################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:02:55 2021 # Report_file: c_0972_24.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00025.pdb # 2: usage_00028.pdb # 3: usage_00050.pdb # 4: usage_00071.pdb # 5: usage_00132.pdb # 6: usage_00139.pdb # 7: usage_00178.pdb # 8: usage_00179.pdb # 9: usage_00195.pdb # 10: usage_00241.pdb # 11: usage_00242.pdb # 12: usage_00252.pdb # 13: usage_00261.pdb # # Length: 42 # Identity: 10/ 42 ( 23.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 42 ( 26.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 42 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 GSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC-- 40 usage_00028.pdb 1 ----RFYFDSETGKCTPFIYGGCGGNGNNFETLHQCRAIC-- 36 usage_00050.pdb 1 ----RFYFDSETGKCTPFIYGGCGGNGNNFETLHQCRAI--- 35 usage_00071.pdb 1 ----RYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNI--- 35 usage_00132.pdb 1 ----KWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA- 37 usage_00139.pdb 1 ----KWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKV--- 35 usage_00178.pdb 1 ----MWFHNPETEKCEVFIYGGCHGNANRFATETECQEVCDR 38 usage_00179.pdb 1 ----RYYYDYEDGECKEFIYGGCEGNANNFETKESCENAC-- 36 usage_00195.pdb 1 VRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECEST--- 39 usage_00241.pdb 1 ----SFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCA- 37 usage_00242.pdb 1 ----SFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTC-- 36 usage_00252.pdb 1 ----RWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYCMAVC-- 36 usage_00261.pdb 1 ----SFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCA- 37 C F YGGC GN N f C #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################