################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:28:09 2021 # Report_file: c_1304_15.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00089.pdb # 2: usage_00093.pdb # 3: usage_00096.pdb # 4: usage_00104.pdb # 5: usage_00283.pdb # 6: usage_00336.pdb # 7: usage_00340.pdb # 8: usage_00386.pdb # 9: usage_00387.pdb # 10: usage_00431.pdb # 11: usage_00437.pdb # 12: usage_00438.pdb # 13: usage_00737.pdb # 14: usage_01074.pdb # 15: usage_01115.pdb # # Length: 35 # Identity: 8/ 35 ( 22.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 35 ( 57.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 35 ( 5.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00089.pdb 1 -WGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 33 usage_00093.pdb 1 SWGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 34 usage_00096.pdb 1 SWGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 34 usage_00104.pdb 1 SWGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 34 usage_00283.pdb 1 SWGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 34 usage_00336.pdb 1 SWGRLSTAIQESNQ-GAFASPIQLQRRNGSKFNVY 34 usage_00340.pdb 1 SWGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 34 usage_00386.pdb 1 -WGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 33 usage_00387.pdb 1 SWGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 34 usage_00431.pdb 1 SWGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 34 usage_00437.pdb 1 -WGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 33 usage_00438.pdb 1 -WGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 33 usage_00737.pdb 1 KWGKLSFQIRTSGANGMFSEAVELERANGKKYYVT 35 usage_01074.pdb 1 -WGRLSTAIQESNQ-GAFASPIQLQRRNGSKFSVY 33 usage_01115.pdb 1 KWSALSNAVQQSNQGGVFSSPVELRSISNKPVYVG 35 Wg LS aiq Snq G F sp L r ng k V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################