################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:58:31 2021 # Report_file: c_1230_16.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00067.pdb # 2: usage_00299.pdb # 3: usage_00514.pdb # 4: usage_00576.pdb # 5: usage_01147.pdb # 6: usage_01193.pdb # 7: usage_01194.pdb # 8: usage_01495.pdb # # Length: 44 # Identity: 3/ 44 ( 6.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 44 ( 72.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 44 ( 27.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00067.pdb 1 VWRWSCDN--GKCVKLK-N----DPRSSEPAL-SLEACKMFCN- 35 usage_00299.pdb 1 I-NVSLNLPIIRVSVDHGTAFDKAYKNAKINTKSYFEAAKFAIN 43 usage_00514.pdb 1 VWRWSCDN--GKCVKLK-N----DPRSSEPAL-SLEACKMFCN- 35 usage_00576.pdb 1 VWRWSCDN--GKCVKLK-N----DPRSSEPAL-SLEACKMFCN- 35 usage_01147.pdb 1 VWRWSCDN--GKCVKLK-N----DPRSSEPAL-SLEACKMF--- 33 usage_01193.pdb 1 VWRWSCDN--GKCVKLK-N----DPRSSEPAL-SLEACKMFCN- 35 usage_01194.pdb 1 VWRWSCDN--GKCVKLK-N----DPRSSEPAL-SLEACKMFCN- 35 usage_01495.pdb 1 VWRWSCDN--GKCVKLK-N----DPRSSEPAL-SLEACKMF--- 33 v rwScdn gkcvklk n dprssepal SleackmF #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################