################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:09:47 2021 # Report_file: c_1370_130.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00027.pdb # 2: usage_00139.pdb # 3: usage_00140.pdb # 4: usage_00669.pdb # 5: usage_00697.pdb # 6: usage_00868.pdb # 7: usage_01073.pdb # 8: usage_01426.pdb # 9: usage_01665.pdb # 10: usage_01711.pdb # # Length: 47 # Identity: 3/ 47 ( 6.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 47 ( 19.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 47 ( 40.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00027.pdb 1 TA----KQIQAAYLLVENEL-----KRTQDEMANELGINRTTLWEWR 38 usage_00139.pdb 1 -------KSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV 40 usage_00140.pdb 1 ------DKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYW-- 39 usage_00669.pdb 1 --------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHV 39 usage_00697.pdb 1 --------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLY--- 36 usage_00868.pdb 1 -----------INSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV 36 usage_01073.pdb 1 ------NRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLY--- 38 usage_01426.pdb 1 --------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYW-- 37 usage_01665.pdb 1 -EAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRY- 45 usage_01711.pdb 1 ------NRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLY--- 38 e t r A lg TLy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################