################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:39 2021 # Report_file: c_0788_57.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00265.pdb # 2: usage_00266.pdb # 3: usage_00287.pdb # 4: usage_00295.pdb # 5: usage_00345.pdb # 6: usage_00404.pdb # # Length: 125 # Identity: 11/125 ( 8.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/125 ( 17.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 61/125 ( 48.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00265.pdb 1 WASIVNVASIAGETGNVVA---GVAYSASKAGVIGLTKRLAVQLAGYGIRVNAVAPSFVE 57 usage_00266.pdb 1 WASIVNVASIAGETGNVVA---GVAYSASKAGVIGLTKRLAVQLAGYGIRVNAVAPSFVE 57 usage_00287.pdb 1 --SVVFTISNAGFYP-NGG---GPLYTATKHAVVGLVRQMAFELAPHV-RVNGVAPGGMN 53 usage_00295.pdb 1 FGRIITIGS------------GQVNYAAAKAGVIGFSKSLAREVASRGITVNVVAPG--- 45 usage_00345.pdb 1 -SAVISTGSIAGHTG-G--GPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSP---- 52 usage_00404.pdb 1 -GSIVNVGSIVGLKG-N---SGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVH 55 S Y A K g a a rvN VaP usage_00265.pdb 58 TD-------M------------------LHPLKIILKPEDVAEAILFLADPRRSRGITGH 92 usage_00266.pdb 58 TD-------MTRSFL----R----IAS-LHPLKIILKPEDVAEAILFLADPRRSRGITGH 101 usage_00287.pdb 54 TDLRGPSSLGLSEQSISSVPLADML-KSVLPIGRMPALEEYTGAYVFFATRGDSLPATGA 112 usage_00295.pdb 46 ------------------------------------DAKEIASAVAFLASD-EASYISGE 68 usage_00345.pdb 53 ----------------------------GIPMGRFGTAEEMAPAFLFFASHLASGYITGQ 84 usage_00404.pdb 56 ------------------------K-K-NIPLGRFGETIEVAHAVVFLLE---SPYITGH 86 a A F a s itG usage_00265.pdb 93 VLSIN 97 usage_00266.pdb 102 VLSIN 106 usage_00287.pdb 113 LLN-- 115 usage_00295.pdb 69 TLHVN 73 usage_00345.pdb 85 VLDIN 89 usage_00404.pdb 87 VLVVD 91 L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################