################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:38:57 2021
# Report_file: c_1036_19.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00023.pdb
#   2: usage_00088.pdb
#   3: usage_00128.pdb
#   4: usage_00129.pdb
#   5: usage_00130.pdb
#   6: usage_00131.pdb
#   7: usage_00331.pdb
#   8: usage_00332.pdb
#   9: usage_00409.pdb
#  10: usage_00410.pdb
#  11: usage_00411.pdb
#
# Length:         38
# Identity:        6/ 38 ( 15.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     18/ 38 ( 47.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            8/ 38 ( 21.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00023.pdb         1  -MRVLVTGGAGFIGSHIVEDLLAR------GLEVAVLD   31
usage_00088.pdb         1  SSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVA-   37
usage_00128.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
usage_00129.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
usage_00130.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
usage_00131.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
usage_00331.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
usage_00332.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
usage_00409.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
usage_00410.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
usage_00411.pdb         1  RNVALITGITGQDGSYLAEFLLEK------GYEVHGI-   31
                             vaLitG tG  Gs laE Ll        g ev    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################