################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:41 2021 # Report_file: c_1226_10.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00062.pdb # 2: usage_00162.pdb # 3: usage_00165.pdb # 4: usage_00516.pdb # 5: usage_00524.pdb # 6: usage_00525.pdb # 7: usage_00565.pdb # 8: usage_00847.pdb # 9: usage_01274.pdb # 10: usage_01277.pdb # # Length: 32 # Identity: 9/ 32 ( 28.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 32 ( 37.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 32 ( 9.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00062.pdb 1 -PVIAGVIGAQKPQYDIWGNTVNVASRMDS-- 29 usage_00162.pdb 1 -RVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 31 usage_00165.pdb 1 -RVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 31 usage_00516.pdb 1 -RVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 31 usage_00524.pdb 1 -RVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 31 usage_00525.pdb 1 GPVIAGVIGAQKPQYDIWGNTVNVASRMDST- 31 usage_00565.pdb 1 -RVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 31 usage_00847.pdb 1 -PVVAGVVGSRRFRYDVWGDAVNVASRMESTD 31 usage_01274.pdb 1 -RVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 31 usage_01277.pdb 1 -RVHCGVLGLRKWQFDVWSNDVTLANHMEAGG 31 V GV G k q D W n V A M #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################