################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:03:17 2021
# Report_file: c_1442_89.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00411.pdb
#   2: usage_00412.pdb
#   3: usage_00415.pdb
#   4: usage_00416.pdb
#   5: usage_05937.pdb
#   6: usage_05938.pdb
#
# Length:         34
# Identity:       16/ 34 ( 47.1%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     16/ 34 ( 47.1%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 34 ( 11.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00411.pdb         1  ---GCVEIPGLSEEEDPAPSRKIHFSTAPIQVFS   31
usage_00412.pdb         1  ---GCVEIPGLSEEEDPAPSRKIHFSTAPIQVFS   31
usage_00415.pdb         1  ---GCVEIPGLSEEEDPAPSRKIHFSTAPIQVF-   30
usage_00416.pdb         1  ---GCVEIPGLSEEEDPAPSRKIHFSTAPIQVF-   30
usage_05937.pdb         1  PDMEYSEIVGLPQEEEIPANRKIKFSCAPIKVF-   33
usage_05938.pdb         1  ---EYSEIVGLPQEEEIPANRKIKFSCAPIKVFN   31
                                 EI GL  EE     RKI FS API VF 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################