################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:40 2021 # Report_file: c_0792_41.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00036.pdb # 2: usage_00071.pdb # 3: usage_00209.pdb # 4: usage_00210.pdb # 5: usage_00225.pdb # 6: usage_00233.pdb # 7: usage_00344.pdb # 8: usage_00356.pdb # 9: usage_00367.pdb # # Length: 80 # Identity: 24/ 80 ( 30.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 80 ( 36.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 80 ( 21.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00036.pdb 1 LSSRVRTGRSIRGLSLPPACSRAERREVENVVVTALAGLKGDLSGKYYSLTNMSERDQQQ 60 usage_00071.pdb 1 --SRVRTGRSIRGFCLPPHCSRGERRAIEKLSVEALGSLGGDLKGKYYALRNMTDAEQQQ 58 usage_00209.pdb 1 -SCRIRTGRGIRGLCYPPSCTRGERREVERVITTALAGLSGDLSGTYYPLSKMTPEQENQ 59 usage_00210.pdb 1 -SCRIRTGRGIRGLCYPPSCTRGERREVERVITTALAGLSGDLSGTYYPLSKMTPEQENQ 59 usage_00225.pdb 1 KSCRIRCGRSVKGVCLPPAMSRAERRLVEKVVSDALGGLKGDLAGKYYPLTTMNEKDQEQ 60 usage_00233.pdb 1 --SRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQ 58 usage_00344.pdb 1 --SRVRTGKSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQ 58 usage_00356.pdb 1 --SRVRTGRSIKGIALPPHCSRGERRLVEKLCIDGLATLTGEFQGKYYPLSSMSDAEQQQ 58 usage_00367.pdb 1 LSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQ 60 R RtGr i G PP c R ERR E aL L G G YY L M Q usage_00036.pdb 61 LIDDHFLFDKPVSPLLTCAG 80 usage_00071.pdb 59 LIDDHFLFDKPVSPLLLASG 78 usage_00209.pdb 60 LIADHFLFQKPTGHLMVNSA 79 usage_00210.pdb 60 LIADHFLFQKPTGHLMVNSA 79 usage_00225.pdb 61 LIEDHFLFEKPTGALLTTSG 80 usage_00233.pdb 59 LIDDHFLFDKPVSPLLLASG 78 usage_00344.pdb 59 LIDDHFLFDKPVSPLLLASG 78 usage_00356.pdb 59 LIDDH--------------- 63 usage_00367.pdb 61 LIDDHFLFDKPVSPLLLASG 80 LI DH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################