################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:01 2021 # Report_file: c_1302_71.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00107.pdb # 2: usage_00108.pdb # 3: usage_00109.pdb # 4: usage_00207.pdb # 5: usage_00483.pdb # 6: usage_00521.pdb # 7: usage_00522.pdb # 8: usage_00634.pdb # 9: usage_00786.pdb # 10: usage_01179.pdb # 11: usage_01181.pdb # 12: usage_01182.pdb # 13: usage_01410.pdb # # Length: 30 # Identity: 20/ 30 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 20/ 30 ( 66.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 30 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00107.pdb 1 ----FMQECKRQLKSGIFTINIVGKRVTIV 26 usage_00108.pdb 1 --LGFMQECKRQLKSGIFTINIVGKRVTIV 28 usage_00109.pdb 1 ----FMQECKRQLKSGIFTINIVGKRVTIV 26 usage_00207.pdb 1 --LGFMQECKRQLKSGIFTINIVGKRVTIV 28 usage_00483.pdb 1 NPLEFMQRCKRDLKSGVFTISIGGQRVTIV 30 usage_00521.pdb 1 ----FMQECKRQLKSGIFTINIVGKRVTIV 26 usage_00522.pdb 1 ----FMQECKRQLKSGIFTINIVGKRVTIV 26 usage_00634.pdb 1 ----FMQRCKRDLKSGVFTISIGGQRVTIV 26 usage_00786.pdb 1 ----FMQRCKRDLKSGVFTISIGGQRVTIV 26 usage_01179.pdb 1 ----FMQECKRQLKSGIFTINIVGKRVTIV 26 usage_01181.pdb 1 --LGFMQECKRQLKSGIFTINIVGKRVTIV 28 usage_01182.pdb 1 --LGFMQECKRQLKSGIFTINIVGKRVTIV 28 usage_01410.pdb 1 --LEFMQRCKRDLKSGVFTISIGGQRVTIV 28 FMQ CKR LKSG FTI I G RVTIV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################