################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:32 2021 # Report_file: c_1420_71.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00264.pdb # 2: usage_00582.pdb # 3: usage_00583.pdb # 4: usage_00604.pdb # 5: usage_00620.pdb # 6: usage_00874.pdb # 7: usage_00982.pdb # 8: usage_00983.pdb # 9: usage_01002.pdb # 10: usage_01132.pdb # 11: usage_01133.pdb # 12: usage_01134.pdb # 13: usage_01499.pdb # # Length: 34 # Identity: 20/ 34 ( 58.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 34 ( 82.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 34 ( 8.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00264.pdb 1 SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FIGF 33 usage_00582.pdb 1 SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF 33 usage_00583.pdb 1 SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF 33 usage_00604.pdb 1 SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FI-- 31 usage_00620.pdb 1 SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FIGF 33 usage_00874.pdb 1 SPLLSHQDEEAFPNPREWNPERNMKLVDGAFCGF 34 usage_00982.pdb 1 SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF 33 usage_00983.pdb 1 SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF 33 usage_01002.pdb 1 SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF 33 usage_01132.pdb 1 SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FIGF 33 usage_01133.pdb 1 SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FI-- 31 usage_01134.pdb 1 SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FIGF 33 usage_01499.pdb 1 SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF 33 SPLLSHhDEEAFP PR WdPERdeKv ga Fi #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################