################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:38 2021 # Report_file: c_1432_69.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00369.pdb # 2: usage_00370.pdb # 3: usage_00849.pdb # 4: usage_00850.pdb # 5: usage_01195.pdb # 6: usage_01371.pdb # 7: usage_01576.pdb # # Length: 61 # Identity: 16/ 61 ( 26.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 61 ( 26.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 61 ( 24.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00369.pdb 1 -PWTFSVHGYATGLYAPGRGRS----TGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQ 55 usage_00370.pdb 1 -PWTFSVHGYATGLYAPGRGRS----TGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQ 55 usage_00849.pdb 1 ------IPGYGSGTFAPGRQ--------S-TTEPWIVGHNLLVAHGRAVKVYRDEFKDLN 45 usage_00850.pdb 1 -PLCSAIPGYGSGTFAPGRQ--------S-TTEPWIVGHNLLVAHGRAVKVYRDEFKDLN 50 usage_01195.pdb 1 EPRCVAALGYDNGFHAPGRCS-GCDAGGNSTTEPYLAAHHLILSHAAAVKRYREKYQLYQ 59 usage_01371.pdb 1 -PWTFSVHGYATGLYAPGRGRS----TGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQ 55 usage_01576.pdb 1 EPRCVAALGYDNGFHAPGRCS-GCDAGGNSTTEPYLAAHHLILSHAAAVKRYREKYQLYQ 59 GY G APGR TEP H L H AV Y usage_00369.pdb 56 E 56 usage_00370.pdb 56 E 56 usage_00849.pdb 46 D 46 usage_00850.pdb 51 D 51 usage_01195.pdb 60 K 60 usage_01371.pdb 56 E 56 usage_01576.pdb 60 K 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################