################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:28:09 2021
# Report_file: c_1084_139.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00261.pdb
#   2: usage_00262.pdb
#   3: usage_00764.pdb
#   4: usage_00822.pdb
#   5: usage_00983.pdb
#   6: usage_01172.pdb
#   7: usage_01211.pdb
#   8: usage_01217.pdb
#   9: usage_01696.pdb
#  10: usage_01852.pdb
#
# Length:         99
# Identity:        3/ 99 (  3.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      7/ 99 (  7.1%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           45/ 99 ( 45.5%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00261.pdb         1  -LAQLGSVLDNINLMAYDYAGSW-D--------SV-SGHQTNLYPSTSN---PS--ST--   42
usage_00262.pdb         1  -LAQLGSVLDNINLMAYDYAGSW-D--------SV-SGHQTNLYPSTSN---PS--ST--   42
usage_00764.pdb         1  -VPELCQELDAIHVMSYDLRGNW-A--------GF-ADVHSPLYKRPHDQW-AY--EK--   44
usage_00822.pdb         1  DIPALNGLVDFVNLATFDFLTPARN------P-EE-ADYSAPIYHPDGS---KDRLAH--   47
usage_00983.pdb         1  AYNVAQNSMDHIFLMSYDFYGAF-D--------LKNLGHQTALNAPAWK---PD--TA--   44
usage_01172.pdb         1  NYAEAQKSLGKIFLMSYDFKGAW-S--------NTDLGYQTTVYAPSWN---SE--EL--   44
usage_01211.pdb         1  PVSAVASSLDWVNLMAYDFYGPG-W------S-RV-TGPPAALFDP-SN-----------   39
usage_01217.pdb         1  -YADAVQYMDYIFAMTYDFYGGW-N--------NV-PGHQTALYCGSFMRPGQC--DGGG   47
usage_01696.pdb         1  -LAEMDKYLDFWNLMAYDFSGSW-D--------KV-SGHMSNVFPSTTK---PE--ST--   42
usage_01852.pdb         1  --KALGAAVDYFQV-TYDQVGPG-WSSGGFHNEAW-PGPESGFD----------------   39
                                    d      yD  g                                       

usage_00261.pdb        43  -----------PFSTKAAVDAYIAAGVPASKIILGMPIY   70
usage_00262.pdb        43  -----------PFSTKAAVDAYIAAGVPASKIILGMPIY   70
usage_00764.pdb        45  ------------LNVNDGLQLWEDKGCPTNKLVVGIP--   69
usage_00822.pdb        48  ------------LNADFQVEYWLSQGFPSNKINLGVAT-   73
usage_00983.pdb        45  ------------YTTVNGVNALLAQGVKPGKIVVGTA--   69
usage_01172.pdb        45  ------------YTTHYAVDALLKQGVDPNKIIVGVA--   69
usage_01211.pdb        40  ----------AGPSGDAGTRSWIQAGLPAKKAVLGFP--   66
usage_01217.pdb        48  VDENGEPYKGPAYTADNGIQLLLAQGVPANKLVLGTAM-   85
usage_01696.pdb        43  -----------PFSSDKAVKDYIKAGVPANKIVLGMPLY   70
usage_01852.pdb        40  -------------WQQALLSYAVS-RVPASKVLAGLP--   62
                                                    g    K   G    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################