################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:24 2021 # Report_file: c_0840_50.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00197.pdb # 2: usage_00743.pdb # 3: usage_00744.pdb # 4: usage_00745.pdb # 5: usage_00746.pdb # 6: usage_01171.pdb # 7: usage_01172.pdb # # Length: 58 # Identity: 11/ 58 ( 19.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 58 ( 87.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 58 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00197.pdb 1 -LELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLL 57 usage_00743.pdb 1 -IEAIVAAKPDLIITEPTRNTPIERLEKIAPTVSIDHLK-----GGAPEIYRKLAEL- 51 usage_00744.pdb 1 -IEAIVAAKPDLIITEPTRNTPIERLEKIAPTVSIDHLK-----GGAPEIYRKLAEL- 51 usage_00745.pdb 1 DIEAIVAAKPDLIITEPTRNTPIERLEKIAPTVSIDHLK-----GGAPEIYRKLAELT 53 usage_00746.pdb 1 -IEAIVAAKPDLIITEPTRNTPIERLEKIAPTVSIDHLK-----GGAPEIYRKLAEL- 51 usage_01171.pdb 1 -IEAIVAAKPDLIITEPTRNTPIERLEKIAPTVSIDHLK-----GGAPEIYRKLAEL- 51 usage_01172.pdb 1 -IEAIVAAKPDLIITEPTRNTPIERLEKIAPTVSIDHLK-----GGAPEIYRKLAEL- 51 iEaivaaKPdliiteptrntpiErLekIAPtvsidhlk ggApeiyrklAeL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################