################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:33 2021 # Report_file: c_0740_21.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00289.pdb # 2: usage_00554.pdb # 3: usage_00555.pdb # 4: usage_00557.pdb # 5: usage_00740.pdb # 6: usage_00810.pdb # 7: usage_00874.pdb # 8: usage_00895.pdb # # Length: 66 # Identity: 11/ 66 ( 16.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 66 ( 31.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 66 ( 15.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00289.pdb 1 EACFFVSIYNSPKSKLGKAVQLVFKITQHIRDKILIESIVELLNCGRVEVRKS---NEAC 57 usage_00554.pdb 1 DGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSR---GPWL 57 usage_00555.pdb 1 DGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSR---GPWL 57 usage_00557.pdb 1 DGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSR---GPWL 57 usage_00740.pdb 1 EGCFFVNLIKS-KSKLGVQVQLVFSITQHIKDKNLMNSLITYLGCGYIKEKNKSEFS-WL 58 usage_00810.pdb 1 DGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSR---GPWL 57 usage_00874.pdb 1 EGCFSVVV----TSKLGEAVKLSFILTQSNRDEYLIKSLIEYLGCGNTSLDPR---G-TI 52 usage_00895.pdb 1 EGSFYIRIAKNSTLKTGYQVQSVFQITQDTRDIELMKNLISYLNCGNIRIRKT---CVDL 57 g F K G lvF iTQ rD L sli yL CG usage_00289.pdb 58 DFTVTS 63 usage_00554.pdb 58 YYTVTN 63 usage_00555.pdb 58 YYTVTN 63 usage_00557.pdb 58 YYTVTN 63 usage_00740.pdb 59 DFVVTK 64 usage_00810.pdb 58 YYTVTN 63 usage_00874.pdb 53 DFKVTN 58 usage_00895.pdb 58 VVTN-- 61 v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################