################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:38 2021 # Report_file: c_1076_16.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00237.pdb # 2: usage_00238.pdb # 3: usage_00239.pdb # 4: usage_00632.pdb # 5: usage_00633.pdb # 6: usage_00638.pdb # 7: usage_01528.pdb # 8: usage_01529.pdb # 9: usage_01564.pdb # # Length: 65 # Identity: 15/ 65 ( 23.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/ 65 ( 89.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 65 ( 10.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00237.pdb 1 ---YWKDRLLKMKMAGLNAIQTYVPWNFHEPWPG-QYQFSEDHDVEYFLRLAHELGLLVI 56 usage_00238.pdb 1 ---YWKDRLLKMKMAGLNAIQTYVPWNFHEPWPG-QYQFSEDHDVEYFLRLAHELGLLVI 56 usage_00239.pdb 1 PRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPG-QYQFSEDHDVEYFLRLAHELGLLVI 59 usage_00632.pdb 1 PRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPG-QYQFSEDHDVEYFLRLAHELGLLVI 59 usage_00633.pdb 1 ---YWKDRLLKMKMAGLNAIQTYVPWNFHEPWPG-QYQFSEDHDVEYFLRLAHELGLLVI 56 usage_00638.pdb 1 ---YWKDRLLKMKMAGLNAIQTYVPWNFHEPWPG-QYQFSEDHDVEYFLRLAHELGLLVI 56 usage_01528.pdb 1 ---YWKDRLLKMKMAGLNAIQTYVPWNFHEPWPG-QYQFSEDHDVEYFLRLAHELGLLVI 56 usage_01529.pdb 1 ---YWKDRLLKMKMAGLNAIQTYVPWNFHEPWPG-QYQFSEDHDVEYFLRLAHELGLLVI 56 usage_01564.pdb 1 DPDGLKEQLLQLRAAGVDGVMVDVWWGIIELKGPKQYDWR---AYRSLLQLVQECGLTLQ 57 ywKdrLLkmkmAGlnaiqtyVpWnfhEpwpg QYqfs dveyfLrLahElGLlvi usage_00237.pdb 57 LRPGP 61 usage_00238.pdb 57 LRPGP 61 usage_00239.pdb 60 LRPGP 64 usage_00632.pdb 60 LRPGP 64 usage_00633.pdb 57 LRPGP 61 usage_00638.pdb 57 LRPGP 61 usage_01528.pdb 57 LRPGP 61 usage_01529.pdb 57 LRPGP 61 usage_01564.pdb 58 AIMSF 62 lrpgp #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################