################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:47 2021 # Report_file: c_1120_131.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00199.pdb # 2: usage_00200.pdb # 3: usage_00201.pdb # 4: usage_00603.pdb # 5: usage_00653.pdb # 6: usage_00757.pdb # 7: usage_00897.pdb # 8: usage_00986.pdb # 9: usage_01061.pdb # # Length: 77 # Identity: 23/ 77 ( 29.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 77 ( 41.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 77 ( 16.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00199.pdb 1 DEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTM 60 usage_00200.pdb 1 -EKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTM 59 usage_00201.pdb 1 DEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTM 60 usage_00603.pdb 1 NEEARLDILKIHSRK-NLTRGINLRKIAEL-PGASGAEVKGVCTEAG-YALRERRVHVTQ 57 usage_00653.pdb 1 --EGRLEILKVHTRR-MKLKGVDLRAIAEMTEGASGADLKAIATEAGMFAIRERRTYVTQ 57 usage_00757.pdb 1 SVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 60 usage_00897.pdb 1 NEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQ 60 usage_00986.pdb 1 SVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 60 usage_01061.pdb 1 NEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQ 60 R IL iH Rk nl nL A G GA K cTEAG A RE R VT usage_00199.pdb 61 DDFRKAVEKIMEKKK-- 75 usage_00200.pdb 60 DDFRKAVEKIMEKK--- 73 usage_00201.pdb 61 DDFRKAVEKIMEKKK-- 75 usage_00603.pdb 58 EDFEAVAKV------Q- 67 usage_00653.pdb 58 EDFLKAVDK-------- 66 usage_00757.pdb 61 EDFELAVGKVMNKNQ-E 76 usage_00897.pdb 61 EDFEMAVAKVM------ 71 usage_00986.pdb 61 EDFELAVGKVMNKNQ-E 76 usage_01061.pdb 61 EDFEMAVAKVMQ----- 72 DF av k #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################