################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:50 2021 # Report_file: c_1373_25.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01475.pdb # 2: usage_01476.pdb # 3: usage_01477.pdb # 4: usage_01479.pdb # 5: usage_01480.pdb # 6: usage_01481.pdb # 7: usage_01537.pdb # 8: usage_01538.pdb # 9: usage_01881.pdb # # Length: 46 # Identity: 41/ 46 ( 89.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 46 ( 89.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 46 ( 10.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01475.pdb 1 KPYGLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSYM 46 usage_01476.pdb 1 ---GLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSYM 43 usage_01477.pdb 1 --YGLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSM- 43 usage_01479.pdb 1 KPYGLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSM- 45 usage_01480.pdb 1 ---GLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSM- 42 usage_01481.pdb 1 --YGLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSM- 43 usage_01537.pdb 1 ---GLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSYM 43 usage_01538.pdb 1 ---GLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLSYM 43 usage_01881.pdb 1 KPYGLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLS-- 44 GLRHLYAEVAYHNFAPPHVTKNSYFAAILGHNNNDLETSLS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################