################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:03 2021 # Report_file: c_1050_11.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00295.pdb # 2: usage_00296.pdb # 3: usage_00297.pdb # 4: usage_00468.pdb # 5: usage_00666.pdb # 6: usage_00763.pdb # 7: usage_00764.pdb # # Length: 78 # Identity: 16/ 78 ( 20.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 78 ( 30.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 78 ( 30.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00295.pdb 1 HVLTILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVE-----GR-- 53 usage_00296.pdb 1 HVLTILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVE-----GR-- 53 usage_00297.pdb 1 NVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAKLASFYERAGKAVALGSP-D-- 57 usage_00468.pdb 1 DVALMADSTSRWAEALRE--------ISGRGYPAYLASKLAEFYERAGRVV-----T-LG 46 usage_00666.pdb 1 HVLVIMTDMTNYAEALREISAARREVPGRRGYPGYLYTNLATLFERAGRIR-----GL-- 53 usage_00763.pdb 1 HVLTILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVE-----GR-- 53 usage_00764.pdb 1 HVLTILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVE-----GR-- 53 V i s A ALRE p rGyP Y L yERAGr usage_00295.pdb 54 ----NGSITQIPILT--- 64 usage_00296.pdb 54 ----NGSITQIPILTM-- 65 usage_00297.pdb 58 ---RTGSVSIVAAVSP-- 70 usage_00468.pdb 47 SDYRVGSVSVIGAVSPP- 63 usage_00666.pdb 54 ----KGSVTQIPILT--- 64 usage_00763.pdb 54 ----NGSITQIPILTMPN 67 usage_00764.pdb 54 ----NGSITQIPILT--- 64 GS i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################