################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:04 2021 # Report_file: c_0907_28.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00357.pdb # 2: usage_00358.pdb # 3: usage_00617.pdb # 4: usage_00618.pdb # 5: usage_00776.pdb # 6: usage_00777.pdb # 7: usage_00778.pdb # # Length: 47 # Identity: 6/ 47 ( 12.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 47 ( 23.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 47 ( 19.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00357.pdb 1 --TKVSHPA----LLSDGKWHTVKTEYIKRKAFMTVDGQESPSVTV- 40 usage_00358.pdb 1 --TKVSHPA----LLSDGKWHTVKTEYIKRKAFMTVDGQESPSVTV- 40 usage_00617.pdb 1 GDTSTMIPT----KINDGQWHKIKIVRVKQEGILYVDDASSQTI--- 40 usage_00618.pdb 1 GRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQS-- 45 usage_00776.pdb 1 GDTSTMIPT----KINDGQWHKIKIVRVKQEGILYVDDASSQTISPK 43 usage_00777.pdb 1 GDTSTMIPT----KINDGQWHKIKIVRVKQEGILYVDDASSQTISP- 42 usage_00778.pdb 1 GDTSTMIPT----KINDGQWHKIKIVRVKQEGILYVDDASSQTISPK 43 t p dG WH k K VD s #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################