################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:56 2021 # Report_file: c_1386_64.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00139.pdb # 2: usage_00444.pdb # 3: usage_00593.pdb # 4: usage_00594.pdb # 5: usage_00624.pdb # 6: usage_00625.pdb # 7: usage_00628.pdb # 8: usage_00714.pdb # 9: usage_01367.pdb # # Length: 67 # Identity: 7/ 67 ( 10.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 67 ( 35.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 67 ( 16.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00139.pdb 1 ----IDSIVEFSSNLQN-NIDISAFSCIAALA-V-TERHGLKEPKRVEELQNKIVNCLKD 53 usage_00444.pdb 1 CSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHH 60 usage_00593.pdb 1 --ELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHH 58 usage_00594.pdb 1 CSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHH 60 usage_00624.pdb 1 --ELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHH 58 usage_00625.pdb 1 --ELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHH 58 usage_00628.pdb 1 -SELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHH 59 usage_00714.pdb 1 -----EPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALEL 55 usage_01367.pdb 1 --ELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHH 58 sif Fs l a a Al RpGL e vE lQ nl a usage_00139.pdb 54 HVTFNNG 60 usage_00444.pdb 61 HLCKT-- 65 usage_00593.pdb 59 HLCKT-- 63 usage_00594.pdb 61 HLCKT-- 65 usage_00624.pdb 59 HLCKT-- 63 usage_00625.pdb 59 HLCKTH- 64 usage_00628.pdb 60 HLCKT-- 64 usage_00714.pdb 56 QLKL--- 59 usage_01367.pdb 59 HLCKT-- 63 hl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################