################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Wed Jan 20 23:31:21 2021
# Report_file: c_1191_63.html
################################################################################################
#====================================
# Aligned_structures: 6
#   1: usage_00341.pdb
#   2: usage_00352.pdb
#   3: usage_00353.pdb
#   4: usage_01186.pdb
#   5: usage_02094.pdb
#   6: usage_02221.pdb
#
# Length:         70
# Identity:       16/ 70 ( 22.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     27/ 70 ( 38.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           18/ 70 ( 25.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00341.pdb         1  QEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRD----IDRG-----------AGRADDSEW   45
usage_00352.pdb         1  DEKSWQARYDYNFAGVGIPGLTFMTRYVKGDN----IDLL-----------TTSGEGKEW   45
usage_00353.pdb         1  DEKSWQARYDYNFAGVGIPGLTFMTRYVKGDN----IDLL-----------TTSGEGKEW   45
usage_01186.pdb         1  QEKSWQLRYDYDFAGLGLPGLNLMTRYVQGRD----IDRG-----------AGRADDSEW   45
usage_02094.pdb         1  GERTWQVRYGYDFATVGVPGLTFNTIYLSGDK----IKTA------------R-GDQSEW   43
usage_02221.pdb         1  NEKSWKLQYDYDFVALGVPGLSASASYSRGKLDLTRVDPDSPGYGGWYSAD-G-KNAKHW   58
                            EksWq rYdY Fa  G PGL   t Y  G      id                    eW

usage_00341.pdb        46  ERNTDLSYV-   54
usage_00352.pdb        46  ERDMDIAYVF   55
usage_00353.pdb        46  ERDMDIAYVF   55
usage_01186.pdb        46  ERNTDLSYV-   54
usage_02094.pdb        44  ERDISLAYVI   53
usage_02221.pdb        59  ERDLDLQYVV   68
                           ER  d  YV 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################