################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:14:09 2021
# Report_file: c_1393_134.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_00054.pdb
#   2: usage_00055.pdb
#   3: usage_00121.pdb
#   4: usage_00122.pdb
#   5: usage_00123.pdb
#   6: usage_00126.pdb
#   7: usage_00627.pdb
#   8: usage_00629.pdb
#   9: usage_00631.pdb
#  10: usage_00632.pdb
#  11: usage_00914.pdb
#  12: usage_01219.pdb
#  13: usage_01222.pdb
#  14: usage_01223.pdb
#
# Length:         30
# Identity:        0/ 30 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      5/ 30 ( 16.7%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           14/ 30 ( 46.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00054.pdb         1  -NECMESVKNGTYDYPKYQKESKLNR----   25
usage_00055.pdb         1  -NECMESVKNGTYDYPKYQKESKLNR----   25
usage_00121.pdb         1  -NECMESVKNGTYDYPKYQKESKLNRQGI-   28
usage_00122.pdb         1  DNECMESVKNGTYDYPKYQKESKLNRQG--   28
usage_00123.pdb         1  -NECMESVKNGTYDYPKYQKESKLNRQGI-   28
usage_00126.pdb         1  NDECMESVKNGTYDYPKYSEESKLNREKI-   29
usage_00627.pdb         1  -NECMESVKNGTYDYPKYQKESRLNRQKIE   29
usage_00629.pdb         1  NNECMESVKNGTYDYPKYQKESRLNRQKIE   30
usage_00631.pdb         1  -NECMESVKNGTYDYPKYQKESKLNR----   25
usage_00632.pdb         1  -NECMESVKNGTYDYPKYQKESKLNR----   25
usage_00914.pdb         1  ---DAACVSLGNCC--LDFQETCVEPTHI-   24
usage_01219.pdb         1  -TEIIKCLRNK------D-PQEILLNEAFV   22
usage_01222.pdb         1  -NECMESVKNGTYDYPKYQKESKLNRQGI-   28
usage_01223.pdb         1  DNECMESVKNGTYDYPKYQKESKLNRQG--   28
                                  v ng         e  l      


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################