################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:41 2021 # Report_file: c_0793_41.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00025.pdb # 2: usage_00036.pdb # 3: usage_00037.pdb # 4: usage_00115.pdb # 5: usage_00343.pdb # 6: usage_00344.pdb # 7: usage_00345.pdb # 8: usage_00346.pdb # 9: usage_00475.pdb # # Length: 84 # Identity: 46/ 84 ( 54.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 84 ( 54.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 84 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 PYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGD------ 54 usage_00036.pdb 1 PYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPVIRGSALLALEQ-MHRNPK 59 usage_00037.pdb 1 PYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPVIRGSALLALEQ-MHRNPK 59 usage_00115.pdb 1 PYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGD------ 54 usage_00343.pdb 1 PYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGD------ 54 usage_00344.pdb 1 PYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGD------ 54 usage_00345.pdb 1 PYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGD------ 54 usage_00346.pdb 1 PYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALEGD------ 54 usage_00475.pdb 1 PYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPVIRGSALLALEQ-MHRNPK 59 PYI VF NK DMVDD ELL LVEMEVR LL QY FPGD P RGSAL ALE usage_00025.pdb 55 -----AEWEAKILELAGFLDSY-- 71 usage_00036.pdb 60 TRRGENEWVDKIWELLDAIDE--- 80 usage_00037.pdb 60 TRRGENEWVDKIWELLDAIDE--- 80 usage_00115.pdb 55 -----AEWEAKILELAGFLDSYI- 72 usage_00343.pdb 55 -----AEWEAKILELAGFLDS--- 70 usage_00344.pdb 55 -----AEWEAKILELAGFLDS--- 70 usage_00345.pdb 55 -----AEWEAKILELAGFLDSYIP 73 usage_00346.pdb 55 -----AEWEAKILELAGFLDS--- 70 usage_00475.pdb 60 TRRGENEWVDKIWELLDAIDE--- 80 EW KI EL D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################