################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:01:45 2021 # Report_file: c_0688_28.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00058.pdb # 2: usage_00059.pdb # 3: usage_00060.pdb # 4: usage_00061.pdb # 5: usage_00062.pdb # 6: usage_00063.pdb # 7: usage_00064.pdb # 8: usage_00065.pdb # 9: usage_00067.pdb # 10: usage_00136.pdb # 11: usage_00137.pdb # 12: usage_00469.pdb # 13: usage_00470.pdb # # Length: 52 # Identity: 45/ 52 ( 86.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 52 ( 86.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 52 ( 13.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00058.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG 52 usage_00059.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV- 51 usage_00060.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE--- 49 usage_00061.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG 52 usage_00062.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRL------- 45 usage_00063.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE--- 49 usage_00064.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE--- 49 usage_00065.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE--- 49 usage_00067.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRL------- 45 usage_00136.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE--- 49 usage_00137.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE--- 49 usage_00469.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE--- 49 usage_00470.pdb 1 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE--- 49 KYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################