################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:32 2021 # Report_file: c_0765_32.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00003.pdb # 2: usage_00285.pdb # 3: usage_00333.pdb # 4: usage_00376.pdb # 5: usage_00387.pdb # 6: usage_00413.pdb # # Length: 91 # Identity: 47/ 91 ( 51.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 91 ( 54.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 91 ( 26.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00003.pdb 1 RVGITGVPGVGKSTAIEALGMHLIERGHRVAVLAVD----------------MARLAVHP 44 usage_00285.pdb 1 RVGITGVPGVGKSTAIEALGMHLIERGHRVAVLAV------R----------MARLAVHP 44 usage_00333.pdb 1 RVGITGVPGVGKSTAIEALGMHLIERGHRVAVLAVD----------------MARLAVHP 44 usage_00376.pdb 1 RVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSS-TRTGGSILGDKTRARLAIDR 59 usage_00387.pdb 1 RVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSKTR----------MARLAIDR 50 usage_00413.pdb 1 HVGITGVPGVGKSTTIEALGMHLIEAGHRVAVLAVD-----R----------MARLAVHP 45 rVGITGVPGVGKST I ALG L GH VAVLAV mARLA usage_00003.pdb 45 NAYIR------TLGGVTRATRETVVLLEAAG 69 usage_00285.pdb 45 NAYIRPS----TLGGVTRATRETVVLLEAAG 71 usage_00333.pdb 45 NAYIRPSP-G-TLGGVTRATRETVVLLEAAG 73 usage_00376.pdb 60 NAFIRPSPSSGTLGGVAAKTRET-LLCEAAG 89 usage_00387.pdb 51 NAFIRPSPSSGTLGGVAAKTRETMLLCEAAG 81 usage_00413.pdb 46 DAYIRPSPTSGTLGGVAKATRETIVLLEAAG 76 nA IR TLGGV TRET L EAAG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################