################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:04 2021 # Report_file: c_1387_171.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00571.pdb # 2: usage_01124.pdb # 3: usage_01125.pdb # 4: usage_01800.pdb # 5: usage_02177.pdb # 6: usage_02186.pdb # 7: usage_02188.pdb # 8: usage_02287.pdb # 9: usage_02413.pdb # # Length: 43 # Identity: 23/ 43 ( 53.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 43 ( 55.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 43 ( 11.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00571.pdb 1 GYHMQEAGATADIEMAYTLADGVDYIRAGESVGLNVDQF---- 39 usage_01124.pdb 1 GYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRL 43 usage_01125.pdb 1 GYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRL 43 usage_01800.pdb 1 GYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRL 43 usage_02177.pdb 1 -YHMQEAGATADIEMAYTLADGVDYIRAGESVGLNVDQFAPRL 42 usage_02186.pdb 1 GYHMQEAGATADIEMAYTLADGVDYIRAGESVGLNVDQFAPRL 43 usage_02188.pdb 1 GYHMQEAGATADIEMAYTLADGVDYIRAGESVGLNVDQFAPRL 43 usage_02287.pdb 1 GYAMQEAGATADIEMAYTLADGVDYIRAGESVGLNVDQFAPRL 43 usage_02413.pdb 1 GYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDEFAPRL 43 YhMQEAGA A E AYTLADG Y R G GL D F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################