################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:43 2021 # Report_file: c_1283_18.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00108.pdb # 2: usage_00560.pdb # 3: usage_00561.pdb # 4: usage_00562.pdb # 5: usage_00750.pdb # 6: usage_00781.pdb # 7: usage_01399.pdb # 8: usage_01562.pdb # # Length: 77 # Identity: 1/ 77 ( 1.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 77 ( 27.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 56/ 77 ( 72.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00108.pdb 1 -----------------------------SQSGTS--QAAAHVAGIAAMMLSAEPELTLA 29 usage_00560.pdb 1 GTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTS--QAAAHVAGIAAMMLSAEPELTLA 58 usage_00561.pdb 1 -----------------------------SQSGTS--QAAAHVAGIAAMMLSAEPELTLA 29 usage_00562.pdb 1 -----------------------------SQSGTS--QAAAHVAGIAAMMLSAEPELTLA 29 usage_00750.pdb 1 -----------------------------SQSGTS--QAAAHVAGIAAMMLSAEPELTLA 29 usage_00781.pdb 1 -----------------------------SQSGTS--QAAAHVAGIAAMMLSAEPELTLA 29 usage_01399.pdb 1 -----------------------------SQSGTS--QAAAHVAGIAAMMLSAEPELTLA 29 usage_01562.pdb 1 -----------------------------------ETRGWAAAVE---VIAGLG------ 16 qaaAhvag mmlsae usage_00108.pdb 30 E-LRQRLIHFS------ 39 usage_00560.pdb 59 E-LRQRLIH-------- 66 usage_00561.pdb 30 E-LRQRLIH-------- 37 usage_00562.pdb 30 E-LRQRLIH-------- 37 usage_00750.pdb 30 E-LRQRLIH-------- 37 usage_00781.pdb 30 E-LRQRLIHFS------ 39 usage_01399.pdb 30 E-LRQRLIHFS------ 39 usage_01562.pdb 17 -LSLDTALVYFDLRRKG 32 lrqrlih #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################