################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:30:37 2021
# Report_file: c_1063_43.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00013.pdb
#   2: usage_00014.pdb
#   3: usage_00107.pdb
#   4: usage_00342.pdb
#   5: usage_00384.pdb
#   6: usage_00416.pdb
#
# Length:         64
# Identity:        2/ 64 (  3.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      4/ 64 (  6.2%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           28/ 64 ( 43.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00013.pdb         1  THRHAAVREIGEETGSPVKLGPYLCEVE------------------------HTLYWAQP   36
usage_00014.pdb         1  THRHAAVREIGEETGSPVKLGPYLCEVEYPLSEEGKKTRHSHDC---TADTKHTLYWAQP   57
usage_00107.pdb         1  KPEETAVREVWEETGVKGEILDYIGEIHYWYT----------LKGE--RIFKTVKYYLMK   48
usage_00342.pdb         1  TLEQAVAREVMEQSGIKVKNLRYVTSQPWPF------------------PQSLMTAFMAE   42
usage_00384.pdb         1  SLEQTVLRKLAEKTAVVPPYIEQLCTVGNNS-R---------D---AR-GWSVTVCYTAL   46
usage_00416.pdb         1  TPEQAVVRELQEEVGITPQHFSLFEKLEYEF----------------PDRHITLWFWLVE   44
                                  Re  E  g                                             

usage_00013.pdb        37  -IS-   38
usage_00014.pdb        58  -IS-   59
usage_00107.pdb        49  -YKE   51
usage_00342.pdb        43  YDS-   45
usage_00384.pdb        47  -MS-   48
usage_00416.pdb            ----     
                               


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################