################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:07 2021 # Report_file: c_1319_65.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_01228.pdb # 2: usage_01229.pdb # 3: usage_01230.pdb # 4: usage_01231.pdb # 5: usage_01232.pdb # 6: usage_01233.pdb # 7: usage_01234.pdb # 8: usage_01236.pdb # 9: usage_01237.pdb # 10: usage_01238.pdb # 11: usage_01495.pdb # # Length: 41 # Identity: 32/ 41 ( 78.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 41 ( 78.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 41 ( 22.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01228.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 usage_01229.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 usage_01230.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 usage_01231.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 usage_01232.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 usage_01233.pdb 1 FGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 41 usage_01234.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 usage_01236.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 usage_01237.pdb 1 ---------QDIATLTGGTVISEEIGMELEKATLEDLGQAK 32 usage_01238.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 usage_01495.pdb 1 -GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAK 40 QDIATLTGGTVISEEIGMELEKATLEDLGQAK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################