################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:52 2021 # Report_file: c_1378_70.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00007.pdb # 2: usage_00008.pdb # 3: usage_00009.pdb # 4: usage_00010.pdb # 5: usage_00338.pdb # 6: usage_00646.pdb # 7: usage_00647.pdb # 8: usage_00648.pdb # 9: usage_00649.pdb # # Length: 62 # Identity: 41/ 62 ( 66.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 62 ( 66.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 62 ( 33.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00007.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLARFYTPARYLFHALQMGSVYI 60 usage_00008.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLARFY----------------- 43 usage_00009.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLARFYTPARYLFHALQMGSVYI 60 usage_00010.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLAR------------------- 41 usage_00338.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLAR------------------- 41 usage_00646.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLAR------------------- 41 usage_00647.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLARFYTPARYLFHALQMGSVYI 60 usage_00648.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLAR------------------- 41 usage_00649.pdb 1 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLAR------------------- 41 YRTYNLLQDGQESYVQGLFDQLNDRGHDQMLTREWVETLAR usage_00007.pdb 61 HQ 62 usage_00008.pdb -- usage_00009.pdb 61 HQ 62 usage_00010.pdb -- usage_00338.pdb -- usage_00646.pdb -- usage_00647.pdb 61 HQ 62 usage_00648.pdb -- usage_00649.pdb -- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################