################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:52 2021 # Report_file: c_1108_25.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00121.pdb # 2: usage_00147.pdb # 3: usage_00149.pdb # 4: usage_00156.pdb # 5: usage_00157.pdb # 6: usage_00158.pdb # 7: usage_00159.pdb # 8: usage_00385.pdb # # Length: 76 # Identity: 55/ 76 ( 72.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 76 ( 73.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 76 ( 1.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00121.pdb 1 DPELIKQVVKQMFYIVGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGA 60 usage_00147.pdb 1 DPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGA 60 usage_00149.pdb 1 -PEIILQVFKQLFYMINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGRNLHQSGA 59 usage_00156.pdb 1 -PEIILQVFKQLFYMINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGRNLHQSGA 59 usage_00157.pdb 1 -PELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGA 59 usage_00158.pdb 1 DPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGA 60 usage_00159.pdb 1 DPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGA 60 usage_00385.pdb 1 DPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGA 60 PE I QV KQ FY i A TLNNLLLRKD CSWS GMQ RYN SQLEEWLR NL SGA usage_00121.pdb 61 KETLEPLIQAAQLLQV 76 usage_00147.pdb 61 KETLEPLIQAAQLLQV 76 usage_00149.pdb 60 VQTMEPLIQAAQLLQL 75 usage_00156.pdb 60 VQTMEPLIQAAQLLQL 75 usage_00157.pdb 60 KETLEPLIQAAQLLQV 75 usage_00158.pdb 61 KETLEPLIQAAQLLQV 76 usage_00159.pdb 61 KETLEPLIQAAQLLQV 76 usage_00385.pdb 61 KETLEPLIQAAQLLQV 76 T EPLIQAAQLLQ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################