################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:59 2021 # Report_file: c_0673_126.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_01474.pdb # 2: usage_01476.pdb # 3: usage_01478.pdb # 4: usage_01480.pdb # 5: usage_01628.pdb # 6: usage_01729.pdb # 7: usage_01787.pdb # # Length: 64 # Identity: 7/ 64 ( 10.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 54/ 64 ( 84.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 64 ( 15.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01474.pdb 1 RDVSLLHKPTTQISDFHVATRFNDD-FSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVA 59 usage_01476.pdb 1 RDVSLLHKPTTQISDFHVATRFNDD-FSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVA 59 usage_01478.pdb 1 RDVSLLHKPTTQISDFHVATRFNDD-FSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVA 59 usage_01480.pdb 1 RDVSLLHKPTTQISDFHVATRFNDD-FSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVA 59 usage_01628.pdb 1 -DVWLMVLPERHLTNARILTPD--ALSDAKTVVIRPEVT-AP---GPVRARLLDGDREIA 53 usage_01729.pdb 1 RDVSLLHKPTTQISDFHVATRFNDD-FSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVA 59 usage_01787.pdb 1 ---SLLHKPTTQISDFHVATRFNDD-FSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVA 56 sLlhkPttqisdfhvaTrf d fsravleaevqmc el lrVtvsLwqGetqvA usage_01474.pdb 60 SGTA 63 usage_01476.pdb 60 SGTA 63 usage_01478.pdb 60 SGTA 63 usage_01480.pdb 60 SGTA 63 usage_01628.pdb 54 ATEG 57 usage_01729.pdb 60 SGTA 63 usage_01787.pdb 57 SGTA 60 sgta #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################