################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:54:43 2021 # Report_file: c_1325_14.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00030.pdb # 2: usage_00031.pdb # 3: usage_00032.pdb # 4: usage_00076.pdb # 5: usage_00077.pdb # 6: usage_00078.pdb # 7: usage_00110.pdb # 8: usage_00111.pdb # 9: usage_00133.pdb # 10: usage_00134.pdb # 11: usage_00154.pdb # 12: usage_00181.pdb # 13: usage_00207.pdb # 14: usage_00208.pdb # 15: usage_00209.pdb # 16: usage_00335.pdb # 17: usage_00336.pdb # # Length: 40 # Identity: 38/ 40 ( 95.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 40 ( 95.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 40 ( 5.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00030.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00031.pdb 1 DTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 40 usage_00032.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00076.pdb 1 DTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 40 usage_00077.pdb 1 DTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 40 usage_00078.pdb 1 DTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 40 usage_00110.pdb 1 DTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 40 usage_00111.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00133.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00134.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00154.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00181.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00207.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00208.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00209.pdb 1 DTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEAL- 39 usage_00335.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 usage_00336.pdb 1 -TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS 39 TEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEAL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################