################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:54 2021 # Report_file: c_0970_24.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00428.pdb # 2: usage_00429.pdb # 3: usage_00430.pdb # 4: usage_00431.pdb # 5: usage_00461.pdb # 6: usage_01189.pdb # 7: usage_01244.pdb # 8: usage_01245.pdb # 9: usage_01246.pdb # 10: usage_01247.pdb # # Length: 69 # Identity: 55/ 69 ( 79.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/ 69 ( 79.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 69 ( 20.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00428.pdb 1 MRTIIALETHDVRFPTSRE--------PDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 52 usage_00429.pdb 1 MRTIIALETHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 60 usage_00430.pdb 1 ------LETHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 54 usage_00431.pdb 1 -----ALETHDVRFPTSRE---SDAMNPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 52 usage_00461.pdb 1 -----ALETHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 55 usage_01189.pdb 1 -----ALETHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 55 usage_01244.pdb 1 -RTIIALETHDVRFPTSRE-------NPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 52 usage_01245.pdb 1 -RTIIALETHDVRFPTSRELDG-SDANPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 58 usage_01246.pdb 1 -RTIIALETHDVRFPTSRELDG-SDANPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 58 usage_01247.pdb 1 -RTIIALETHDVRFPTSRE----SDANPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN 55 LETHDVRFPTSRE PDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGN usage_00428.pdb 53 DVQTAAVAA 61 usage_00429.pdb 61 DVQTAAVAA 69 usage_00430.pdb 55 DVQTAAVAA 63 usage_00431.pdb 53 DVQTAAVAA 61 usage_00461.pdb 56 DVQTAAVAA 64 usage_01189.pdb 56 DVQTAAVAA 64 usage_01244.pdb 53 DVQTAAVAA 61 usage_01245.pdb 59 DVQTAAVAA 67 usage_01246.pdb 59 DVQTAAVAA 67 usage_01247.pdb 56 DVQTAAVAA 64 DVQTAAVAA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################