################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:01 2021 # Report_file: c_1370_153.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00309.pdb # 2: usage_00796.pdb # 3: usage_00801.pdb # 4: usage_00823.pdb # 5: usage_01079.pdb # 6: usage_01183.pdb # # Length: 84 # Identity: 6/ 84 ( 7.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 84 ( 15.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 30/ 84 ( 35.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00309.pdb 1 ---------------------YKDFIEETSNDLIKNI----DNKDIISEYAVRLPVNIIS 35 usage_00796.pdb 1 ---------------PRTISDLEPRIRDVTRSLLADA---GESFDLVDVLAFPLPVTIVA 42 usage_00801.pdb 1 --------------TPRTISDLEPRIRDVTRSLLADA---GESFDLVDVLAFPLPVTIVA 43 usage_00823.pdb 1 PEHSRLRRLVVKAFTARRAESLRPRAREIAHELVDQMAATGQPADLVAMFARQLPVRVIC 60 usage_01079.pdb 1 ---------------------PVDFVREVTVKLLSEL---DEEFDVIESFAIPLPILVIS 36 usage_01183.pdb 1 --------------TPRVMKQWEPRIQEITDELIQKFQ-GRSEFDLVHDFSYPLPVIVIS 45 L D a LPv usage_00309.pdb 36 KILGIPDSDMPLFKLWSDYIIG-- 57 usage_00796.pdb 43 ELLGLPPMDHEQFG-DWSGALVD- 64 usage_00801.pdb 44 ELLGLPPMDHEQFGDWSGALVD-- 65 usage_00823.pdb 61 ELLGVPSADHDRFTRWSGAFL--- 81 usage_01079.pdb 37 KMLGINP-DVKKVKDWSDLVALRL 59 usage_01183.pdb 46 ELLGVPSAHMEQFKAWSDLLV--- 66 LG p d f ws #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################