################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:43 2021 # Report_file: c_1065_15.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00077.pdb # 2: usage_00082.pdb # 3: usage_00142.pdb # 4: usage_00174.pdb # 5: usage_00175.pdb # 6: usage_00176.pdb # 7: usage_00203.pdb # 8: usage_00204.pdb # # Length: 74 # Identity: 16/ 74 ( 21.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 74 ( 31.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 74 ( 8.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00077.pdb 1 SGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIG--QPND---FDAEIH 55 usage_00082.pdb 1 -GENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLG--ELDE---RLVKIY 54 usage_00142.pdb 1 -GWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNGEGVSAESHLLFNVY 59 usage_00174.pdb 1 -GPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVG--PPSE---EVKKVY 54 usage_00175.pdb 1 -GPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVG--PPSE---EVKKVY 54 usage_00176.pdb 1 -GPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVG--PPSE---EVKKVY 54 usage_00203.pdb 1 -GLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAVG--EPSD---KLKEIY 54 usage_00204.pdb 1 -GLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAVG--EPSD---KLKEIY 54 G A PH i g D Ga GYcSD TRT g y usage_00077.pdb 56 KIVKEAQQAAMDFI 69 usage_00082.pdb 55 EVVKDAQESAFKAV 68 usage_00142.pdb 60 QIVLQAQLAAISAI 73 usage_00174.pdb 55 EIVKEAQETAVQKV 68 usage_00175.pdb 55 EIVKEAQETAVQKV 68 usage_00176.pdb 55 EIVKEAQETAVQKV 68 usage_00203.pdb 55 NIVLEAQLRGVNGI 68 usage_00204.pdb 55 NIVLEAQLRGVNGI 68 iV AQ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################