################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:23 2021 # Report_file: c_0941_88.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_01112.pdb # 2: usage_01113.pdb # 3: usage_01114.pdb # 4: usage_01115.pdb # 5: usage_01116.pdb # 6: usage_01117.pdb # 7: usage_01994.pdb # 8: usage_02084.pdb # 9: usage_02085.pdb # 10: usage_02086.pdb # # Length: 51 # Identity: 16/ 51 ( 31.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 51 ( 94.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 51 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01112.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 usage_01113.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 usage_01114.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 usage_01115.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 usage_01116.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 usage_01117.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 usage_01994.pdb 1 -RKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYIC 50 usage_02084.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 usage_02085.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 usage_02086.pdb 1 RGDCDGVQINVPITFQVKVTATECIQ--EQSFVIRALGFTDIVTVQVLPQC 49 gdCdgvqInvpitFqvkvTateCiq eqSFvIRaLGFTdiVtVqvlpqC #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################