################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:28:14 2021 # Report_file: c_0467_59.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00046.pdb # 2: usage_00099.pdb # 3: usage_00123.pdb # 4: usage_00152.pdb # 5: usage_00362.pdb # 6: usage_00363.pdb # # Length: 87 # Identity: 8/ 87 ( 9.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 87 ( 24.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 87 ( 13.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 AIEVIAVEDGRGDSLHSRRVAHQLLEDYPNLAGIFATEANGGVGVGDAVRLESRAGEIQI 60 usage_00099.pdb 1 -----SVQSGEWEIDKGNAVASA-LNEYPNLKALLCGNDN-AIGAVSAVRAAGKQGKVYV 53 usage_00123.pdb 1 EFKMVAQQSAEFDRDTAYKVTEQILQAHPEIKAIWCGNDAMALGAMKACEAAGRTD-IYI 59 usage_00152.pdb 1 QIKLVASQPADWDRIKALDVATNVLQRNPNIKAIYCANDTMAMGVAQAVANAGKTGKVLV 60 usage_00362.pdb 1 DIKIVASQSANWETEQALNVTTNILTANPNINGIFAANDNMAIGAVTAVENAGLAGKVLV 60 usage_00363.pdb 1 -----ASQSANWETEQALNVTTNILTANPNINGIFAANDNMAIGAVTAVENAGLAGKVLV 55 a q V L Pn i nd a G Av ag g usage_00046.pdb 61 ISFDTDKGTLDLVDEG-IISATLAQ-- 84 usage_00099.pdb 54 VGYDNINAIKPLKDGR--VLATADQ-- 76 usage_00123.pdb 60 FGFDGAEDVINAIKEGKQIVATIMQFP 86 usage_00152.pdb 61 VGTDGIPEARKMVEAG-QMTATVAQ-- 84 usage_00362.pdb 61 SGYDGIPLAIEYVKQG-KMQNTIDQ-- 84 usage_00363.pdb 56 SGYDGIPLAIEYVKQG-KMQNTIDQ-- 79 g D g T Q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################