################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:17:41 2021 # Report_file: c_1208_46.html ################################################################################################ #==================================== # Aligned_structures: 19 # 1: usage_00944.pdb # 2: usage_00945.pdb # 3: usage_00950.pdb # 4: usage_00951.pdb # 5: usage_00952.pdb # 6: usage_00953.pdb # 7: usage_00954.pdb # 8: usage_00955.pdb # 9: usage_00958.pdb # 10: usage_00959.pdb # 11: usage_00962.pdb # 12: usage_00963.pdb # 13: usage_00964.pdb # 14: usage_00965.pdb # 15: usage_00981.pdb # 16: usage_00982.pdb # 17: usage_00983.pdb # 18: usage_00984.pdb # 19: usage_00985.pdb # # Length: 33 # Identity: 33/ 33 (100.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 33 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 33 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00944.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00945.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00950.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00951.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00952.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00953.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00954.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00955.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00958.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00959.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00962.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00963.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00964.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00965.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00981.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00982.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00983.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00984.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 usage_00985.pdb 1 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY 33 GFNVETVQYKNISFTVWDVGGQDRIRSLWRHYY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################