################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:32 2021 # Report_file: c_1133_37.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00103.pdb # 2: usage_00104.pdb # 3: usage_00347.pdb # 4: usage_00349.pdb # 5: usage_00604.pdb # 6: usage_00605.pdb # 7: usage_00721.pdb # # Length: 79 # Identity: 1/ 79 ( 1.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 79 ( 8.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 25/ 79 ( 31.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00103.pdb 1 ----PLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLL----NPKERKQVFDQY 52 usage_00104.pdb 1 REQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGS-LLEREEKEKLFNEH 59 usage_00347.pdb 1 ----QIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLFLQH 56 usage_00349.pdb 1 ------MQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAI---EKMKDREALFNEF 51 usage_00604.pdb 1 ----KREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGS-LLEREEKEKLFNEH 55 usage_00605.pdb 1 ---MKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGS-LLEREEKEKLFNEH 56 usage_00721.pdb 1 ----TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYS-AL--AKLSEKKQAFNAY 53 a fk w d r F usage_00103.pdb 53 VKTRAEEERR--------- 62 usage_00104.pdb 60 IEALTKKK----------- 67 usage_00347.pdb 57 IHRLKH------------- 62 usage_00349.pdb 52 VAAAR-------------- 56 usage_00604.pdb 56 IEALTKKKREHFRQLLDET 74 usage_00605.pdb 57 IEALTKKKREHFRQLLDET 75 usage_00721.pdb 54 KVQTE-------------- 58 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################