################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:43:49 2021
# Report_file: c_1228_46.html
################################################################################################
#====================================
# Aligned_structures: 7
#   1: usage_00001.pdb
#   2: usage_00135.pdb
#   3: usage_00162.pdb
#   4: usage_00326.pdb
#   5: usage_00327.pdb
#   6: usage_00328.pdb
#   7: usage_00786.pdb
#
# Length:         63
# Identity:        8/ 63 ( 12.7%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     22/ 63 ( 34.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           36/ 63 ( 57.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00001.pdb         1  DKIIKFEGCYHGHADMFLVKAGSGVAT-LGLPSSPGVPKKTTANTLTTPYNDLEAVKALF   59
usage_00135.pdb         1  EKVIKFEGCYHGH-----------------------------AATLTAPYNDLEAVSRLF   31
usage_00162.pdb         1  RMILRFEG--------------------------------TTANTLLIRPDDIEGMREVF   28
usage_00326.pdb         1  DKIIKFEGCYHGHADM--------------------------ANTLTTPYNDLEAVKALF   34
usage_00327.pdb         1  DKIIKFEG-----------------------------------NTLTTPYNDLEAVKALF   25
usage_00328.pdb         1  DKIIKFEGCYHGH------------------------------NTLTTPYNDLEAVKALF   30
usage_00786.pdb         1  DKIIKFEGCYHGHADMFLVK-------AG-LPSSPGVPKKTTANTLTTPYNDLEAVKALF   52
                            kiikFEG                                   nTLt pynDlEav  lF

usage_00001.pdb        60  AE-   61
usage_00135.pdb        32  EQY   34
usage_00162.pdb        29  AN-   30
usage_00326.pdb        35  AEN   37
usage_00327.pdb        26  AEN   28
usage_00328.pdb        31  AEN   33
usage_00786.pdb        53  AEN   55
                           a  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################