################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:12:18 2021
# Report_file: c_1192_116.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00057.pdb
#   2: usage_00299.pdb
#   3: usage_01003.pdb
#   4: usage_01008.pdb
#   5: usage_01019.pdb
#   6: usage_01198.pdb
#   7: usage_01199.pdb
#   8: usage_01541.pdb
#   9: usage_01543.pdb
#  10: usage_01545.pdb
#  11: usage_01814.pdb
#  12: usage_01998.pdb
#
# Length:         34
# Identity:       11/ 34 ( 32.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     11/ 34 ( 32.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            3/ 34 (  8.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00057.pdb         1  -YVIRDSGDRIDLRYSKRAGD-IQLQYGWKVER-   31
usage_00299.pdb         1  KYVIRDSGDRIDLRYSKRAGD-IQLQYGWKVERH   33
usage_01003.pdb         1  -YVIRDSGDRIDLRYSKRAGD-IQLQYGWKVERH   32
usage_01008.pdb         1  KYVIRDSGDRIDLRYSKRAGD-IQLQYGWKVERH   33
usage_01019.pdb         1  -YVIRDSGDRIDLRYSKRAGD-IQLQYGWKVERH   32
usage_01198.pdb         1  -YVIDPEGRRIRLMESNRELIAEKLDIGWTVERH   33
usage_01199.pdb         1  -YVIDPEGRRIRLMESNRELIAEKLDIGWTVERH   33
usage_01541.pdb         1  KYIIRDNGDRIDLRFHPKPSD-LHLQTGYKVERH   33
usage_01543.pdb         1  -YIIRDNGDRIDLRFHPKPSD-LHLQTGYKVERH   32
usage_01545.pdb         1  -YIIRDNGDRIDLRFHPKPSD-LHLQTGYKVERH   32
usage_01814.pdb         1  -YVIRDSGDRIDLRYSKRAGD-IQLQYGWKVER-   31
usage_01998.pdb         1  KYIIRDNGDRIDLRFHPKPSD-LHLQTGYKVERH   33
                            Y I   G RI L           L  G  VER 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################