################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:28:23 2021
# Report_file: c_1399_103.html
################################################################################################
#====================================
# Aligned_structures: 10
#   1: usage_00181.pdb
#   2: usage_00182.pdb
#   3: usage_00183.pdb
#   4: usage_00184.pdb
#   5: usage_00185.pdb
#   6: usage_00186.pdb
#   7: usage_00275.pdb
#   8: usage_00276.pdb
#   9: usage_00277.pdb
#  10: usage_00376.pdb
#
# Length:         36
# Identity:       21/ 36 ( 58.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     32/ 36 ( 88.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 36 ( 11.1%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00181.pdb         1  DEKALAKMNGYQLATICLEELNSPKPSPLIERIL--   34
usage_00182.pdb         1  DEKALAKMNGYQLATICLEELNSPKPSPLIERIL--   34
usage_00183.pdb         1  DEKALAKMNGYQLATICLEELNSPKPSPLIERILSN   36
usage_00184.pdb         1  DEKALAKMNGYQLATICLEELNSPKPSPLIERIL--   34
usage_00185.pdb         1  DEKALAKMNGYQLATICLEELNSPKPSPLIERIL--   34
usage_00186.pdb         1  DEKALAKMNGYQLATICLEELNSPKPSPLIERILSN   36
usage_00275.pdb         1  -EKALAK-NGYQLATICLEELNSPKPSPLIERIL--   32
usage_00276.pdb         1  -EKALAK-NGYQLATICLEELNSPKPSPLIERIL--   32
usage_00277.pdb         1  -EKALAK-NGYQLATICLEELNSPKPSPLIERILS-   33
usage_00376.pdb         1  DEQTLNAMSGDQLATICFEELNAPHPSRLIMRIL--   34
                            EkaLak nGyQLATIClEELNsPkPSpLIeRIL  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################