################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:06 2021 # Report_file: c_1100_42.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00013.pdb # 2: usage_00154.pdb # 3: usage_00155.pdb # 4: usage_00156.pdb # 5: usage_00157.pdb # 6: usage_00158.pdb # 7: usage_00369.pdb # 8: usage_00595.pdb # 9: usage_00596.pdb # 10: usage_00597.pdb # 11: usage_00598.pdb # # Length: 43 # Identity: 20/ 43 ( 46.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 43 ( 93.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 43 ( 7.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00013.pdb 1 SAGSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 43 usage_00154.pdb 1 SAGSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 43 usage_00155.pdb 1 SAGSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 43 usage_00156.pdb 1 --GSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 41 usage_00157.pdb 1 --GSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 41 usage_00158.pdb 1 --GSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 41 usage_00369.pdb 1 --GAMAASRGMESIGFWKKLAAHPSYDSFWQQQAMDKMLAQH- 40 usage_00595.pdb 1 --GSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 41 usage_00596.pdb 1 --GSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 41 usage_00597.pdb 1 -AGSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 42 usage_00598.pdb 1 --GSFATQAGLDQYPFWQRMHAHPAYDAFWQGQALDKILAQRK 41 GsfAtqaGldqypFWqrmhAHPaYDaFWQgQAlDKiLAQr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################