################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:11 2021 # Report_file: c_1298_18.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00131.pdb # 2: usage_00132.pdb # 3: usage_00133.pdb # 4: usage_00153.pdb # 5: usage_00154.pdb # 6: usage_00576.pdb # 7: usage_00577.pdb # 8: usage_00579.pdb # 9: usage_00580.pdb # 10: usage_00581.pdb # 11: usage_00582.pdb # 12: usage_01696.pdb # 13: usage_01778.pdb # # Length: 34 # Identity: 34/ 34 (100.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 34 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 34 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00131.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00132.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00133.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00153.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00154.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00576.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00577.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00579.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00580.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00581.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_00582.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_01696.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 usage_01778.pdb 1 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE 34 ATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################