################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:48 2021 # Report_file: c_0646_19.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00313.pdb # 2: usage_00379.pdb # 3: usage_00381.pdb # 4: usage_00382.pdb # 5: usage_00383.pdb # 6: usage_00424.pdb # 7: usage_00427.pdb # 8: usage_00430.pdb # 9: usage_00433.pdb # 10: usage_00435.pdb # 11: usage_00542.pdb # 12: usage_00554.pdb # 13: usage_00557.pdb # # Length: 48 # Identity: 40/ 48 ( 83.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 40/ 48 ( 83.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 48 ( 8.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00313.pdb 1 -NVTFEGRDLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMK 47 usage_00379.pdb 1 --VTFEGRDLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQ-- 44 usage_00381.pdb 1 --VTFEGRDLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQ-- 44 usage_00382.pdb 1 -NVTFEGRDLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMK 47 usage_00383.pdb 1 -NVTFEGRDLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMK 47 usage_00424.pdb 1 INVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSLKMW 48 usage_00427.pdb 1 INVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSLKMW 48 usage_00430.pdb 1 INVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSLKMW 48 usage_00433.pdb 1 -NVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSLKMW 47 usage_00435.pdb 1 -NVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSLKMW 47 usage_00542.pdb 1 -NVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSLKMW 47 usage_00554.pdb 1 INVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSLKMW 48 usage_00557.pdb 1 INVTFEGRDLSFSEDGYQMHPKLVIILLNQERKWERVGKYKDRSLKMW 48 VTFEGRDLSFSEDGYQMHPKLVIILLN ERKWERVGK KD SL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################