################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:56 2021 # Report_file: c_1256_127.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01394.pdb # 2: usage_01395.pdb # 3: usage_02209.pdb # 4: usage_02424.pdb # 5: usage_02425.pdb # 6: usage_02426.pdb # 7: usage_03318.pdb # 8: usage_03859.pdb # 9: usage_04035.pdb # # Length: 40 # Identity: 2/ 40 ( 5.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 40 ( 75.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 40 ( 12.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01394.pdb 1 RIAIPPMCQYMAEDGMI-NDWHHVHLAGLARGGAGLLVV- 38 usage_01395.pdb 1 RIAIPPMCQYMAEDGMI-NDWHHVHLAGLARGGAGLLVV- 38 usage_02209.pdb 1 RIAIPPMCQYMAEDGLI-NDWHQVHYASMARGGAGLLVV- 38 usage_02424.pdb 1 RIAIPPMCQYMAEDGMI-NDWHHVHLAGLARGGAGLLVV- 38 usage_02425.pdb 1 RIAIPPMAQYMAEDGMI-NDWHHVHLAGLARGGAGLLVV- 38 usage_02426.pdb 1 RIAIPPMSQYMAEDGMI-NDWHHVHLAGLARGGAGLLVV- 38 usage_03318.pdb 1 RIAIPPMCQYMAEDGMI-NDWHHVHLAGLARGGAGLLVV- 38 usage_03859.pdb 1 NIRLTSAVSVLS--S-DDPVRVFQQFSTVDLLSNGRAEIA 37 usage_04035.pdb 1 RIAIPPMAQYMAEDGMI-NDWHHVHLAGLARGGAGLLVV- 38 rIaippm qyma g i ndwh vh a arggaGllvv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################