################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:02 2021 # Report_file: c_1330_31.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00044.pdb # 2: usage_00045.pdb # 3: usage_00046.pdb # 4: usage_00133.pdb # 5: usage_00374.pdb # 6: usage_00669.pdb # 7: usage_00782.pdb # # Length: 65 # Identity: 23/ 65 ( 35.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 65 ( 56.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 28/ 65 ( 43.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00044.pdb 1 -PRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAV-DTENIRRVFNDCRDIIQRMHLR 58 usage_00045.pdb 1 --------------FLRISTASGDGRHYCYPHFTCAV-DTENIRRVFNDCRDIIQRMHLR 45 usage_00046.pdb 1 DPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAV-DTENIRRVFNDCRDIIQRMHLR 59 usage_00133.pdb 1 --------------FLRISTASGDGRHYCYPHFTCAV-DTENIRRVFNDCRDIIQR---- 41 usage_00374.pdb 1 DPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAV-DTENIRRVFNDCRDI------- 52 usage_00669.pdb 1 DPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAV-DTENIRRVFNDCRDII------ 53 usage_00782.pdb 1 DPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTC-TENARRIFNDCRDIIQRMHLRQ-Y 58 FLRISTASGDGRHYCYPHFTC v dtenIrrvfnDcrdi usage_00044.pdb 59 -QYEL 62 usage_00045.pdb 46 -Q--- 46 usage_00046.pdb 60 -Q--- 60 usage_00133.pdb ----- usage_00374.pdb ----- usage_00669.pdb ----- usage_00782.pdb 59 E---- 59 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################