################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:02:47 2021 # Report_file: c_0937_71.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00235.pdb # 2: usage_00265.pdb # 3: usage_00266.pdb # 4: usage_00424.pdb # 5: usage_00425.pdb # 6: usage_00426.pdb # 7: usage_00427.pdb # 8: usage_00428.pdb # 9: usage_00646.pdb # 10: usage_00647.pdb # 11: usage_01039.pdb # 12: usage_01111.pdb # 13: usage_01112.pdb # # Length: 42 # Identity: 15/ 42 ( 35.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 42 ( 35.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 42 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00235.pdb 1 NPKHIEVQVIGDEH---GNIVHLFERDCSVQRRHQKVVEVA- 38 usage_00265.pdb 1 --KHIEVQVIGDEH---GNIVHLFERDCSVQRRHQKVVEVA- 36 usage_00266.pdb 1 NPKHIEVQVIGDEH---GNIVHLFERDCSVQRRHQKVVEVA- 38 usage_00424.pdb 1 --RHVEIQVLADTH---GNAVYLAERDCSMQRRHQKVVEEA- 36 usage_00425.pdb 1 --RHVEIQVLADTH---GNAVYLAERDCSMQRRHQKVVEEA- 36 usage_00426.pdb 1 --RHVEIQVLADTH---GNAVYLAERDCSMQRRHQKVVEEA- 36 usage_00427.pdb 1 --RHVEIQVLADTH---GNAVYLAERDCSMQRRHQKVVEEA- 36 usage_00428.pdb 1 --RHVEIQVLADTH---GNAVYLAERDCSMQRRHQKVVEEA- 36 usage_00646.pdb 1 --RHIEVQVVAAPAGHQTHALAVGDRDCSMQRRYQKLIEIAP 40 usage_00647.pdb 1 DARHIEVQVVAAPAGHQTHALAVGDRDCSMQRRYQKLIEIAP 42 usage_01039.pdb 1 NPKHIEVQVIGDEH---GNIVHLFERDCSVQRRHQKVVEVA- 38 usage_01111.pdb 1 --RHVEIQVLADTH---GNAVYLAERDCSMQRRHQKVVEEA- 36 usage_01112.pdb 1 --RHVEIQVLADTH---GNAVYLAERDCSMQRRHQKVVEEA- 36 H E QV RDCS QRR QK E A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################