################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:26 2021 # Report_file: c_1489_170.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00768.pdb # 2: usage_01097.pdb # 3: usage_01365.pdb # 4: usage_01596.pdb # 5: usage_01760.pdb # 6: usage_02678.pdb # 7: usage_03353.pdb # 8: usage_03434.pdb # 9: usage_04332.pdb # # Length: 51 # Identity: 3/ 51 ( 5.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 51 ( 45.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 51 ( 41.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00768.pdb 1 --GACLLPKIETMREKVLTSSARQRLRCASIQKFGERALKAWSVARLSQKF 49 usage_01097.pdb 1 DKGACLLPKIETMREKVLTSSARQRLRCASIQKFGERALKAWSVARLSQK- 50 usage_01365.pdb 1 --AACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRF 49 usage_01596.pdb 1 --GACLLPKIDAMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKF 49 usage_01760.pdb 1 --------------------DYEKNKVCKEFSHLGKEDFTSLSLVLYSRKF 31 usage_02678.pdb 1 --LACLIPKLDALKERILLSSAKERLKCSSFQNFGERAVKAWSVARLSQK- 48 usage_03353.pdb 1 --LACLIPKLDALKERILLSSAKERLKCSSFQNFGERAVKAWSVARLSQKF 49 usage_03434.pdb 1 --LACLIPKLDALKERILLSSAKERLKCSSFQNFGERAVKAWSVARLSQKF 49 usage_04332.pdb 1 --LACLIPKLDALKERILLSSAKERLKCSSFQNFGERAVKAWSVARLSQKF 49 sa rl C s q fGera kawsvarlSqk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################