################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:31 2021 # Report_file: c_0763_1.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00123.pdb # 2: usage_00188.pdb # 3: usage_00210.pdb # 4: usage_00423.pdb # 5: usage_00424.pdb # 6: usage_00425.pdb # 7: usage_00426.pdb # 8: usage_00472.pdb # 9: usage_00521.pdb # # Length: 87 # Identity: 14/ 87 ( 16.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 87 ( 39.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 21/ 87 ( 24.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00123.pdb 1 SIGIVGATGQVGQVMRTLLDERDFPASAVRFFASARSQGRKLAFRGQEIEVEDAETA--D 58 usage_00188.pdb 1 TVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTET--A 58 usage_00210.pdb 1 NVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQR-GFAESSLRVGDVDSF--D 57 usage_00423.pdb 1 TVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTET--A 58 usage_00424.pdb 1 TVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTET--A 58 usage_00425.pdb 1 TVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTET--A 58 usage_00426.pdb 1 TVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTET--A 58 usage_00472.pdb 1 TVAVVGAT---GAQMIKMLEESTLPIDKIRYL-------------DQDITIEETT--ETA 42 usage_00521.pdb 1 TVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTET--A 58 vavVGAT G m L E P r l q i e usage_00123.pdb 59 PSGLDIALFSAGSAMSKVQAPRFAAA- 84 usage_00188.pdb 59 FEGVDIALFSAGSSTSAKYAPYAVKA- 84 usage_00210.pdb 58 FSSVGLAFFAAAAEVSRAHAERARAAG 84 usage_00423.pdb 59 FEGVDIALFSAGSSTSAKYAPYAVKAG 85 usage_00424.pdb 59 FEGVDIALFSAGSSTSAKYAPYAVKAG 85 usage_00425.pdb 59 FEGVDIALFSAGSSTSAKYAPYAVKAG 85 usage_00426.pdb 59 FEGVDIALFSAGSSTSAKYAPYAVKAG 85 usage_00472.pdb 43 FEGVDIALFSAGSSTSAKYAPYAVKAG 69 usage_00521.pdb 59 FEGVDIALFSAGSSTSAKYAPYAVKAG 85 f gvdiAlFsAgs S Ap a A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################