################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:33:19 2021 # Report_file: c_1408_174.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00171.pdb # 2: usage_00592.pdb # 3: usage_01179.pdb # 4: usage_01219.pdb # 5: usage_01329.pdb # 6: usage_01330.pdb # # Length: 94 # Identity: 8/ 94 ( 8.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 94 ( 22.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 45/ 94 ( 47.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00171.pdb 1 KEAQAAAEQLKTTRNAYIQKYLQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCD 60 usage_00592.pdb 1 ---------------------RVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR 39 usage_01179.pdb 1 -------------------------LKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD 35 usage_01219.pdb 1 ---------------------------------TLSAILLAFIITWTPYNIMVLVNTFCD 27 usage_01329.pdb 1 -------------------------MREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR 35 usage_01330.pdb 1 -------------------------MREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNR 35 tLgii F l W Pff niv v usage_00171.pdb 61 SCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNK 94 usage_00592.pdb 40 DLV---PDWLFVAFNWLGYANSAMNPIILC---- 66 usage_01179.pdb 36 NLI---RKEVYILLNWIGYVNSGFNPLIY----- 61 usage_01219.pdb 28 SCI---PKTYWNLGYWLCYINSTVNPVCYALC-- 56 usage_01329.pdb 36 DLV---PDWLFVAFNWLGYANSAMN--------- 57 usage_01330.pdb 36 DLV---PDWLFVAFNWLGYANSAMN--------- 57 W gY nS N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################