################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:36:33 2021 # Report_file: c_0475_3.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00015.pdb # 2: usage_00023.pdb # 3: usage_00064.pdb # 4: usage_00065.pdb # 5: usage_00066.pdb # 6: usage_00067.pdb # 7: usage_00092.pdb # # Length: 105 # Identity: 15/105 ( 14.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/105 ( 35.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/105 ( 29.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 -PKLLILVGAPGSGKSTFARYFIRTED----NW--VRVNRDDFRLQFGDS---LSPFYEE 50 usage_00023.pdb 1 ---LVVLIGSSGSGKSTFAKKHFK---------PTEVISSDFCRGLSD--DEND-QTVTG 45 usage_00064.pdb 1 DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDV--IVLGSDLIRESFP--V--WKEKYEE 54 usage_00065.pdb 1 DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDV--IVLGSDLIRESFP--V--WKEKYEE 54 usage_00066.pdb 1 ---LIILTGLPGVGKSTFSKNLAKILSKNNIDV--IVLGSDLIRESFP--V--WKEKYEE 51 usage_00067.pdb 1 DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDV--IVLGSDLIRESFP--V--WKEKYEE 54 usage_00092.pdb 1 DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDV--IVLGSDLIRESFP--V--WKEKYEE 54 L iL G pG GKSTF k k v sD R f yee usage_00015.pdb 51 RITK-VEASVIALLKNRTNVIIDATNSSLRSLQDVH--TY----- 87 usage_00023.pdb 46 AAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPL-IEI-AKDYH 88 usage_00064.pdb 55 FIKKSTYRLIDSALKN-YWVIVDDTNYYNSMRRDL-INI-AKKYN 96 usage_00065.pdb 55 FIKKSTYRLIDSALKN-YWVIVDDTNYYNSMRRDL-INI-AKKYN 96 usage_00066.pdb 52 FIKKSTYRLIDSALKN-YWVIVDDTNYYNSMRRDL-INI-AKKYN 93 usage_00067.pdb 55 FIKKSTYRLIDSALKN-YWVIVDDTNYYNSMRRDL-INI-AKKYN 96 usage_00092.pdb 55 FIKKSTYRLIDSALKN-YWVIVDDTNYYNSMRRDL-INI-AKKYN 96 i k Lkn vivD TN s r dl i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################