################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:13 2021 # Report_file: c_1408_19.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00259.pdb # 2: usage_00260.pdb # 3: usage_01114.pdb # 4: usage_01115.pdb # 5: usage_01116.pdb # 6: usage_01117.pdb # 7: usage_01607.pdb # 8: usage_01608.pdb # # Length: 63 # Identity: 60/ 63 ( 95.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 63 ( 95.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 63 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00259.pdb 1 -TEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV 59 usage_00260.pdb 1 -TEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV 59 usage_01114.pdb 1 -TEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV 59 usage_01115.pdb 1 -TEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV 59 usage_01116.pdb 1 -TEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV 59 usage_01117.pdb 1 -TEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV 59 usage_01607.pdb 1 ETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV 60 usage_01608.pdb 1 ETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV 60 TEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMV usage_00259.pdb 60 SRM 62 usage_00260.pdb 60 SRM 62 usage_01114.pdb 60 S-- 60 usage_01115.pdb 60 S-- 60 usage_01116.pdb 60 SRM 62 usage_01117.pdb 60 SRM 62 usage_01607.pdb 61 S-- 61 usage_01608.pdb 61 S-- 61 S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################