################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:03:05 2021 # Report_file: c_1387_18.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01977.pdb # 2: usage_02146.pdb # 3: usage_02149.pdb # 4: usage_02154.pdb # 5: usage_02580.pdb # 6: usage_02611.pdb # # Length: 81 # Identity: 40/ 81 ( 49.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 81 ( 50.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 81 ( 9.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01977.pdb 1 QDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLLASQILAFCEGMLSRFVRSE 60 usage_02146.pdb 1 QDRLQGRINQLFERIEAQLRQVMREKRMREGEGYTTDETLLASQILAFCEGMLSRFVRSE 60 usage_02149.pdb 1 -DRLQGRINQLFERIEAQLRQVLREKRMREGEGYATDETLLASQILAFCEGMLSRFVRSE 59 usage_02154.pdb 1 QDRLQGRINQLFERIEVQLRQVMREKKMREGEGYTLDETLLASQLLAFCEGMLSRFVRSE 60 usage_02580.pdb 1 NERLRDRINQLFERIETSLRQILRERK----KSFPVDENILAAQLLGQVEGSLNRFVRSD 56 usage_02611.pdb 1 -ERLRDRINQLFERIETSLRQILRERKLREGKSFPVDENILAAQLLGQVEGSLNRFVRSD 59 RL RINQLFERIE LRQ RE DE LA Q L EG L RFVRS usage_01977.pdb 61 FKYRPTDDFDARWPLIAAQL- 80 usage_02146.pdb 61 FKYRPTDDFDARWPLIAA--- 78 usage_02149.pdb 60 FKYRPTDDFDARWPLIAAQL- 79 usage_02154.pdb 61 FKYRPTDDFEARWPLVAA--- 78 usage_02580.pdb 57 FKYLPTANFDEYWALLSAQIK 77 usage_02611.pdb 60 FKYLPTANFDEYWALLSAQI- 79 FKY PT Fd W L A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################