################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:17:26 2021 # Report_file: c_1355_15.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00112.pdb # 2: usage_00113.pdb # 3: usage_00114.pdb # 4: usage_00115.pdb # 5: usage_00116.pdb # 6: usage_00117.pdb # 7: usage_00413.pdb # 8: usage_00414.pdb # 9: usage_00748.pdb # 10: usage_00749.pdb # 11: usage_00750.pdb # 12: usage_00751.pdb # 13: usage_00752.pdb # 14: usage_00753.pdb # # Length: 44 # Identity: 18/ 44 ( 40.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 44 ( 40.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 44 ( 4.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00112.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00113.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00114.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00115.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00116.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00117.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00413.pdb 1 AASMQDFLASSEDMTKFIATVSDAADQAREANNGTKDIALSFDE 44 usage_00414.pdb 1 --SMQDFLASSEDMTKFIATVSDAADQAREANNGTKDIALSFDE 42 usage_00748.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00749.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00750.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00751.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00752.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 usage_00753.pdb 1 --DTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDE 42 DFLA S D FI V D KDI LSFDE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################