################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:11 2021 # Report_file: c_1433_30.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00235.pdb # 2: usage_00385.pdb # 3: usage_00905.pdb # 4: usage_00906.pdb # 5: usage_01167.pdb # # Length: 65 # Identity: 11/ 65 ( 16.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 65 ( 30.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 65 ( 23.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00235.pdb 1 --PLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSL-GQMP 57 usage_00385.pdb 1 DAAIFREMGEIGLLGPTIPEQYGGPGLDYVSYGLIAREVERVDSGY-RSMMSVQSSLVMV 59 usage_00905.pdb 1 --ELHRKAAELGLLGAGFPEDAGGSGGDGADPVVICEEMHYAG--SPGGVYASLF----- 51 usage_00906.pdb 1 --ELHRKAAELGLLGAGFPEDAGGSGGDGADPVVICEEMHYAG--SPGGVYASLF----- 51 usage_01167.pdb 1 --ELHRKAAELGLLGAGFPEDAGGSGGDGADPVVICEEMHYAG--SPGGVYASLF----- 51 l R a ElGLlg PE GG G d d I eE y usage_00235.pdb 58 I-II- 60 usage_00385.pdb 60 PIFEF 64 usage_00905.pdb ----- usage_00906.pdb ----- usage_01167.pdb ----- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################