################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:13 2021 # Report_file: c_1307_116.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00003.pdb # 2: usage_00004.pdb # 3: usage_00312.pdb # 4: usage_00606.pdb # 5: usage_00607.pdb # 6: usage_00824.pdb # 7: usage_00825.pdb # 8: usage_01045.pdb # 9: usage_01047.pdb # 10: usage_01931.pdb # 11: usage_02306.pdb # # Length: 35 # Identity: 31/ 35 ( 88.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 35 ( 88.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 35 ( 11.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 GNEKIHLISTQSAIPYALRVELEDWNGRTSTADYA 35 usage_00004.pdb 1 GNEKIHLISTQSAIPYALRVELEDWNGRTSTADYA 35 usage_00312.pdb 1 GNEKIHLISTQSAIPYALRVELEDWNGRTSTAD-- 33 usage_00606.pdb 1 --EKIHLISTQSAIPYALRVELEDWNGRTSTAD-- 31 usage_00607.pdb 1 --EKIHLISTQSAIPYALRVELEDWNGRTSTAD-- 31 usage_00824.pdb 1 GNEKIHLISTQSAIPYALRVELEDWNGRTSTADYA 35 usage_00825.pdb 1 GNEKIHLISTQSAIPYALRVELEDWNGRTSTADYA 35 usage_01045.pdb 1 GNEKIHLISTQSAIPYALRVELEDWNGRTSTAD-- 33 usage_01047.pdb 1 -NEKIHLISTQSAIPYALRVELEDWNGRTSTADYA 34 usage_01931.pdb 1 GNEKIHLISTQSAIPYALRVELEDWNGRTSTADYA 35 usage_02306.pdb 1 -NEKIHLISTQSAIPYALRVELEDWNGRTSTADYA 34 EKIHLISTQSAIPYALRVELEDWNGRTSTAD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################