################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:40:29 2021 # Report_file: c_0405_14.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00114.pdb # 2: usage_00229.pdb # 3: usage_00249.pdb # 4: usage_00250.pdb # 5: usage_00251.pdb # 6: usage_00428.pdb # 7: usage_00526.pdb # # Length: 84 # Identity: 42/ 84 ( 50.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/ 84 ( 50.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 84 ( 7.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00114.pdb 1 -TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE 59 usage_00229.pdb 1 GGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYE 60 usage_00249.pdb 1 -TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE 59 usage_00250.pdb 1 -TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE 59 usage_00251.pdb 1 -TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE 59 usage_00428.pdb 1 GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE 60 usage_00526.pdb 1 GGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYE 60 ASVVC LNNFYP V WK D S T QDSKDSTYS SSTLTL K YE usage_00114.pdb 60 KHKVYACEVTHQGLSSPVTKSF-- 81 usage_00229.pdb 61 RHNSYTCEATHATSTSPIVKSFN- 83 usage_00249.pdb 60 KKLY-ACEVTQ-GLSSPVTKSFNR 81 usage_00250.pdb 60 KKLY-ACEVTQ-GLSSPVTKSFNR 81 usage_00251.pdb 60 KKLY-ACEVTQ-GLSSPVTKSFNR 81 usage_00428.pdb 61 KHKVYACEVTHQGLSSPVTKSFN- 83 usage_00526.pdb 61 RHNSYTCEATHKTSTSPIVKS--- 81 CE T SP KS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################