################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:30:22 2021 # Report_file: c_0952_23.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00108.pdb # 2: usage_00523.pdb # 3: usage_00524.pdb # 4: usage_00525.pdb # 5: usage_00611.pdb # 6: usage_00628.pdb # # Length: 79 # Identity: 45/ 79 ( 57.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 79 ( 57.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 34/ 79 ( 43.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00108.pdb 1 YVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS- 59 usage_00523.pdb 1 YVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS- 59 usage_00524.pdb 1 YVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS- 59 usage_00525.pdb 1 -VLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS- 58 usage_00611.pdb 1 --------------GSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSG 46 usage_00628.pdb 1 --------SAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS- 51 GSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS usage_00108.pdb ------------------- usage_00523.pdb ------------------- usage_00524.pdb ------------------- usage_00525.pdb ------------------- usage_00611.pdb 47 TTEANAWKSTLVGHDTFTK 65 usage_00628.pdb ------------------- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################