################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:38:49 2021 # Report_file: c_0655_28.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00003.pdb # 2: usage_00005.pdb # 3: usage_00036.pdb # 4: usage_00037.pdb # 5: usage_00039.pdb # 6: usage_00055.pdb # 7: usage_00088.pdb # 8: usage_00153.pdb # 9: usage_00157.pdb # 10: usage_00158.pdb # 11: usage_00163.pdb # 12: usage_00199.pdb # 13: usage_00203.pdb # 14: usage_00205.pdb # 15: usage_00276.pdb # 16: usage_00289.pdb # # Length: 52 # Identity: 12/ 52 ( 23.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 52 ( 40.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 52 ( 13.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 ---HSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRR- 48 usage_00005.pdb 1 ---HSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRR- 48 usage_00036.pdb 1 ---HSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRR- 48 usage_00037.pdb 1 ----SLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRR- 47 usage_00039.pdb 1 ----SLNVLEGSWVLYELPNYRGRQYLLRPGEYRRYHDWGAMNAKVGSLRR- 47 usage_00055.pdb 1 ----SLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRR- 47 usage_00088.pdb 1 ---HSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRR- 48 usage_00153.pdb 1 DKISSIKVKSGTWRFYEYINYGGRYWDLGPGEYSSVESAGIP--DNSISSFR 50 usage_00157.pdb 1 ---HSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRR- 48 usage_00158.pdb 1 ---HSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRR- 48 usage_00163.pdb 1 ---HSCHVMDGHWLVYEQPNYTGRQFYLRPGEYRSYNDWGGVTSRMGSIRR- 48 usage_00199.pdb 1 ---HSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRR- 48 usage_00203.pdb 1 ---HSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRR- 48 usage_00205.pdb 1 ---HSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRR- 48 usage_00276.pdb 1 ----SLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRR- 47 usage_00289.pdb 1 ----SLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRR- 47 S V G W YE Y GRq L pg Yr dwG s rr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################