################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:07 2021 # Report_file: c_1312_46.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00240.pdb # 2: usage_00320.pdb # 3: usage_00321.pdb # 4: usage_00322.pdb # 5: usage_00478.pdb # 6: usage_00651.pdb # 7: usage_00816.pdb # 8: usage_00974.pdb # 9: usage_00975.pdb # 10: usage_01027.pdb # 11: usage_01041.pdb # # Length: 43 # Identity: 28/ 43 ( 65.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 43 ( 65.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 43 ( 4.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00240.pdb 1 FMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVAQDT- 42 usage_00320.pdb 1 LMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDA- 42 usage_00321.pdb 1 LMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDA- 42 usage_00322.pdb 1 LMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDA- 42 usage_00478.pdb 1 -MDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDA- 41 usage_00651.pdb 1 -MDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDA- 41 usage_00816.pdb 1 -MDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDT- 41 usage_00974.pdb 1 LMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTG 43 usage_00975.pdb 1 LMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDT- 42 usage_01027.pdb 1 -MARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVAQDT- 41 usage_01041.pdb 1 -MDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDT- 41 M AFQYV NGGLDSEESYPY A E CKY P SVA D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################