################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:48 2021 # Report_file: c_0774_28.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00027.pdb # 2: usage_00033.pdb # 3: usage_00071.pdb # 4: usage_00072.pdb # 5: usage_00096.pdb # # Length: 72 # Identity: 6/ 72 ( 8.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 72 ( 19.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 72 ( 31.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00027.pdb 1 DCLLIDLDGTVFCGRQPTGGAVQSLSQV--R-SRKLFVTNNASRSADEVAAHLCELGFTA 57 usage_00033.pdb 1 ELFIL-DDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRNGVDVP 59 usage_00071.pdb 1 KAVLVDLNGTLHI---AVPGAQEALKRLRATS-VVRFVTNTTKETKKDLLERLKKLEFEI 56 usage_00072.pdb 1 KAVLVDLNGTLHIEDAAVPGAQEALKRLRATS-VVRFVTNTTKETKKDLLERLKKLEFEI 59 usage_00096.pdb 1 TAFIWDLDGT------LMPGAREVLAWADESGIQQFIYTHK----GNNAFTILKDLGVE- 49 l GT pGa e L f Tn L l usage_00027.pdb 58 TGEDVVTS---- 65 usage_00033.pdb 60 D-DAVVTS---- 66 usage_00071.pdb 57 SEDEIFTS---- 64 usage_00072.pdb 60 SEDEIFTS---- 67 usage_00096.pdb 50 --SYFTE-ILTS 58 t #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################