################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:53 2021 # Report_file: c_0831_41.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00129.pdb # 2: usage_00187.pdb # 3: usage_00190.pdb # 4: usage_00236.pdb # 5: usage_00237.pdb # 6: usage_00544.pdb # 7: usage_00582.pdb # 8: usage_00596.pdb # # Length: 76 # Identity: 39/ 76 ( 51.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 72/ 76 ( 94.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 76 ( 3.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00129.pdb 1 NPEVKEYLFDVARFWMEQGIDGWRLDVANEVD-HAFWREFRRLVKSLNPDALIVGAIWHD 59 usage_00187.pdb 1 --EVKEYLFDVARFWMEQGIDGWRLDVANEVD-HAFWREFRRLVKSLNPDALIVGEIWHD 57 usage_00190.pdb 1 NPEVKEYLFDVARFWMEQGIDGWRLNVANEVD-HAFWREFRRLVKSLNPDALIVGEIWHD 59 usage_00236.pdb 1 NPEVKEYLFDVARFWMEQGIDGWRLDVANEVD-HAFWREFRRLVKSLNPDALIVGEIWHD 59 usage_00237.pdb 1 NPEVKEYLFDVARFWMEQGIDGWRLDVANEVD-HAFWREFRRLVKSLNPDALIVGEIWHD 59 usage_00544.pdb 1 --EVKEYLFDVARFWMEQGIDGWRLDVANEVD-HAFWREFRRLVKSLNPDALIVGEIWHD 57 usage_00582.pdb 1 -PEVREYIMEIAEYWLKFGIDGWRLDVPFEIKTPGFWQEFRDRTKAINPEAYIVGEVWGD 59 usage_00596.pdb 1 -PEVKEYLFDVARFWMEQGIDGWRLNVANEVD-HAFWREFRRLVKSLNPDALIVGEIWHD 58 EVkEYlfdvArfWmeqGIDGWRL VanEvd haFWrEFRrlvKslNPdAlIVGeiWhD usage_00129.pdb 60 ASGWLMGDQFDSVMNY 75 usage_00187.pdb 58 ASGWLMGDQFDSVMNY 73 usage_00190.pdb 60 ASGWLMGDQFDSVMNY 75 usage_00236.pdb 60 ASGWLMGDQFDSVMNY 75 usage_00237.pdb 60 ASGWLMGDQFDSVMNY 75 usage_00544.pdb 58 ASGWLMGDQFDSVMNY 73 usage_00582.pdb 60 SRQWLDGTQFDGVMNY 75 usage_00596.pdb 59 ASGWLMGDQFDSVMNY 74 asgWLmGdQFDsVMNY #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################