################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:52 2021 # Report_file: c_1492_170.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_01271.pdb # 2: usage_01373.pdb # 3: usage_01961.pdb # 4: usage_01970.pdb # 5: usage_01971.pdb # 6: usage_01976.pdb # 7: usage_01977.pdb # # Length: 42 # Identity: 3/ 42 ( 7.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 42 ( 40.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 42 ( 19.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01271.pdb 1 LRIVTHLAICLDIINPGSV-----EEVDKSKLITTYISLLKL 37 usage_01373.pdb 1 ---KPAYKFKSLVSTLENILKGYDNQVIMNASLQQLIEVLRN 39 usage_01961.pdb 1 --TKPAYKFKSLVSTLENILKGYDNQVIMNASLQQLIEVLRN 40 usage_01970.pdb 1 --SKPAQRFAVLYGTMCDILNGYDNQVVMQQKLKEFIEVLRD 40 usage_01971.pdb 1 --SKPAQRFAVLYGTMCDILNGYDNQVVMQQKLKEFIEVLRD 40 usage_01976.pdb 1 --SKPAQRFAVLYGTMCDILNGYDNQVVMQQKLKEFIEVLRD 40 usage_01977.pdb 1 --SKPAQRFAVLYGTMCDILNGYDNQVVMQQKLKEFIEVLRD 40 kpa f l t i nqV m l IevLr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################