################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:26:54 2021 # Report_file: c_0958_58.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00041.pdb # 2: usage_00042.pdb # 3: usage_00117.pdb # 4: usage_00118.pdb # 5: usage_00119.pdb # 6: usage_00568.pdb # 7: usage_00727.pdb # 8: usage_00861.pdb # 9: usage_00918.pdb # 10: usage_00919.pdb # 11: usage_00921.pdb # 12: usage_01317.pdb # 13: usage_01369.pdb # 14: usage_01391.pdb # 15: usage_01392.pdb # # Length: 49 # Identity: 6/ 49 ( 12.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 10/ 49 ( 20.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 49 ( 22.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00041.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_00042.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_00117.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_00118.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_00119.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_00568.pdb 1 DYQLLQENDPQVFSYLREY-R--------GEKLLVVVNLSEEKALFEA- 39 usage_00727.pdb 1 TFRELGGSNPSVLAYIREVTRQQGDGGAKTDAVLCVNNLSRFPQPIELN 49 usage_00861.pdb 1 DFSLVSNTQDAVLAYYRIL-N--------DKKWLVVANLSNEEQNFVS- 39 usage_00918.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_00919.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_00921.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_01317.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_01369.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_01391.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFTL- 39 usage_01392.pdb 1 SYRDIDPSNADVYAYTRSQ-D--------GETYLVVVNFKAEPRSFT-- 38 V aY R LvV N e f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################