################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:19:39 2021
# Report_file: c_1076_122.html
################################################################################################
#====================================
# Aligned_structures: 5
#   1: usage_00780.pdb
#   2: usage_00828.pdb
#   3: usage_01308.pdb
#   4: usage_01309.pdb
#   5: usage_01310.pdb
#
# Length:         81
# Identity:       18/ 81 ( 22.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     29/ 81 ( 35.8%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           34/ 81 ( 42.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00780.pdb         1  -------------------------PSIEHAGMMMVQCLLGGNKIISCGNGGSAGHAQHF   35
usage_00828.pdb         1  DMQHRIRQLFQASIETKQQALEVLPPYIEQASLVMVNALLNEGKILSCGNGGSAGDAQHF   60
usage_01308.pdb         1  --------------------EKILVEPTVQAAELMLQCLMNDGKILACGNGGSAADAQHF   40
usage_01309.pdb         1  -------------------AEKILVEPTVQAAELMLQCLMNDGKILACGNGGSAADAQHF   41
usage_01310.pdb         1  -------------------AEKILVEPTVQAAELMLQCLMNDGKILACGNGGSAADAQHF   41
                                                        qA   M qcL n gKIl CGNGGSA dAQHF

usage_00780.pdb        36  CAQLLNKYETERPSLPAIS--   54
usage_00828.pdb        61  SSELLNRFERERPSLPAVALT   81
usage_01308.pdb        41  AAEMTG------MELAAVALT   55
usage_01309.pdb        42  AAEMTG-------ELAAVALT   55
usage_01310.pdb        42  AAEMTG-------ELAAVALT   55
                            ae           L Ava  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################