################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:18:19 2021
# Report_file: c_1256_131.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_00479.pdb
#   2: usage_00480.pdb
#   3: usage_00722.pdb
#   4: usage_02003.pdb
#   5: usage_02037.pdb
#   6: usage_02038.pdb
#   7: usage_02042.pdb
#   8: usage_02043.pdb
#   9: usage_02074.pdb
#  10: usage_02075.pdb
#  11: usage_03387.pdb
#  12: usage_03388.pdb
#  13: usage_03945.pdb
#  14: usage_03946.pdb
#
# Length:         35
# Identity:       32/ 35 ( 91.4%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     33/ 35 ( 94.3%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 35 (  5.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00479.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_00480.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_00722.pdb         1  -PLKTLYYKKIDTSALKSIRDSCRNFPGYVRVVY-   33
usage_02003.pdb         1  LPLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVYE   35
usage_02037.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_02038.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_02042.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_02043.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_02074.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_02075.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_03387.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_03388.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_03945.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
usage_03946.pdb         1  -PLKTLYYKKIDTSALKSIRDFCRNFPGYVRVVY-   33
                            PLKTLYYKKIDTSALKSIRDfCRNFPGYVRVVY 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################