################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:01:49 2021
# Report_file: c_0702_12.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00016.pdb
#   2: usage_00035.pdb
#   3: usage_00036.pdb
#   4: usage_00037.pdb
#   5: usage_00057.pdb
#   6: usage_00108.pdb
#   7: usage_00182.pdb
#   8: usage_00183.pdb
#   9: usage_00184.pdb
#  10: usage_00185.pdb
#  11: usage_00186.pdb
#  12: usage_00187.pdb
#  13: usage_00188.pdb
#
# Length:         39
# Identity:        4/ 39 ( 10.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     11/ 39 ( 28.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            7/ 39 ( 17.9%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00016.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00035.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00036.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00037.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00057.pdb         1  VKILLSNNEIITGKVYDIDFDGIVLGT----EKGIERIP   35
usage_00108.pdb         1  -QIELKNGEIIQGILTNVDNWNLTLSNVTEVKLNEIYIR   38
usage_00182.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00183.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00184.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00185.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLL--   33
usage_00186.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00187.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
usage_00188.pdb         1  VKIFLRNGEVLDAEVTGVSNYEIMVKV----GDRNLLVF   35
                            kI L NgE     vt v n  i                


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################