################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:07:45 2021
# Report_file: c_1112_13.html
################################################################################################
#====================================
# Aligned_structures: 4
#   1: usage_00121.pdb
#   2: usage_00122.pdb
#   3: usage_00123.pdb
#   4: usage_00128.pdb
#
# Length:         84
# Identity:       61/ 84 ( 72.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     61/ 84 ( 72.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           23/ 84 ( 27.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00121.pdb         1  AQRARVLYASGFHTVADLARANIVEVEVILKNAV--------------NMRTIWVTGRKG   46
usage_00122.pdb         1  AQRARVLYASGFHTVADLARANIVEVEVILKNAV--------------NMRTIWVTGRKG   46
usage_00123.pdb         1  AQRARVLYASGFHTVADLARANIVEVEVILKN------------------RTIWVTGRKG   42
usage_00128.pdb         1  AQRARVLYASGFHTVADLARANIVEVEVILKNAVPFKSARKEAVEERRNMRTIWVTGRKG   60
                           AQRARVLYASGFHTVADLARANIVEVEVILKN                  RTIWVTGRKG

usage_00121.pdb        47  LTEREAAALIVEEARMILQ-----   65
usage_00122.pdb        47  LTEREAAALIVEEARMILQQDLVE   70
usage_00123.pdb        43  LTEREAAALIVEEARMILQQDLVE   66
usage_00128.pdb        61  LTEREAAALIVEEARMILQQD---   81
                           LTEREAAALIVEEARMILQ     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################