################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 03:50:07 2021 # Report_file: c_0949_84.html ################################################################################################ #==================================== # Aligned_structures: 28 # 1: usage_00004.pdb # 2: usage_00120.pdb # 3: usage_00134.pdb # 4: usage_00205.pdb # 5: usage_00207.pdb # 6: usage_00315.pdb # 7: usage_00327.pdb # 8: usage_00337.pdb # 9: usage_00340.pdb # 10: usage_00353.pdb # 11: usage_00359.pdb # 12: usage_00360.pdb # 13: usage_00361.pdb # 14: usage_00371.pdb # 15: usage_00372.pdb # 16: usage_00374.pdb # 17: usage_00375.pdb # 18: usage_00376.pdb # 19: usage_00388.pdb # 20: usage_00414.pdb # 21: usage_00569.pdb # 22: usage_00720.pdb # 23: usage_00721.pdb # 24: usage_00930.pdb # 25: usage_00980.pdb # 26: usage_00981.pdb # 27: usage_00982.pdb # 28: usage_00983.pdb # # Length: 33 # Identity: 16/ 33 ( 48.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 33 ( 78.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 33 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00120.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFCFHW 33 usage_00134.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFCW 33 usage_00205.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFDFHW 33 usage_00207.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFDFHW 33 usage_00315.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00327.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00337.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFNFHW 33 usage_00340.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00353.pdb 1 SFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHW 33 usage_00359.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00360.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00361.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00371.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00372.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00374.pdb 1 LFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00375.pdb 1 TFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00376.pdb 1 SFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00388.pdb 1 AFQVEFDDSCEDSGISGGPLGNHYRLKQFHFHW 33 usage_00414.pdb 1 SFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHW 33 usage_00569.pdb 1 AFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00720.pdb 1 SFNVEYDDSEDKAVLKDGPLTGTYRLVQFHFHW 33 usage_00721.pdb 1 SFNVEYDDSEDKAVLKDGPLTGTYRLVQFHFHW 33 usage_00930.pdb 1 GFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHW 33 usage_00980.pdb 1 SFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHW 33 usage_00981.pdb 1 SFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHW 33 usage_00982.pdb 1 SFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHW 33 usage_00983.pdb 1 SFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHW 33 FnVE DDS dkavlk GPL gtYRL QF FhW #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################