################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:47 2021 # Report_file: c_0786_29.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00110.pdb # 2: usage_00161.pdb # 3: usage_00162.pdb # 4: usage_00164.pdb # 5: usage_00352.pdb # 6: usage_00363.pdb # 7: usage_00493.pdb # 8: usage_01093.pdb # # Length: 70 # Identity: 11/ 70 ( 15.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 70 ( 37.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 70 ( 22.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00110.pdb 1 PVTVCGDVHGQFHDLMELFRIG-GKSP-DTNYLFMGDYVNRGYYSVETVTLLVALKV--- 55 usage_00161.pdb 1 PVTVCGDIHGQFFDLMKLFEVG-GSPA-NTRYLFLGDYVDRGYFSIECVLYLWALKI--- 55 usage_00162.pdb 1 PVTVCGDIHGQFFDLMKLFEVG-GSPA-NTRYLFLGDYVDRGYFSIECVLYLWALKI--- 55 usage_00164.pdb 1 RVIIVGDIHGCRAQLEDLLRAVSFKQG-SDTLVAVGDLVNKGPDSFGVVRLLKRLGAYSV 59 usage_00352.pdb 1 KISVCGDTHGQFYDVLNLFRKF-GKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKI--- 56 usage_00363.pdb 1 PVTVCGDIHGQFFDLMKLFEVG-GSPA-NTRYLFLGDYVDRGYFSIECVLYLWALKI--- 55 usage_00493.pdb 1 -ITVCGDVHGQYYDLMKLFEVG-GDPA-ETRYLFLGDYVDRGYFSIECVLYLWALKI--- 54 usage_01093.pdb 1 PVTVCGDIHGQFFDLMKLFEVG-GSPA-NTRYLFLGDYVDRGYFSIECVLYLWALKI--- 55 vcGD HGq dl Lf g ylf GD V rG S e v l Lk usage_00110.pdb 56 RYRERITILR 65 usage_00161.pdb 56 LYPKTLFLLR 65 usage_00162.pdb 56 LYPKTLFLLR 65 usage_00164.pdb ---------- usage_00352.pdb 57 LHPNNFFLNR 66 usage_00363.pdb 56 LYPKTLFLLR 65 usage_00493.pdb 55 WYPNTLWLLR 64 usage_01093.pdb 56 LYPKTLFLLR 65 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################