################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:34 2021 # Report_file: c_1007_46.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00002.pdb # 2: usage_00077.pdb # 3: usage_00152.pdb # 4: usage_00153.pdb # 5: usage_00209.pdb # 6: usage_00247.pdb # 7: usage_00282.pdb # 8: usage_00283.pdb # # Length: 63 # Identity: 21/ 63 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 63 ( 44.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 63 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00002.pdb 1 GIYAVGDVCG----KALLTPVAIAAGRKLAHRLFEY--KEDSKLDYNNIPTVVFSHPPIG 54 usage_00077.pdb 1 NIYAVGDCCMVKFYNVQLTPVAINAGRLLADRLFL---KKTRKTNYKLIPTVIFSHPPIG 57 usage_00152.pdb 1 -VYALGDITG----RDQLTPVAIAAGRRLAERLFDG--QSERKLDYDNIPTVVFAHPPLS 53 usage_00153.pdb 1 -VYALGDITG----RDQLTPVAIAAGRRLAERLFDG--QSERKLDYDNIPTVVFAHPPLS 53 usage_00209.pdb 1 GIYAVGDNTG----AVELTPVAVAAGRRLSERLFNN--KPDEHLDYSNIPTVVFSHPPIG 54 usage_00247.pdb 1 GIYAVGDVCG----KALLTPVAIAAGRKLAHRLFEY--KEDSKLDYNNIPTVVFSHPPIG 54 usage_00282.pdb 1 NIYSLGDVVG----KVELTPVAIAAGRKLSNRLFGPEKFRNDKLDYENVPSVIFSHPEAG 56 usage_00283.pdb 1 NIYSLGDVVG----KVELTPVAIAAGRKLSNRLFGPEKFRNDKLDYENVPSVIFSHPEAG 56 Y GD g LTPVAiaAGR L RLF kldY n P V F HP usage_00002.pdb 55 TVG 57 usage_00077.pdb 58 TI- 59 usage_00152.pdb 54 KVG 56 usage_00153.pdb 54 KVG 56 usage_00209.pdb 55 TVG 57 usage_00247.pdb 55 TVG 57 usage_00282.pdb 57 SIG 59 usage_00283.pdb 57 SIG 59 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################