################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:09 2021 # Report_file: c_0664_60.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00118.pdb # 2: usage_00119.pdb # 3: usage_00120.pdb # 4: usage_00121.pdb # 5: usage_00379.pdb # # Length: 69 # Identity: 17/ 69 ( 24.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/ 69 ( 71.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 69 ( 27.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00118.pdb 1 GLKPAMTWEAKVSVVKQIER--GFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVGRVC 58 usage_00119.pdb 1 GLKPAMTWEAKVSVVKQI-R--GFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVGRVC 57 usage_00120.pdb 1 GLKPAMTWEAKVSVVKQI-R--GFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVGRVC 57 usage_00121.pdb 1 --------------VKQIEAGQGFVAVVPAGYADGMPRHAQGKFSVTIDGLDYPQVGRVC 46 usage_00379.pdb 1 ------------LQSRFI-P--STLATISIGYADGWPRILSNKGTVYFNGHKLPIVGHIS 45 vkqI gfvAvvpaGYADGmPRhaqgKfsVtidGldyPqVGrvc usage_00118.pdb 59 MDQFVIS-- 65 usage_00119.pdb 58 MDQFVISLG 66 usage_00120.pdb 58 MDQFVIS-- 64 usage_00121.pdb 47 MDQFVIS-- 53 usage_00379.pdb 46 MDSIIVD-- 52 MDqfvis #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################