################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:08:04 2021 # Report_file: c_0470_46.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00271.pdb # 2: usage_00380.pdb # 3: usage_00418.pdb # 4: usage_00467.pdb # 5: usage_00468.pdb # 6: usage_00469.pdb # 7: usage_00477.pdb # 8: usage_00623.pdb # 9: usage_00624.pdb # # Length: 86 # Identity: 18/ 86 ( 20.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 86 ( 27.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 86 ( 9.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00271.pdb 1 --KILVTGH---R-FGRGFEEICHALADIATTHQDIQIVYPVHLNPNVREPVNRILGHVK 54 usage_00380.pdb 1 -RMVLITGH-RRESFGEPFRNFCEALRTLAHRYRDAQFVYPLHLNPNVREPALALLGGEA 58 usage_00418.pdb 1 KKFILMTAH-RRENIGKPMENIFKAVRRLIDEYTDLALVYPMHKNPKVREVAQKILGSHD 59 usage_00467.pdb 1 -RLILMTAH-RRENLGEPMQGMFEAVREIVESREDTELVYPMHLNPAVREKAMAILGGHE 58 usage_00468.pdb 1 -RLILMTAH-RRENLGEPMQGMFEAVREIVESREDTELVYPMHLNPAVREKAMAILGGHE 58 usage_00469.pdb 1 -RLILMTAH-RRENLGEPMQGMFEAVREIVESREDTELVYPMHLNPAVREKAMAILGGHE 58 usage_00477.pdb 1 -KLILVTGHRRES-FGGGFERICQALITTAEQHPECQILYPVHLNPNVREPVNKLLKGVS 58 usage_00623.pdb 1 -KMILLTAH-RRENLGEPMENMFKAIRRIVGEFEDVQVVYPVHLNPVVREAAHKHFGDSD 58 usage_00624.pdb 1 -KMILLTAH-RRENLGEPMENMFKAIRRIVGEFEDVQVVYPVHLNPVVREAAHKHFGDSD 58 iL T H G A d vYP HlNP VRE g usage_00271.pdb 55 NVILIDPQEYLPFVWLNHA-WLILT- 78 usage_00380.pdb 59 NIYLIEPQEYLAFVYLMSRSHFIIT- 83 usage_00418.pdb 60 RIELIEPLDVVDFHNFAKKSYFILTD 85 usage_00467.pdb 59 RIHLIEPLDAIDFHNFLRKSYLVFT- 83 usage_00468.pdb 59 RIHLIEPLDAIDFHNFLRKSYLVFT- 83 usage_00469.pdb 59 RIHLIEPLDAIDFHNFLRKSYLVFT- 83 usage_00477.pdb 59 NIVLIEPQQYLPFVYLMDRAHIILT- 83 usage_00623.pdb 59 RVHLIEPLEVIDFHNFAAKSHFILTD 84 usage_00624.pdb 59 RVHLIEPLEVIDFHNFAAKSHFILTD 84 LIeP F T #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################