################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:54:15 2021
# Report_file: c_1480_14.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_00388.pdb
#   2: usage_00389.pdb
#   3: usage_00390.pdb
#   4: usage_00391.pdb
#   5: usage_00392.pdb
#   6: usage_00393.pdb
#   7: usage_00394.pdb
#   8: usage_00395.pdb
#   9: usage_01367.pdb
#  10: usage_02218.pdb
#  11: usage_02576.pdb
#  12: usage_03108.pdb
#
# Length:        100
# Identity:        0/100 (  0.0%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      0/100 (  0.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           93/100 ( 93.0%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00388.pdb         1  ---------SLEQQFSIRSFATQVQN-----------S-HD--QAK------------DF   25
usage_00389.pdb         1  ---------SLEQQFSIRSFATQVQN-----------S-HD--QAK------------DF   25
usage_00390.pdb         1  ---------SLEQQFSIRSFATQVQN-----------S-HD--QAK------------DF   25
usage_00391.pdb         1  ---------SLEQQFSIRSFATQVQN-----------S-HD--QAK------------DF   25
usage_00392.pdb         1  ---------SLEQQFSIRSFATQVQN-----------S-HD--QAK------------DF   25
usage_00393.pdb         1  ---------SLEQQFSIRSFATQVQN-----------S-HD--QAK------------DF   25
usage_00394.pdb         1  ---------SLEQQFSIRSFATQVQN-----------S-HD--QAK------------DF   25
usage_00395.pdb         1  ---------SLEQQFSIRSFATQVQN-----------S-HD--QAK------------DF   25
usage_01367.pdb         1  -LQPVWDRYDTQIHNQ------------------------------KDNDNEVPVHQVSY   29
usage_02218.pdb         1  MDALI----AQLQRQFRDYTISLYQQ---------------GFLDD------------QF   29
usage_02576.pdb         1  ----------------------------------------T--KEN------------LF    6
usage_03108.pdb         1  ----------------IQQVLKDCIVHLCISKPERPKFLRE--HFE------------KL   30
                                                                                       

usage_00388.pdb        26  LVKLYEQ-VVREATYQELLK-HQ-----------------   46
usage_00389.pdb        26  LVKLYEQ-VVREATYQELL---------------------   43
usage_00390.pdb        26  LVKLYEQ-VVREATYQELL---------------------   43
usage_00391.pdb        26  LVKLYEQ-VVREATYQELLK-H------------------   45
usage_00392.pdb        26  LVKLYEQ-VVREATYQELLK-HQ-----------------   46
usage_00393.pdb        26  LVKLYEQ-VVREATYQELLK--------------------   44
usage_00394.pdb        26  LVKLYEQ-VVREATYQELLK--------------------   44
usage_00395.pdb        26  LVKLYEQ-VVREATYQELLK-HQW----------------   47
usage_01367.pdb        30  TNLAEMV-GEMNKLL-------------------------   43
usage_02218.pdb        30  TELKK-----------------------------------   34
usage_02576.pdb         7  LEILNIQESKWQEQWKKEQI-KAKTNREKFYLYNELSLTT   45
usage_03108.pdb        31  EKEENRQ-ILARQ-------KS------------------   44
                                                                   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################