################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:32 2021 # Report_file: c_0864_57.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00282.pdb # 2: usage_00283.pdb # 3: usage_00453.pdb # 4: usage_00454.pdb # 5: usage_00455.pdb # 6: usage_00456.pdb # 7: usage_00608.pdb # # Length: 58 # Identity: 27/ 58 ( 46.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 58 ( 46.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 58 ( 6.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00282.pdb 1 TPVLKDAKAFNYSIEL-AKALE---GRKFDLIAAPEARGFLFGAPLAYRLGVGFVPVR 54 usage_00283.pdb 1 TPVLKDAKAFNYSIEL-AKALE---GRKFDLIAAPEARGFLFGAPLAYRLGVGFVPVR 54 usage_00453.pdb 1 SPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIR 58 usage_00454.pdb 1 SPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIR 58 usage_00455.pdb 1 SPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIR 58 usage_00456.pdb 1 SPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIR 58 usage_00608.pdb 1 SPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIR 58 PVLKD F I L A L G D IA RGFLFG LA LG G V R #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################