################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:50:12 2021 # Report_file: c_1269_7.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00418.pdb # 2: usage_00483.pdb # 3: usage_00690.pdb # 4: usage_00728.pdb # 5: usage_00805.pdb # 6: usage_00806.pdb # 7: usage_00941.pdb # 8: usage_00942.pdb # # Length: 60 # Identity: 2/ 60 ( 3.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 60 ( 35.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/ 60 ( 53.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00418.pdb 1 GIPWMEYNFFGPTKTIE--SLRAIAAKFDES-IQKKCEEVIAK----------------- 40 usage_00483.pdb 1 QIPWMEYNFFGPTKIAE--SLRKIADQFDDT-IRANAEAVIARYEGQMAAIIAKYRPRLE 57 usage_00690.pdb 1 GIPWMEYNFFGPTKTIE--SLRAIAAKFDES-IQKKCEEVIAKY---------------- 41 usage_00728.pdb 1 --MKTFALQ--------GDTLDAICVRYY--GRTEGVVETVLAA---------------- 32 usage_00805.pdb 1 GIPWMEYNFFGPTKTIE--SLRAIAAKFDES-IQKKCEEVIAK----------------- 40 usage_00806.pdb 1 GIPWMEYNFFGPTKTIE--SLRAIAAKFDES-IQKKCEEVIAK----------------- 40 usage_00941.pdb 1 GIPWMEYNFFGPTKTIE--SLRAIAAKFDES-IQKKCEEVIAK----------------- 40 usage_00942.pdb 1 GIPWMEYNFFGPTKTIE--SLRAIAAKFDES-IQKKCEEVIAK----------------- 40 pwmeynf sLraIa fd i eevia #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################