################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:46 2021 # Report_file: c_0769_17.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00701.pdb # 2: usage_00718.pdb # 3: usage_00719.pdb # 4: usage_00720.pdb # 5: usage_00721.pdb # # Length: 100 # Identity: 7/100 ( 7.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 78/100 ( 78.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/100 ( 21.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00701.pdb 1 HFLMTGYTPLT---------KTTVLDVMRRLLQPKNVMVSTT------NHCYIAILNIIQ 45 usage_00718.pdb 1 -FLSPSFTPFTSDYIHDDIAHKCHSSYDVMLDLLDPSNSLV-STAMNNPTYFNVYNTIIG 58 usage_00719.pdb 1 ---SPSFTPFTSDYIHDDIAHKCHSSYDVMLDLLDPSNSLV-STAMNNPTYFNVYNTIIG 56 usage_00720.pdb 1 HFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLV-STAMNNPTYFNVYNTIIG 59 usage_00721.pdb 1 ---SPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLV-STAMNNPTYFNVYNTIIG 56 spsfTPfT hk hssydvmLdlldpsnslv ptyfnvyntIIg usage_00701.pdb 46 GEVDPTQVHKSLQRIRER-LANFIPWGPASIQVALSRKSP 84 usage_00718.pdb 59 NVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYL- 97 usage_00719.pdb 57 NVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYLP 96 usage_00720.pdb 60 NVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYL- 98 usage_00721.pdb 57 NVEPRQISRAMTKLQQRIKFPSWSSSAMHVNIGRRSPYLP 96 nveprqisramtklqqri fpswsssamhvnigrrSpyl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################