################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:27 2021 # Report_file: c_0680_164.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00276.pdb # 2: usage_00766.pdb # 3: usage_00901.pdb # 4: usage_00984.pdb # 5: usage_01317.pdb # # Length: 90 # Identity: 7/ 90 ( 7.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 90 ( 23.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 35/ 90 ( 38.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00276.pdb 1 ---PPTVKILQSSSDGGGHF------PPTIQLLCLVSGYTPGTINITWLED-GQVMD-VD 49 usage_00766.pdb 1 PKAAPSVTLFPPS-------SE------KATLVCLISDFYPGAVTVAWKADSSPV--KA- 44 usage_00901.pdb 1 ---PPEVAVFEPS-------EAEISHTQKATLVCLATGFYPDHVELSWWVNGKEV--HS- 47 usage_00984.pdb 1 -----TVSIFPPS-------SEQLTSG-GASVVCFLNNFYPKDINVKWKIDGSER--QN- 44 usage_01317.pdb 1 --ANPTVTLFPPS-------SEELQAN-KATLVCLISDFYPGAVTVAWKADGSPV--EA- 47 V f pS a lvCl fyP W d v usage_00276.pdb 50 LSTA--STTQE-----G-ELASTQSELTL- 70 usage_00766.pdb 45 GVETT-TPSKQ-S---N-NKYAASSYLSLT 68 usage_00901.pdb 48 GVCTDPQPLKE-QPALNDSRYALSSRLRVS 76 usage_00984.pdb 45 GVLNS-WTDQDSK---D-STYSMSSTLTLT 69 usage_01317.pdb 48 GVETT-KPSKQ-S---N-NKYAASSYLS-- 69 gv y sS L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################