################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:56 2021 # Report_file: c_1261_160.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00616.pdb # 2: usage_01442.pdb # 3: usage_01443.pdb # 4: usage_02921.pdb # 5: usage_02922.pdb # 6: usage_02924.pdb # 7: usage_02925.pdb # 8: usage_02926.pdb # 9: usage_02930.pdb # # Length: 31 # Identity: 2/ 31 ( 6.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 31 ( 25.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 31 ( 16.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00616.pdb 1 -HTFDFQHVADAISLFELDQKHCC-KVLL-- 27 usage_01442.pdb 1 -QTFPFSKVPEAFLKVERGHARGKTVIN-VV 29 usage_01443.pdb 1 EQTFPFSKVPEAFLKVERGHARGKTVIN-VV 30 usage_02921.pdb 1 -KTFPNEDIVEAFRYLQRSKHIGRVVVT-MP 29 usage_02922.pdb 1 -KTFPNEDIVEAFRYLQRSKHIGRVVVT-MP 29 usage_02924.pdb 1 -KTFPNEDIVEAFRYLQRSKHIGRVVVT-MP 29 usage_02925.pdb 1 -KTFPNEDIVEAFRYLQRSKHIGRVVVT-MP 29 usage_02926.pdb 1 -KTFPNEDIVEAFRYLQRSKHIGRVVVT-MP 29 usage_02930.pdb 1 -KVFPSEDVVEAFRHLQHSKHIGKIVVT-MP 29 tFp eAf g v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################