################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:18 2021 # Report_file: c_0828_20.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00072.pdb # 2: usage_00073.pdb # 3: usage_00074.pdb # 4: usage_00257.pdb # 5: usage_00258.pdb # 6: usage_00391.pdb # 7: usage_00392.pdb # 8: usage_00393.pdb # 9: usage_00394.pdb # 10: usage_00395.pdb # # Length: 61 # Identity: 54/ 61 ( 88.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 54/ 61 ( 88.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 61 ( 4.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00072.pdb 1 -PSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVFVGEKGAYLF 59 usage_00073.pdb 1 SPSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVFVGEKGAYLF 60 usage_00074.pdb 1 SPSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVFVGEKGAYLF 60 usage_00257.pdb 1 -PSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVFVGEKGAYLF 59 usage_00258.pdb 1 -PSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVFVGEKGAYLF 59 usage_00391.pdb 1 SPSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLAYGGSKGAYLF 60 usage_00392.pdb 1 SPSARRVQGALETRGFGHLKVVELPA--RTAKEAAQAVGAEVGQIVKSLAYGGSKGAYLF 58 usage_00393.pdb 1 SPSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVYGGEKGAYLF 60 usage_00394.pdb 1 SPSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVYGGEKGAYLF 60 usage_00395.pdb 1 SPSARRVQGALETRGFGHLKVVELPASTRTAKEAAQAVGAEVGQIVKSLVYGGEKGAYLF 60 PSARRVQGALETRGFGHLKVVELPA RTAKEAAQAVGAEVGQIVKSL G KGAYLF usage_00072.pdb 60 L 60 usage_00073.pdb 61 L 61 usage_00074.pdb 61 L 61 usage_00257.pdb 60 L 60 usage_00258.pdb 60 L 60 usage_00391.pdb 61 L 61 usage_00392.pdb 59 L 59 usage_00393.pdb 61 L 61 usage_00394.pdb 61 L 61 usage_00395.pdb 61 L 61 L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################