################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:34 2021 # Report_file: c_1479_36.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00100.pdb # 2: usage_00638.pdb # 3: usage_00639.pdb # 4: usage_00640.pdb # 5: usage_00641.pdb # 6: usage_01438.pdb # 7: usage_01439.pdb # 8: usage_01806.pdb # # Length: 68 # Identity: 39/ 68 ( 57.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 68 ( 57.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/ 68 ( 42.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00100.pdb 1 LLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFWKWGYPVVLAVMGVIAVIM 60 usage_00638.pdb 1 -----------------------ATIFMPLTFIAGIYGMNF---GYPVVLAVMGVIAVIM 34 usage_00639.pdb 1 -----------------------ATIFMPLTFIAGIYGMNF---GYPVVLAVMGVIAVIM 34 usage_00640.pdb 1 -----------------------ATIFMPLTFIAGIYGMNF---GYPVVLAVMGVIAVIM 34 usage_00641.pdb 1 -----------------------ATIFMPLTFIAGIYGMNF---GYPVVLAVMGVIAVIM 34 usage_01438.pdb 1 -LDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNF---GYPVVLAVMGVIAVIM 56 usage_01439.pdb 1 -LDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNF---GYPVVLAVMGVIAVIM 56 usage_01806.pdb 1 -LDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNF---GYPVVLAVMGVIAVIM 56 ATIFMPLTFIAGIYGMNF GYPVVLAVMGVIAVIM usage_00100.pdb 61 VVYFKKKK 68 usage_00638.pdb 35 VVYFKKKK 42 usage_00639.pdb 35 VVYFKKKK 42 usage_00640.pdb 35 VVYFKKKK 42 usage_00641.pdb 35 VVYFKKKK 42 usage_01438.pdb 57 VVYFKKKK 64 usage_01439.pdb 57 VVYFKKKK 64 usage_01806.pdb 57 VVYFK--- 61 VVYFK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################