################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:56 2021 # Report_file: c_1069_2.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00019.pdb # 2: usage_00024.pdb # 3: usage_00025.pdb # 4: usage_00041.pdb # 5: usage_00269.pdb # 6: usage_00307.pdb # 7: usage_00455.pdb # 8: usage_00476.pdb # # Length: 62 # Identity: 46/ 62 ( 74.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 62 ( 75.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 62 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00019.pdb 1 -PDEIREEVDNNCQSILGYVVRWVDQGVGASKVPDIHDVALMEDRATLRISSQLLANWLR 59 usage_00024.pdb 1 -PDEIREEVDNNCQSILGYVVRWVDQGVGASKVPDIHDVALMEDRATLRISSQLLANWLR 59 usage_00025.pdb 1 -PDEIREEVDNNCQSILGYVVRWVDQGVGASKVPDIHDVALMEDRATLRISSQLLANWLR 59 usage_00041.pdb 1 -AQEIQQELDNNVQGILGYVVRWVEQGIG-SKVPDIHNVALMEDRATLRISSQHIANWLR 58 usage_00269.pdb 1 -PDEIREEVDNNCQSILGYVVRWVDQGVGASKVPDIHDVALMEDRATLRISSQLLANWLR 59 usage_00307.pdb 1 SAQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLR 60 usage_00455.pdb 1 APDEIREEVDNNCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLR 60 usage_00476.pdb 1 -PEEIREEVDNDCQSILGYVVRWVDQGIGCSKVPDIHNVALMEDRATLRISSQLLANWLR 59 EI E DNn Q ILGYVVRWV QG G SKVPDIH VALMEDRATLRISSQ ANWLR usage_00019.pdb 60 HG 61 usage_00024.pdb 60 HG 61 usage_00025.pdb 60 HG 61 usage_00041.pdb 59 HG 60 usage_00269.pdb 60 HG 61 usage_00307.pdb 61 H- 61 usage_00455.pdb 61 HG 62 usage_00476.pdb 60 HG 61 H #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################