################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:02 2021 # Report_file: c_1078_28.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00069.pdb # 2: usage_00071.pdb # 3: usage_00072.pdb # 4: usage_00087.pdb # 5: usage_00102.pdb # 6: usage_00110.pdb # 7: usage_00111.pdb # 8: usage_00159.pdb # 9: usage_00178.pdb # 10: usage_00331.pdb # 11: usage_00333.pdb # # Length: 36 # Identity: 25/ 36 ( 69.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 36 ( 94.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 36 ( 5.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00069.pdb 1 --YSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 34 usage_00071.pdb 1 --YSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 34 usage_00072.pdb 1 --YSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 34 usage_00087.pdb 1 --YSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 34 usage_00102.pdb 1 AAFRQEANKKFKYSVKLSDYSTLQDAVTDAVDGLLI 36 usage_00110.pdb 1 DQYSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 36 usage_00111.pdb 1 --YSIEADKKFKYSAKLSDYPTLQDAASAAVDGLLI 34 usage_00159.pdb 1 --YSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 34 usage_00178.pdb 1 --YSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 34 usage_00331.pdb 1 --YSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 34 usage_00333.pdb 1 DQYSIEADKKFKYSVKLSDYPTLQDAASAAVDGLLI 36 ysiEAdKKFKYSvKLSDYpTLQDAasaAVDGLLI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################