################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:18:34 2021 # Report_file: c_1297_76.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_01026.pdb # 2: usage_01288.pdb # 3: usage_01448.pdb # 4: usage_01701.pdb # 5: usage_01702.pdb # # Length: 62 # Identity: 9/ 62 ( 14.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 62 ( 38.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 62 ( 29.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01026.pdb 1 TAQEIDVKLRRYLQEEYNIYGHNSTGKGKEYGYKSK-FYSGFNKGKVLFHLNDEKSFSYD 59 usage_01288.pdb 1 -IQELDVKSRYYLQKHFNIYGFG-D-V-KDFGRSSR-FQSGFEEGNIIFHLNSGERISYN 55 usage_01448.pdb 1 TFQEIDVRLRKSLMSD------------NRIKLY--EHNSICKKGYWGIHYKDNTTKFTD 46 usage_01701.pdb 1 TAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSK-FYSGFNIGKVTFHLNNNDTFSYD 59 usage_01702.pdb 1 TAQEIDVKLRKYLQEEYNIYGHNGTKKGEEYGHKSK-FYSGFNIGKVTFHLNNNDTFSYD 59 QEiDVklR yLq g f Sgf G fHln syd usage_01026.pdb -- usage_01288.pdb -- usage_01448.pdb -- usage_01701.pdb 60 LF 61 usage_01702.pdb -- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################