################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:15 2021 # Report_file: c_1477_61.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00049.pdb # 2: usage_00050.pdb # 3: usage_00051.pdb # 4: usage_00052.pdb # 5: usage_00053.pdb # 6: usage_00190.pdb # 7: usage_00191.pdb # 8: usage_00306.pdb # 9: usage_01202.pdb # 10: usage_01203.pdb # 11: usage_01204.pdb # 12: usage_01205.pdb # # Length: 37 # Identity: 27/ 37 ( 73.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 37 ( 73.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 37 ( 27.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00049.pdb 1 DTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKD 37 usage_00050.pdb 1 DTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKD 37 usage_00051.pdb 1 DTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLL-- 35 usage_00052.pdb 1 DTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLK- 36 usage_00053.pdb 1 -TSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLL-- 34 usage_00190.pdb 1 -TSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPL--- 33 usage_00191.pdb 1 -TSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLL-- 34 usage_00306.pdb 1 DTSVVSQRAKELNKRLTAPPAAFLCHLD--------- 28 usage_01202.pdb 1 DTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKD 37 usage_01203.pdb 1 DTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKD 37 usage_01204.pdb 1 -TSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKD 36 usage_01205.pdb 1 -TSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKD 36 TSVVSQRAKELNKRLTAPPAAFLCHLD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################