################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:08 2021 # Report_file: c_0768_67.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00029.pdb # 2: usage_00052.pdb # 3: usage_00053.pdb # 4: usage_00060.pdb # 5: usage_00071.pdb # 6: usage_00187.pdb # 7: usage_00212.pdb # # Length: 69 # Identity: 13/ 69 ( 18.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 69 ( 40.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 69 ( 14.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00029.pdb 1 PPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFY 60 usage_00052.pdb 1 PPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFY 60 usage_00053.pdb 1 PPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFY 60 usage_00060.pdb 1 PPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFY 60 usage_00071.pdb 1 PPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFY 60 usage_00187.pdb 1 KPMNRLLQGDVGSGKTVVAQLAILDNYE--AGF-QTAFMVPTSILAIQHYRRTVESFSKF 57 usage_00212.pdb 1 -----LCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYM 55 Q sG GKTa fvLA L q E q l pT eLA Q k e k usage_00029.pdb 61 PELKLAYAV 69 usage_00052.pdb 61 PELKLAYAV 69 usage_00053.pdb 61 PELKLAYAV 69 usage_00060.pdb 61 PELKLAYAV 69 usage_00071.pdb 61 PELKLAY-- 67 usage_00187.pdb 58 NIHVALL-I 65 usage_00212.pdb 56 PNVKVAV-- 62 p k a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################