################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:02 2021 # Report_file: c_0842_73.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00517.pdb # 2: usage_00518.pdb # 3: usage_00895.pdb # 4: usage_00920.pdb # 5: usage_00921.pdb # # Length: 65 # Identity: 20/ 65 ( 30.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 31/ 65 ( 47.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 65 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00517.pdb 1 GCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPP 60 usage_00518.pdb 1 GCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPP 60 usage_00895.pdb 1 --NKVGVAEYVFSVLMVLAQQQGFSVFDKTVGIIGAGQVGSYLAKCLSGIGMKVLLNDPP 58 usage_00920.pdb 1 --NAIAVVEYVFSALL-LAERDGFSLRDRTIGIVGVGNVGSRLQTRLEALGIRTLLCDPP 57 usage_00921.pdb 1 ----IAVVEYVFSALL-LAERDGFSLRDRTIGIVGVGNVGSRLQTRLEALGIRTLLCDPP 55 Vv YV Ll Ae G l rT G vG G VG rL L lG L cDPP usage_00517.pdb 61 RQARE 65 usage_00518.pdb 61 RQARE 65 usage_00895.pdb 59 KQAQG 63 usage_00920.pdb 58 RAARG 62 usage_00921.pdb 56 RAARG 60 r Ar #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################