################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:28 2021 # Report_file: c_1409_21.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00892.pdb # 2: usage_00901.pdb # 3: usage_00902.pdb # 4: usage_00903.pdb # 5: usage_00986.pdb # 6: usage_01014.pdb # 7: usage_01166.pdb # # Length: 66 # Identity: 44/ 66 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/ 66 ( 95.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 66 ( 4.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00892.pdb 1 -KAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINK 59 usage_00901.pdb 1 -KAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINK 59 usage_00902.pdb 1 -KAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINK 59 usage_00903.pdb 1 NKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINK 60 usage_00986.pdb 1 NKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINK 60 usage_01014.pdb 1 NKAFEVALKVQIIAGFDRGLVKWLRVHGRTLSTVQKKALYFVNRRYMQTHWANYMLWINK 60 usage_01166.pdb 1 -KAYEVTMKIQIISGFDRQLTAWLRVHGRRLTNNQKKTLFFVNRRYMQTHWQNYMLWVKR 59 KAfEValKvQIIaGFDRgLvkWLRVHGRtLstvQKKaLyFVNRRYMQTHWaNYMLWink usage_00892.pdb 60 KIDAL- 64 usage_00901.pdb 60 KIDA-- 63 usage_00902.pdb 60 KIDA-- 63 usage_00903.pdb 61 KIDALG 66 usage_00986.pdb 61 KIDAL- 65 usage_01014.pdb 61 KIDAL- 65 usage_01166.pdb 60 KIKAL- 64 KIdA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################