################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:58 2021 # Report_file: c_1200_255.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00712.pdb # 2: usage_02318.pdb # 3: usage_03452.pdb # 4: usage_04165.pdb # 5: usage_04166.pdb # 6: usage_04169.pdb # 7: usage_04170.pdb # 8: usage_04253.pdb # 9: usage_05235.pdb # 10: usage_05237.pdb # 11: usage_05244.pdb # # Length: 30 # Identity: 2/ 30 ( 6.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 30 ( 60.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 30 ( 20.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00712.pdb 1 SNYHIIFFLSE--SWLAVQIVVNGWVHRIQ 28 usage_02318.pdb 1 -FAQYSIMNLQNRKLVQVGIFNGSYIIQN- 28 usage_03452.pdb 1 --AQYSIMNLQNRKLVQVGIFNGSYIIQND 28 usage_04165.pdb 1 ---QYSIMNLQNRKLVQVGIFDGSYIIQND 27 usage_04166.pdb 1 ---QYSIMNLQNRKLVQVGIFDGSYIIQND 27 usage_04169.pdb 1 ---QYSIMNLQNRKLVQVGIFDGSYIIQND 27 usage_04170.pdb 1 ---QYSIMNLQNRKLVQVGIFDGSYIIQND 27 usage_04253.pdb 1 --AQYSIMNLQNRKLVQVGIFNGSYIIQND 28 usage_05235.pdb 1 -FAQYSIMNLQNRKLVQVGIYNGTHVIPND 29 usage_05237.pdb 1 -FAQYSIMNLQNRKLVQVGIYNGTHVIPND 29 usage_05244.pdb 1 ---QYSIMNLQNRKLVQVGIFDGSYIIQND 27 qysimnlq klvqVgI g i n #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################