################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:13 2021 # Report_file: c_1434_78.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_02035.pdb # 2: usage_02038.pdb # 3: usage_02599.pdb # 4: usage_02600.pdb # 5: usage_02912.pdb # # Length: 65 # Identity: 25/ 65 ( 38.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 65 ( 86.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 65 ( 13.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02035.pdb 1 -EEEIQKLRNFGLYQGTLRGMMEMK--NSHQLIDENIIGKLKELALEELGGFHGKNAELM 57 usage_02038.pdb 1 -EEEIQKLRNFGLYQGTLRGMMEMK--NSHQLIDENIIGKLKELALEELGGFHGKNAELM 57 usage_02599.pdb 1 AEEEIQKLRNFGLYQGTLRGMMEMK--NSHQLIDENIIGKLKELALEELGGFHGKNAELM 58 usage_02600.pdb 1 AEEEIQKLRNFGLYQGTLRGMMEMK--NSHQLIDENIIGKLKELALEELGGFHGKNAELM 58 usage_02912.pdb 1 DEDKIEKLRRFGLYVGTVQGLLGKNRS-----GFEGRIKELKELAVKELESFGGEKIELI 55 EeeIqKLRnFGLYqGTlrGmmemk idEniIgkLKELAleELggFhGknaELm usage_02035.pdb 58 SSLVA 62 usage_02038.pdb 58 SSLVA 62 usage_02599.pdb 59 SSLVA 63 usage_02600.pdb 59 SSLVA 63 usage_02912.pdb 56 RGVF- 59 sslv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################