################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:46 2021 # Report_file: c_1370_16.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00707.pdb # 2: usage_00711.pdb # 3: usage_00713.pdb # 4: usage_00717.pdb # 5: usage_00723.pdb # 6: usage_01405.pdb # 7: usage_01632.pdb # 8: usage_01748.pdb # # Length: 73 # Identity: 64/ 73 ( 87.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 64/ 73 ( 87.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 73 ( 12.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00707.pdb 1 -PQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHAS-----IQDFNYTDH 54 usage_00711.pdb 1 TPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHAS-----IQDFNYTDH 55 usage_00713.pdb 1 TPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHAS-----IQDFNYTDH 55 usage_00717.pdb 1 TPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHAS--------FNYTDH 52 usage_00723.pdb 1 TPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHAS-----IQDFNYTDH 55 usage_01405.pdb 1 TPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDH 60 usage_01632.pdb 1 TPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHAS-----IQDFNYTDH 55 usage_01748.pdb 1 TPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDH 60 PQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHAS FNYTDH usage_00707.pdb 55 TLGRIILNAMNET 67 usage_00711.pdb 56 TLGRIILNAMNET 68 usage_00713.pdb 56 TLGRIILNAMNET 68 usage_00717.pdb 53 TLGRIILNAMNET 65 usage_00723.pdb 56 TLGRIILNAMNET 68 usage_01405.pdb 61 TLGRIILNAMNET 73 usage_01632.pdb 56 TLGRIILNAMNET 68 usage_01748.pdb 61 TLGRIILNAMNET 73 TLGRIILNAMNET #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################