################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:17 2021 # Report_file: c_1261_138.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00089.pdb # 2: usage_01665.pdb # 3: usage_01666.pdb # 4: usage_01673.pdb # 5: usage_01675.pdb # 6: usage_01677.pdb # 7: usage_01679.pdb # 8: usage_02142.pdb # 9: usage_02144.pdb # 10: usage_04627.pdb # # Length: 33 # Identity: 3/ 33 ( 9.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 33 ( 51.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 33 ( 6.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00089.pdb 1 THVAIIGNGVGGFTTAQALRAEGFEGRISLIGD 33 usage_01665.pdb 1 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFER 33 usage_01666.pdb 1 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFER 33 usage_01673.pdb 1 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFER 33 usage_01675.pdb 1 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFER 33 usage_01677.pdb 1 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFER 33 usage_01679.pdb 1 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFER 33 usage_02142.pdb 1 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFER 33 usage_02144.pdb 1 RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFER 33 usage_04627.pdb 1 -I-GVFDSGVGGFSVLKSLLKARLFDEIIYYGD 31 aiig G G takaLlae fd l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################