################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:36:21 2021 # Report_file: c_0467_69.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00103.pdb # 2: usage_00159.pdb # 3: usage_00160.pdb # 4: usage_00161.pdb # 5: usage_00165.pdb # 6: usage_00166.pdb # 7: usage_00268.pdb # 8: usage_00364.pdb # 9: usage_00365.pdb # 10: usage_00366.pdb # 11: usage_00367.pdb # # Length: 76 # Identity: 47/ 76 ( 61.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/ 76 ( 72.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 76 ( 6.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00103.pdb 1 --EVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL 58 usage_00159.pdb 1 --EVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL 58 usage_00160.pdb 1 --EVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL 58 usage_00161.pdb 1 --EVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL 58 usage_00165.pdb 1 DTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKL 60 usage_00166.pdb 1 DTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKL 60 usage_00268.pdb 1 --EVLSGQQAACD-AALEDVDQV-AAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL 56 usage_00364.pdb 1 --EVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL 58 usage_00365.pdb 1 --EVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL 58 usage_00366.pdb 1 DTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKL 60 usage_00367.pdb 1 DTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKL 60 EV SG AAC AAL DVDQV AAIVG AGL TLAAIRAGK LLANKESL TCG L usage_00103.pdb 59 FMDAVKQSKAQLLPVD 74 usage_00159.pdb 59 FMDAVKQSKAQLLPVD 74 usage_00160.pdb 59 FMDAVKQSKAQLLPVD 74 usage_00161.pdb 59 FMDAVKQSKAQLLPVD 74 usage_00165.pdb 61 FMDEVKRSRAQLLPID 76 usage_00166.pdb 61 FMDEVKRSRAQLLPID 76 usage_00268.pdb 57 FDAVKQSKAQLLP-VD 71 usage_00364.pdb 59 FMDAVKQSKAQLLPVD 74 usage_00365.pdb 59 FMDAVKQSKAQLLPVD 74 usage_00366.pdb 61 FMDEVKRSRAQLLPID 76 usage_00367.pdb 61 FMDEVKRSRAQLLPID 76 Fmd vk s aqLl D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################