################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:10 2021 # Report_file: c_0768_20.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00003.pdb # 2: usage_00130.pdb # 3: usage_00131.pdb # 4: usage_00324.pdb # 5: usage_00332.pdb # 6: usage_00333.pdb # 7: usage_00334.pdb # 8: usage_00335.pdb # 9: usage_00336.pdb # 10: usage_00337.pdb # # Length: 67 # Identity: 3/ 67 ( 4.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 67 ( 14.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 67 ( 13.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 -RILNLPTSAGRSLIQALLARYYLE-NYEGKILIIVPTTALTTQMADDFVDYRLF---SH 55 usage_00130.pdb 1 DRLVCGDVGFGKTEVAMRAAFLAVD-N-HKQVAVLVPTTLLAQQHYDNFRDRFANWPV-- 56 usage_00131.pdb 1 -RILNLPTSAGRSLIQALLARYYLE-NYEGKILIIVPTTALTTQMADDFVDYRLF---SH 55 usage_00324.pdb 1 FGLNLASTGCGKTLANGRILYALADPQRGARFSIALGLRSLTLQTGQAYRERLGL---GD 57 usage_00332.pdb 1 -CLIVLPTGLGKTLIAMMIAEYRLT-KYGGKVLMLAPTKPLVLQHAESFRRLFNL---PP 55 usage_00333.pdb 1 -CLIVLPTGLGKTLIAMMIAEYRLT-KYGGKVLMLAPTKPLVLQHAESFRRLFNL---PP 55 usage_00334.pdb 1 -CLIVLPTGLGKTLIAMMIAEYRLT-KYGGKVLMLAPTKPLVLQHAESFRRLFNL---PP 55 usage_00335.pdb 1 -CLIVLPTGLGKTLIAMMIAEYRLT-KYGGKVLMLAPTKPLVLQHAESFRRLFNL---PP 55 usage_00336.pdb 1 -CLIVLPTGLGKTLIAMMIAEYRLT-KYGGKVLMLAPTKPLVLQHAESFRRLFNL---PP 55 usage_00337.pdb 1 -CLIVLPTGLGKTLIAMMIAEYRLT-KYGGKVLMLAPTKPLVLQHAESFRRLFNL---PP 55 t G l a pt L Q f usage_00003.pdb 56 AMIKKIG 62 usage_00130.pdb 57 -RIEMIS 62 usage_00131.pdb 56 AMIKKIG 62 usage_00324.pdb 58 DDLAILV 64 usage_00332.pdb 56 EKIVALT 62 usage_00333.pdb 56 EKIVALT 62 usage_00334.pdb 56 EKIVALT 62 usage_00335.pdb 56 EKIVALT 62 usage_00336.pdb 56 EKIVALT 62 usage_00337.pdb 56 EKIVALT 62 i #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################