################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:00:07 2021 # Report_file: c_1434_227.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_01709.pdb # 2: usage_02422.pdb # 3: usage_02423.pdb # 4: usage_02424.pdb # 5: usage_02425.pdb # 6: usage_02454.pdb # 7: usage_02455.pdb # 8: usage_02456.pdb # # Length: 53 # Identity: 49/ 53 ( 92.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/ 53 ( 92.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 53 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01709.pdb 1 SWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRC- 52 usage_02422.pdb 1 SWAVARLYHLLAEEKLCPAS-RDVAYQEAVRTLSSRDDHRLGELQDEARNRCG 52 usage_02423.pdb 1 SWAVARLYHLLAEEKLCPAS-RDVAYQEAVRTLSSRDDHRLGELQDEARNRCG 52 usage_02424.pdb 1 SWAVARLYHLLAEEKLCPAS-RDVAYQEAVRTLSSRDDHRLGELQDEARNRCG 52 usage_02425.pdb 1 SWAVARLYHLLAEEKLCPAS-RDVAYQEAVRTLSSRDDHRLGELQDEARNRCG 52 usage_02454.pdb 1 SWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARN--- 50 usage_02455.pdb 1 SWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARN--- 50 usage_02456.pdb 1 SWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCG 53 SWAVARLYHLLAEEKLCPAS RDVAYQEAVRTLSSRDDHRLGELQDEARN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################