################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:15 2021 # Report_file: c_0751_3.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00067.pdb # 2: usage_00215.pdb # 3: usage_00216.pdb # 4: usage_00219.pdb # 5: usage_00277.pdb # 6: usage_00278.pdb # 7: usage_00280.pdb # # Length: 101 # Identity: 7/101 ( 6.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/101 ( 18.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 39/101 ( 38.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00067.pdb 1 -----LVRVWAG-DEHGLGECYP--SAPAAGIHHIV----------N-EEQLLGEDPRDV 41 usage_00215.pdb 1 -----FAEIETAGGHQGLGFSYSKRA-GGPGQFAHAR---------EIAPALIGEDPSDI 45 usage_00216.pdb 1 -----FAEIETAGGHQGLGFSYSKRA-GGPGQFAHAR---------EIAPALIGEDPSDI 45 usage_00219.pdb 1 DFELITVRIEDSDGATGLGYTYTVNH-GGAAVATVDK---------DLRGCLLGADAEQI 50 usage_00277.pdb 1 -----FAEIETAGGHQGLGFSYSKRA-GGPGQFAHAR---------EIAPALIGEDPSDI 45 usage_00278.pdb 1 -----FAEIETAGGHQGLGFSYSKRA-GGPGQFAHAR---------EIAPALIGEDPSDI 45 usage_00280.pdb 1 -EDAVIVKVHTDKGIVGVGEADS----SPLVVQACIEAPQTNFYCNGLKRLLIGENALEI 55 g GlG y L Ged i usage_00067.pdb 42 ERLYEKR-RWNIFTGGQAGAVITALS--------------- 66 usage_00215.pdb 46 AKLWDKLCWAGA-SAGRSGLSTQAIGAFDVALWDLKAKRAG 85 usage_00216.pdb 46 AKLWDKLCWAGA-SAGRSGLSTQAIGAFDVALWDLKAKRAG 85 usage_00219.pdb 51 EKIWQS-WWRLH-YAGRGGHATSAISAVDIALWDLKGIRA- 88 usage_00277.pdb 46 AKLWDKLCWAGA-SAGRSGLSTQAIGAFDVALWDLKAKRAG 85 usage_00278.pdb 46 AKLWDKLCWAGA-SAGRSGLSTQAIGAFDVALWDLKAKRAG 85 usage_00280.pdb 56 ERLWNKMYWGSN-YMGRRGAGIHAISAIDIALWDIAGQFYG 95 lw k w Gr G Ai #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################