################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:16:14 2021 # Report_file: c_1064_23.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00042.pdb # 2: usage_00043.pdb # 3: usage_00044.pdb # 4: usage_00045.pdb # 5: usage_00046.pdb # 6: usage_00047.pdb # 7: usage_00048.pdb # 8: usage_00098.pdb # 9: usage_00099.pdb # 10: usage_00100.pdb # 11: usage_00113.pdb # 12: usage_00234.pdb # 13: usage_00422.pdb # 14: usage_00423.pdb # # Length: 45 # Identity: 40/ 45 ( 88.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 45 ( 88.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 45 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQ 45 usage_00043.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQ 45 usage_00044.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQ 45 usage_00045.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQ 45 usage_00046.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSK----- 40 usage_00047.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQ 45 usage_00048.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQ 45 usage_00098.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSK----- 40 usage_00099.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSK----- 40 usage_00100.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQ 45 usage_00113.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEY- 44 usage_00234.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKE-- 43 usage_00422.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQ 45 usage_00423.pdb 1 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKE-- 43 RKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################