################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 02:06:17 2021
# Report_file: c_1345_44.html
################################################################################################
#====================================
# Aligned_structures: 18
#   1: usage_00088.pdb
#   2: usage_00089.pdb
#   3: usage_00090.pdb
#   4: usage_00290.pdb
#   5: usage_00291.pdb
#   6: usage_00292.pdb
#   7: usage_00293.pdb
#   8: usage_00294.pdb
#   9: usage_00305.pdb
#  10: usage_00306.pdb
#  11: usage_00448.pdb
#  12: usage_00470.pdb
#  13: usage_00471.pdb
#  14: usage_00472.pdb
#  15: usage_00473.pdb
#  16: usage_00474.pdb
#  17: usage_00475.pdb
#  18: usage_00476.pdb
#
# Length:         38
# Identity:        7/ 38 ( 18.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     32/ 38 ( 84.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            6/ 38 ( 15.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00088.pdb         1  --DHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARRY   33
usage_00089.pdb         1  -PDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARRY   34
usage_00090.pdb         1  LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARRY   35
usage_00290.pdb         1  LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARRY   35
usage_00291.pdb         1  LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARR-   34
usage_00292.pdb         1  LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARR-   34
usage_00293.pdb         1  LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARR-   34
usage_00294.pdb         1  LPDHYVSQGKWFVLFSHPADFTPV--T-TEFVSFARR-   34
usage_00305.pdb         1  LPDHYVSQGKWFVLFSHPADFTPVS-T-TEFVSFARR-   35
usage_00306.pdb         1  LPDHYVSQGKWFVLFSHPADFTPVS-T-TEFVSFARR-   35
usage_00448.pdb         1  EWSKLISENKKVIITGAPAAFSPT-CTVSHIPGYINYL   37
usage_00470.pdb         1  -PDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY   35
usage_00471.pdb         1  LPDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY   36
usage_00472.pdb         1  -PDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY   35
usage_00473.pdb         1  LPDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARR-   35
usage_00474.pdb         1  --DHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY   34
usage_00475.pdb         1  -PDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARR-   34
usage_00476.pdb         1  -PDHYVSQGKWFVLFSHPADFTPVC-T-TEFVSFARRY   35
                             dhyvSqgKwfvlfshPAdFtPv  T tefvsfarr 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################