################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:57 2021 # Report_file: c_0577_16.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00059.pdb # 2: usage_00066.pdb # 3: usage_00070.pdb # 4: usage_00071.pdb # 5: usage_00072.pdb # 6: usage_00090.pdb # 7: usage_00106.pdb # 8: usage_00110.pdb # # Length: 78 # Identity: 22/ 78 ( 28.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 78 ( 43.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 78 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00059.pdb 1 GSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQ-- 58 usage_00066.pdb 1 GSIRIYSMRFSPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQ-- 58 usage_00070.pdb 1 --LRVYNMRYCPYAQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAE-- 56 usage_00071.pdb 1 --LRVYNMRYCPYAQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAE-- 56 usage_00072.pdb 1 --LRVYNMRYCPYAQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAE-- 56 usage_00090.pdb 1 GSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQ-- 58 usage_00106.pdb 1 GLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQ-- 58 usage_00110.pdb 1 --LRLYHVDMNPYGHRVLLVLEAKRIKYEVYRLDPLRLPEWFRAKNPRLKIPVLEIPTDQ 58 R Y mr P Rt L L AK I EV ni l kPEW K f P E usage_00059.pdb 59 -GQLIYESAITCEYLDE- 74 usage_00066.pdb 59 -GQLIYESAITCEYLDE- 74 usage_00070.pdb 57 -DVTIYESLVTVEYLDEV 73 usage_00071.pdb 57 -DVTIYESLVTVEYLDEV 73 usage_00072.pdb 57 -DVTIYESLVTVEYLDEV 73 usage_00090.pdb 59 -GQLIYESAITCEYLDE- 74 usage_00106.pdb 59 -SQLIYESVIACEYLDD- 74 usage_00110.pdb 59 GDRFLFESVVICDYLDE- 75 iyES eYLDe #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################