################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:07 2021 # Report_file: c_1062_97.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00217.pdb # 2: usage_00481.pdb # 3: usage_00667.pdb # 4: usage_00668.pdb # 5: usage_00669.pdb # 6: usage_00670.pdb # 7: usage_00804.pdb # 8: usage_00805.pdb # 9: usage_00806.pdb # 10: usage_00807.pdb # # Length: 80 # Identity: 8/ 80 ( 10.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 80 ( 56.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 80 ( 17.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00217.pdb 1 TEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHV-V-CHGIPNEKPLKEGDILNV 58 usage_00481.pdb 1 -REVAAKVEYLMKMNG-AEK-------PAFDTIIASGYRSALPHGVASDKRIERGDLVVI 51 usage_00667.pdb 1 TNSLNDLCHNFITS-HNAIPAPLNYKGFPKSICTSINHV-V-CHGIPNDKPLKNGDIVNI 57 usage_00668.pdb 1 TNSLNDLCHNFITS-HNAIPAPLNYKGFPKSICTSINHV-V-CHGIPNDKPLKNGDIVNI 57 usage_00669.pdb 1 TNSLNDLCHNFITS-HNAIPAPLNYKGFPKSICTSINHV-V-CHGIPNDKPLKNGDIVNI 57 usage_00670.pdb 1 TNSLNDLCHNFITS-HNAIPAPLNYKGFPKSICTSINHV-V-CHGIPNDKPLKNGDIVNI 57 usage_00804.pdb 1 TEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHV-V-CHGIPNEKPLKEGDILNV 58 usage_00805.pdb 1 TEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHV-V-CHGIPNEKPLKEGDILNV 58 usage_00806.pdb 1 TEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHV-V-CHGIPNEKPLKEGDILNV 58 usage_00807.pdb 1 TEELDRICHDYIVNEQKAIPAPLNYKGFPKSICTSINHV-V-CHGIPNEKPLKEGDILNV 58 l ch i Aip fpksictsinhv v cHGipn Kplk GDi n usage_00217.pdb 59 DITVIKDGYHGDTSKMFLVG 78 usage_00481.pdb 52 DLGALYQHYNSDITRTIV-- 69 usage_00667.pdb 58 DVTVILDGWYGDTSRMYYVG 77 usage_00668.pdb 58 DVTVILDGWYGDTSRMYYVG 77 usage_00669.pdb 58 DVTVILDGWYGDTSRMYYVG 77 usage_00670.pdb 58 DVTVILDGWYGDTSRMYYVG 77 usage_00804.pdb 59 DITVIKDGYHGDTSKMFLVG 78 usage_00805.pdb 59 DITVIKDGYHGDTSKMFLVG 78 usage_00806.pdb 59 DITVIKDGYHGDTSKMFLVG 78 usage_00807.pdb 59 DITVIKDGYHGDTSKMFLVG 78 D tvi dg gDts m #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################