################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Fri Jan 22 10:40:35 2021 # Report_file: c_0691_33.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00429.pdb # 2: usage_00524.pdb # 3: usage_00525.pdb # 4: usage_00740.pdb # 5: usage_00743.pdb # # Length: 77 # Identity: 7/ 77 ( 9.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 77 ( 55.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/ 77 ( 41.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00429.pdb 1 GL-------AIAVE-GP----SKAEISFEDRK---DGSCGVAYVVQE----PGDYEVSVK 41 usage_00524.pdb 1 DAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISTFGQ 60 usage_00525.pdb 1 DAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISTFGQ 60 usage_00740.pdb 1 DAYVLAEGQNELQV-PTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQ 59 usage_00743.pdb 1 DAYVLAEGQNELQV-PTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQ 59 da nelqv t agntftktfvl DyavnVnYnVQn Pleis fgq usage_00429.pdb 42 FNEEHIPDSPFVVPVAS 58 usage_00524.pdb 61 LK----Q---------S 64 usage_00525.pdb 61 LK----Q---------S 64 usage_00740.pdb 60 LK----Q---------S 63 usage_00743.pdb 60 LK----Q---------S 63 lk q S #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################