################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:12 2021 # Report_file: c_0581_69.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00395.pdb # 2: usage_00491.pdb # 3: usage_00492.pdb # 4: usage_00670.pdb # 5: usage_00671.pdb # # Length: 90 # Identity: 19/ 90 ( 21.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 90 ( 31.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 90 ( 15.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00395.pdb 1 EKVTVFRVTKNVAID-EATSLLHKWQFVAEELEEDFTLSVLGGAD----EKQVWLTMLGF 55 usage_00491.pdb 1 --VTVFQVHKGI--KEGAIDLVTKWQTVAPALPDDLMIRIMAMG--------QGAMFEAL 48 usage_00492.pdb 1 PKVTVFQVHKGI--KEGAIDLVTKWQTVAPALPDDLMIRIMAMG--------QGAMFEAL 50 usage_00670.pdb 1 ATVTVFTVTKTL--EQDGTKVLYKWEQIADKLDDDLFIRVIISPASKGNR-TISMSYQAQ 57 usage_00671.pdb 1 ATVTVFTVTKTL--EQDGTKVLYKWEQIADKLDDDLFIRVIISPASK-NR-TISMSYQAQ 56 VTVF V K KW A L dDl ir a usage_00395.pdb 56 HFGLKTVAKSTFDLLFPELGLVEEDYLEMS 85 usage_00491.pdb 49 YLGTCKDLVLLMTARFPELGMNATHCKEM- 77 usage_00492.pdb 51 YLGTCKDLVLLMTARFPELGMNATHCKEM- 79 usage_00670.pdb 58 FLGDSNRLLQVMQKSFPELGLTKKDCTEMS 87 usage_00671.pdb 57 FLGDSNRLLQVMQKSFPELGLTKKDCTEMS 86 lG l m FPELG c EM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################