################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:36 2021 # Report_file: c_0811_3.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00155.pdb # 2: usage_00233.pdb # 3: usage_00235.pdb # 4: usage_00236.pdb # 5: usage_00237.pdb # 6: usage_00479.pdb # 7: usage_00505.pdb # 8: usage_00507.pdb # 9: usage_00508.pdb # # Length: 61 # Identity: 16/ 61 ( 26.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 61 ( 39.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 61 ( 11.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00155.pdb 1 -WSVKLRLMLDIALGIEYMQNQNPPIVHRDLRSPNILLQSLDENAPVCAKVADFGLSQQS 59 usage_00233.pdb 1 -WPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNE----F-HVKIADFGLSKWR 54 usage_00235.pdb 1 -WPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNE----F-HVKIADFGLSKWR 54 usage_00236.pdb 1 -WPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNE----F-HVKIADFGLSKWR 54 usage_00237.pdb 1 -WPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNE----F-HVKIADFGLSKWR 54 usage_00479.pdb 1 DERRRLSMAYDVAKGMNYLHNRNPPIVHRDLKSPNLLVDKK----Y-TVKVCDFGLSRLK 55 usage_00505.pdb 1 -WSVKLRLMLDIALGIEYMQNQNPPIVHRDLRSPNIFLQSLDENAPVCAKVADFGLSQQS 59 usage_00507.pdb 1 -WPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNE----F-HVKIADFGLSKWR 54 usage_00508.pdb 1 -WPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNE----F-HVKIADFGLSKWR 54 w r iAlG Y N PP H DL Nill K aDFGLS usage_00155.pdb - usage_00233.pdb - usage_00235.pdb - usage_00236.pdb 55 M 55 usage_00237.pdb 55 M 55 usage_00479.pdb 56 A 56 usage_00505.pdb - usage_00507.pdb - usage_00508.pdb - #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################