################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:24:52 2021 # Report_file: c_0699_51.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00602.pdb # 2: usage_00603.pdb # 3: usage_00604.pdb # 4: usage_00605.pdb # 5: usage_00606.pdb # 6: usage_00607.pdb # 7: usage_00608.pdb # 8: usage_00609.pdb # 9: usage_01261.pdb # 10: usage_01368.pdb # # Length: 65 # Identity: 1/ 65 ( 1.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 65 ( 20.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 30/ 65 ( 46.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00602.pdb 1 -SFLIQYQES-EK--EAINLTVPGSERSYDLTGLKPGTEYTVSIYGV-KGGHRSNPLSAE 55 usage_00603.pdb 1 DSFLIQYQES-EKVGEAINLTVPGSERSYDLTGLKPGTEYTVSIYGV-KGGHRSNPLSAE 58 usage_00604.pdb 1 ---LIQYQES-EKVGEAINLTVPGSERSYDLTGLKPGTEYTVSIYGV-KGGHRSN----- 50 usage_00605.pdb 1 -SFLIQYQES-EKVGEAINLTVPGSERSYDLTGLKPGTEYTVSIYGV-KGGHRSNPLSAE 57 usage_00606.pdb 1 -SFLIQYQES-VG--EAINLTVPGSERSYDLTGLKPGTEYTVSIYGV-KGGHRSNPLSAE 55 usage_00607.pdb 1 -SFLIQYQES-EKVGEAINLTVPGSERSYDLTGLKPGTEYTVSIYGV-KGGHRSNPLSAE 57 usage_00608.pdb 1 -SFLIQYQES------AINLTVPGSERSYDLTGLKPGTEYTVSIYGV-KGGHRSNPLSAE 52 usage_00609.pdb 1 ---LIQYQESEKV--EAINLTVPGSERSYDLTGLKPGTEYTVSIYGV-KGGHRSNPLSAE 54 usage_01261.pdb 1 LFYHLELQVN-RT---YQMHLGG-KQREYEFFGLTPDTEFLGTIMIC-VPT--WAKESA- 51 usage_01368.pdb 1 --VAIQYK--------NKTRNN-----TLAS-TWQPGDPEWYTVSVPGADGF-LRTVNNT 43 iqyq y gl Pgte i g usage_00602.pdb ----- usage_00603.pdb ----- usage_00604.pdb ----- usage_00605.pdb ----- usage_00606.pdb ----- usage_00607.pdb ----- usage_00608.pdb ----- usage_00609.pdb 55 FTTGG 59 usage_01261.pdb ----- usage_01368.pdb 44 FI--- 45 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################