAVVIGEMGSINK-NNTAARVTHAEYYAKSAKARGLT 59 usage_00711.pdb 1 ------------------FVKNGRAVVIGEMGSINK-NNTAARVTHAEYYAKSAKARGLT 41 usage_00712.pdb 1 SDYDKSSLDSEFDAVYNKFVKNGRAVVIGEMGSINK-NNTAARVTHAEYYAKSAKARGLT 59 FVknGraVvIGE G i K nN RV hAeyYa A aRG t usage_00022.pdb 61 CCWWDNN 67 usage_00071.pdb 60 VFWWDNG 66 usage_00710.pdb 60 PIWWDNG 66 usage_00711.pdb 42 PIWWDNG 48 usage_00712.pdb 60 PIWWDNG 66 WWDNg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################