################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:05:14 2021 # Report_file: c_0385_19.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00119.pdb # 2: usage_00128.pdb # 3: usage_00129.pdb # 4: usage_00401.pdb # # Length: 80 # Identity: 8/ 80 ( 10.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/ 80 ( 78.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 80 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00119.pdb 1 -NVTVNVMNETVNISIDNSGSTYRFVDYFKTSSTQSYRQRNYLITEHRLQAYRRDESGNI 59 usage_00128.pdb 1 --VTVNVMNETVNISIDNSGSTYRFVDYIKTSSTQAYGSRNYLNTAHRLQAYRRDGDGNI 58 usage_00129.pdb 1 TNVTVNVMNETVNISIDNSGSTYRFVDYIKTSSTQAYGSRNYLNTAHRLQAYRRDGDGNI 60 usage_00401.pdb 1 ESRQYSLFGVNKQITVVNTSNKWKFMEMFRNNSNAEFQHKRTLTSSTKLVGILKHGGRLW 60 vtvnvmnetvnIsidNsgstyrFvdy ktsStq y rnyL t hrLqayrrdg gni usage_00119.pdb 60 SNYWGSSTYGDLRVGTYFN- 78 usage_00128.pdb 59 SNYWGADTQGDLRVGTYS-- 76 usage_00129.pdb 61 SNYWGADTQGDLRVGTYS-- 78 usage_00401.pdb 61 TY--HGET-P-NATTDYS-T 75 sn g T g lrvgtYs #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################