################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:56 2021 # Report_file: c_1002_20.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00002.pdb # 2: usage_00074.pdb # 3: usage_00075.pdb # 4: usage_00076.pdb # 5: usage_00119.pdb # 6: usage_00126.pdb # 7: usage_00184.pdb # # Length: 66 # Identity: 15/ 66 ( 22.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 66 ( 48.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 66 ( 13.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00002.pdb 1 -ATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVN--ACHLSCSALLQDNIADAVACAKR 57 usage_00074.pdb 1 RATNYNAGDRSTDYGIFQINSRYCANDGKTPGAV--NACHLSCSALLQDNIADAVACAKR 58 usage_00075.pdb 1 RATNYNAGDRSTDYGIFQINSRYCAND--GKTPGAVNACHLSCSALLQDNIADAVACAKR 58 usage_00076.pdb 1 RATNYNAGDRSTDYGIFQINSRYCANDGKTPGAV--NACHLSCSALLQDNIADAVACAKR 58 usage_00119.pdb 1 -ATNYNRGDQSTDYGILQINSRWWCNDGKTPKAKN--ACGIECSELLKADITAAVNCAKR 57 usage_00126.pdb 1 NVVGPTNSNGSNDYGIFQINNYYWCQPSNGRFSYN--ECHLSCDALLTDNISNSVTCARK 58 usage_00184.pdb 1 -ATNYNPSSESTDYGIFQINSKWWCNDGKTPNAVD--GCHVSCSELMENDIAKAVACAKH 57 atnyn StDYGIfQINs nd Ch sCs Ll I aV CAk usage_00002.pdb 58 VVR--- 60 usage_00074.pdb 59 VVRDP- 63 usage_00075.pdb 59 VVR--- 61 usage_00076.pdb 59 VVR--- 61 usage_00119.pdb 58 IVR--- 60 usage_00126.pdb 59 IKSQQG 64 usage_00184.pdb 58 IVSE-- 61 v #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################