################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:57 2021 # Report_file: c_1270_25.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00074.pdb # 2: usage_00200.pdb # 3: usage_00254.pdb # 4: usage_00364.pdb # 5: usage_00438.pdb # 6: usage_00719.pdb # 7: usage_00757.pdb # 8: usage_00895.pdb # 9: usage_01101.pdb # 10: usage_01130.pdb # 11: usage_01131.pdb # 12: usage_01147.pdb # 13: usage_01166.pdb # # Length: 44 # Identity: 16/ 44 ( 36.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 44 ( 72.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 44 ( 11.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00074.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACK- 43 usage_00200.pdb 1 LLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMAC-- 42 usage_00254.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK 44 usage_00364.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK 44 usage_00438.pdb 1 ILGIDVWEHAYYLRYQNKRADYLTTIWDVINWEEVSARYEKALK 44 usage_00719.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK 44 usage_00757.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACK- 43 usage_00895.pdb 1 LFGIDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ 44 usage_01101.pdb 1 LLGIDVAEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACK- 43 usage_01130.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACK- 43 usage_01131.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACK- 43 usage_01147.pdb 1 LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERY----- 39 usage_01166.pdb 1 LVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEK--- 41 l GIDVwEHAYyLqYkNvRpdYl iW viNW v ery #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################