################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:15 2021 # Report_file: c_1491_369.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_02696.pdb # 2: usage_02697.pdb # 3: usage_02698.pdb # 4: usage_02699.pdb # 5: usage_02700.pdb # 6: usage_02701.pdb # 7: usage_02702.pdb # 8: usage_02703.pdb # # Length: 33 # Identity: 32/ 33 ( 97.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 33 ( 97.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 33 ( 3.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02696.pdb 1 DAELKILAARRAIEHALNVYYLLFKPEYLTRM- 32 usage_02697.pdb 1 DAELKILAARRAIEHALNVYYLLFKPEYLTRM- 32 usage_02698.pdb 1 DAELKILAARRAIEHALNVYYLLFKPEYLTRMA 33 usage_02699.pdb 1 DAELKILAARRAIEHALNVYYLLFKPEYLTRMA 33 usage_02700.pdb 1 DAELKILAARRAIEHALNVYYLLFKPEYLTRM- 32 usage_02701.pdb 1 DAELKILAARRAIEHALNVYYLLFKPEYLTRM- 32 usage_02702.pdb 1 DAELKILAARRAIEHALNVYYLLFKPEYLTRMA 33 usage_02703.pdb 1 DAELKILAARRAIEHALNVYYLLFKPEYLTRMA 33 DAELKILAARRAIEHALNVYYLLFKPEYLTRM #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################