################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:58:52 2021
# Report_file: c_0967_5.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00056.pdb
#   2: usage_00121.pdb
#   3: usage_00127.pdb
#   4: usage_00151.pdb
#   5: usage_00174.pdb
#   6: usage_00215.pdb
#   7: usage_00222.pdb
#   8: usage_00248.pdb
#   9: usage_00282.pdb
#  10: usage_00317.pdb
#  11: usage_00335.pdb
#  12: usage_00348.pdb
#  13: usage_00390.pdb
#
# Length:         36
# Identity:        3/ 36 (  8.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      5/ 36 ( 13.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            7/ 36 ( 19.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00056.pdb         1  NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR--   34
usage_00121.pdb         1  DFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH--   34
usage_00127.pdb         1  NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLD   36
usage_00151.pdb         1  NFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQ--   34
usage_00174.pdb         1  NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR--   34
usage_00215.pdb         1  DYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL---   33
usage_00222.pdb         1  NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR--   34
usage_00248.pdb         1  -FQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR--   33
usage_00282.pdb         1  -YDTGEELGSGKFAVVKKCREKSTGLQYAAKFIK--   33
usage_00317.pdb         1  NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIR--   34
usage_00335.pdb         1  DYEVLYTIGTGSYGRCQKIRR---GKILVWKELDYG   33
usage_00348.pdb         1  -YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIK--   33
usage_00390.pdb         1  -YELCEVIGKGAFSVVRRCINRETGQQFAVKIVD--   33
                                   G G    v        g     K     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################