################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:00:06 2021 # Report_file: c_1434_346.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00211.pdb # 2: usage_00227.pdb # 3: usage_00229.pdb # 4: usage_01611.pdb # 5: usage_02280.pdb # 6: usage_03108.pdb # 7: usage_03255.pdb # 8: usage_03581.pdb # # Length: 56 # Identity: 29/ 56 ( 51.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 56 ( 53.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 56 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00211.pdb 1 -DREDLVYQAKLAEQAERYDEMVESMKKVAGM-D--VELTVEERNLLSVAYKNVI- 51 usage_00227.pdb 1 -AREENVYMAKLAEQAERYEEMVEFMEKVSNS-LGSEELTVEERNLLSVAYKNVI- 53 usage_00229.pdb 1 TAREENVYMAKLAEQAERYEEMVEFMEKVSNS-LGSEELTVEERNLLSVAYKNVI- 54 usage_01611.pdb 1 --REDYVFMAQLNENAERYDEMVETMRKISGM-E--GELSDKERNLLSVAYKNV-- 49 usage_02280.pdb 1 --REENVYMAKLAEQAERYEEMVEYMEKVAKTVD-VEELTVEERNLLSVAYKNVI- 52 usage_03108.pdb 1 -AREENVYMAKLAEQAERYEEMVEFMEKVSNS-LGSEELTVEERNLLSVAYKNVI- 53 usage_03255.pdb 1 ---EDYVFMAQLNENAERYDEMVETMRKISGM-E--GELSDKERNLLSVAYKNVI- 49 usage_03581.pdb 1 ---EDYVFMAQLNENAERYDEMVETMRKISGM-E--GELSDKERNLLSVAYKNVIG 50 E V mA L E AERY EMVE M K EL ERNLLSVAYKNV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################