################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:20 2021 # Report_file: c_0672_16.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00023.pdb # 2: usage_00024.pdb # 3: usage_00025.pdb # 4: usage_00026.pdb # 5: usage_00027.pdb # 6: usage_00028.pdb # 7: usage_00114.pdb # 8: usage_00309.pdb # # Length: 61 # Identity: 9/ 61 ( 14.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 61 ( 36.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 61 ( 14.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00023.pdb 1 NVRVATGDSEDEFKVTSNLLLYRTRG-DVATYDVLSGERTDVLRRAG-D-SFLMAKRVVL 57 usage_00024.pdb 1 NVRVATGDSEDEFKVTSNLLLYRTRG-DVATYDVLSGERTDVLRRAG-D-SFLMAKRVVL 57 usage_00025.pdb 1 NVRVATGDSEDEFKVTSNLLLYRTRG-DVATYDVLSGERTDVLRRAG-D-SFLMAKRVVL 57 usage_00026.pdb 1 NVRVATGDSEDEFKVTSNLLLYRTRG-DVATYDVLSGERTDVLRRAG-D-SFLMAKRVVL 57 usage_00027.pdb 1 NVRVATGDSEDEFKVTSNLLLYRTRG-DVATYDVLSGERTDVLRRAG-D-SFLMAKRVVL 57 usage_00028.pdb 1 NVRVATGDSEDEFKVTSNLLLYRTRG-DVATYDVLSGERTDVLRRAG-D-SFLMAKRVVL 57 usage_00114.pdb 1 -VEAFEAENG---ELDVLSNILVYRNRRQTEVTVHTLGREDKLRQDG-N-GFKVFRRKLI 54 usage_00309.pdb 1 NVMIVDGEKPGEYHVSSVFIVYRNRL-E-RQLDIFAGERKDILRRTGSEAGFELAKRTIL 58 V g v s yr R dv geR D LRr G F akR l usage_00023.pdb 58 L 58 usage_00024.pdb 58 L 58 usage_00025.pdb 58 L 58 usage_00026.pdb 58 L 58 usage_00027.pdb 58 L 58 usage_00028.pdb 58 L 58 usage_00114.pdb 55 L 55 usage_00309.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################