################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:34 2021 # Report_file: c_1480_83.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01861.pdb # 2: usage_01862.pdb # 3: usage_01863.pdb # 4: usage_01864.pdb # 5: usage_02021.pdb # 6: usage_02298.pdb # 7: usage_02299.pdb # 8: usage_02732.pdb # 9: usage_03265.pdb # # Length: 37 # Identity: 8/ 37 ( 21.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 37 ( 35.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 37 ( 10.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01861.pdb 1 -QRQYNQCLRDYGWYLRLVTYGVLAGNKEPIETTG-- 34 usage_01862.pdb 1 -QRQYNQCLRDYGWYLRLVTYGVLAGNKEPIETTG-- 34 usage_01863.pdb 1 -QRQYNQCLRDYGWYLRLVTYGVLAGNKEPIETTG-- 34 usage_01864.pdb 1 -QRQYNQCLRDYGWYLRLVTYGVLAGNKEPIETTG-- 34 usage_02021.pdb 1 -QEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIA 36 usage_02298.pdb 1 -QRQYNQCLRDYGWYLRLVTYGVLAGNKEPIETTG-- 34 usage_02299.pdb 1 -QRQYNQCLRDYGWYLRLVTYGVLAGNKEPIETTG-- 34 usage_02732.pdb 1 TPEGKAKCARDIGYYLRMITYCLVAGGTGPMDEYL-- 35 usage_03265.pdb 1 GQEMTATCLRDLDYYLRLITYGIVAGDVTPIEEI--- 34 q C RD YlRl tY aG P #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################