################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:33:15 2021 # Report_file: c_0663_9.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00104.pdb # 2: usage_00106.pdb # 3: usage_00108.pdb # 4: usage_00109.pdb # 5: usage_00174.pdb # 6: usage_00175.pdb # 7: usage_00176.pdb # 8: usage_00177.pdb # 9: usage_00178.pdb # 10: usage_00256.pdb # 11: usage_00257.pdb # # Length: 52 # Identity: 41/ 52 ( 78.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 52 ( 78.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 52 ( 9.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00104.pdb 1 APFTRRIVGRDGLCVDVRNGYDTDGTPIQLWPCGTQRNQQWTFYNDKTIRS- 51 usage_00106.pdb 1 APFTRRIVGRDGLCVDVRNGYDTDGTPIQLWPCGTQRNQQWTFYNDKTIRS- 51 usage_00108.pdb 1 APFTRRIVGRDGLCVDVRNGYDTDGTPIQLWPCGTQRNQQWTFYNDKTIRS- 51 usage_00109.pdb 1 APFTRRIVGRDGLCVDVRNGYDTDGTPIQLWPCGTQRNQQWTFYNDKTIRS- 51 usage_00174.pdb 1 TSFTRNIVGRDGLCVDVRNGYDTDGTPLQLWPCGTQRNQRWTFDSDDTIRSM 52 usage_00175.pdb 1 ----RNIVGRDGLCVDVRNGYDTDGTPLQLWPCGTQRNQRWTFDSDDTIRSM 48 usage_00176.pdb 1 TSFTRNIVGRDGLCVDVRNGYDTDGTPLQLWPCGTQRNQRWTFDSDDTIRSM 52 usage_00177.pdb 1 TSFTRNIVGRDGLCVDVRNGYDTDGTPLQLWPCGTQRNQRWTFDSDDTIRSM 52 usage_00178.pdb 1 TSFTRNIVGRDGLCVDVRNGYDTDGTPLQLWPCGTQRNQRWTFDSDDTIRSM 52 usage_00256.pdb 1 TSFTRNIVGRDGLCVDVRNGYDTDGTPLQLWPCGTQRNQRWTFDSDDTIRSM 52 usage_00257.pdb 1 ----RNIVGRDGLCVDVRNGYDTDGTPLQLWPCGTQRNQRWTFDSDDTIRSM 48 R IVGRDGLCVDVRNGYDTDGTP QLWPCGTQRNQ WTF D TIRS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################