################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:18:19 2021 # Report_file: c_1256_131.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00479.pdb # 2: usage_00480.pdb # 3: usage_00722.pdb # 4: usage_02003.pdb # 5: usage_02037.pdb # 6: usage_02038.pdb # 7: usage_02042.pdb # 8: usage_02043.pdb # 9: usage_02074.pdb # 10: usage_02075.pdb # 11: usage_03387.pdb # 12: usage_03388.pdb # 13: usage_03945.pdb # 14: usage_03946.pdb # # Length: 35 # Identity: 32/ 35 ( 91.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 35 ( 94.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 35 ( 5.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00479.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_00480.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_00722.pdb 1 -PLKTLYYKKIDTSALKSIRDSCRNFPGYVRVVY- 33 usage_02003.pdb 1 LPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYE 35 usage_02037.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_02038.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_02042.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_02043.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_02074.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_02075.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_03387.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_03388.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_03945.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 usage_03946.pdb 1 -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY- 33 PLKTLYYKKIDTSALKSIRDfCRNFPGYVRVVY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################