################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:11:37 2021 # Report_file: c_0334_8.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00025.pdb # 2: usage_00028.pdb # 3: usage_00032.pdb # 4: usage_00046.pdb # 5: usage_00090.pdb # # Length: 65 # Identity: 8/ 65 ( 12.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 65 ( 38.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 65 ( 23.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 MQIELKNGEIIQGILTNVDNWMNLTLSNVTEY--S----------VKLNEIYIRGTFIKF 48 usage_00028.pdb 1 VNVKLASGLLYSGRLESIDGFMNVALSSATEH--YESNNNKL-LNKFNSDVFLRGTQVMY 57 usage_00032.pdb 1 MQIELKNGEIIQGILTNVDNWMNLTLSNVTEY--S----------VKLNEIYIRGTFIKF 48 usage_00046.pdb 1 MQIELKNGEIIQGILTNVDNWMNLTLSNVTEY--SE--ESA-IA-VKLNEIYIRGTFIKF 54 usage_00090.pdb 1 VQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAG-----------EKFNRVFI-YRYIVH 48 q L nGe G L vDn mN Lsn te k n i gt i usage_00025.pdb 49 IKLQ- 52 usage_00028.pdb 58 ISEQ- 61 usage_00032.pdb 49 IKLQ- 52 usage_00046.pdb 55 IKLQ- 58 usage_00090.pdb 49 IDSTE 53 I q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################