################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:54:34 2021 # Report_file: c_1240_67.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00342.pdb # 2: usage_00344.pdb # 3: usage_00346.pdb # 4: usage_00348.pdb # 5: usage_00350.pdb # 6: usage_00352.pdb # 7: usage_00817.pdb # 8: usage_00819.pdb # 9: usage_00821.pdb # 10: usage_00824.pdb # 11: usage_01684.pdb # 12: usage_01892.pdb # 13: usage_01894.pdb # 14: usage_01896.pdb # 15: usage_01898.pdb # 16: usage_01900.pdb # 17: usage_01902.pdb # # Length: 49 # Identity: 12/ 49 ( 24.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 49 ( 57.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 49 ( 20.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00342.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_00344.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_00346.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_00348.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_00350.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_00352.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_00817.pdb 1 -GYCFVRLTSI-----SNNSLLADKITKILSNHLSVKPRRVYIEF---- 39 usage_00819.pdb 1 -GYCFVRLTSIGGINRSNNSLLADKITKILSNHLSVKPRRVYIEF---- 44 usage_00821.pdb 1 -GYCFVRLTSIGGINRSNNSLLADKITKILSNHLSVKPRRVYIEF---- 44 usage_00824.pdb 1 -AYCFVRITSIGGINRSNNSALADQITKLLVSNLNVKSRRIYVEFRDCS 48 usage_01684.pdb 1 DPCAFIRVASIGGITSSTNCKIAAALSAACERHLGVPKNRIYTTFTNKS 49 usage_01892.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRD-- 46 usage_01894.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRD-- 46 usage_01896.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_01898.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_01900.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 usage_01902.pdb 1 -GYCFVRLTSIGGINRSNNSSLADKITKILSNHLGVKPRRVYIEFRDCS 48 ycFvR tSI SnNs lAd itk l hL Vk rR Y eF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################