################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:29 2021 # Report_file: c_1452_29.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00620.pdb # 2: usage_00621.pdb # 3: usage_01203.pdb # 4: usage_01613.pdb # 5: usage_01725.pdb # 6: usage_01726.pdb # 7: usage_02796.pdb # 8: usage_02797.pdb # 9: usage_02798.pdb # 10: usage_03571.pdb # 11: usage_03844.pdb # 12: usage_04783.pdb # 13: usage_04798.pdb # # Length: 43 # Identity: 23/ 43 ( 53.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 43 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 43 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00620.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_00621.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_01203.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_01613.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_01725.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_01726.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_02796.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_02797.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_02798.pdb 1 EYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_03571.pdb 1 DYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINA 43 usage_03844.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_04783.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 usage_04798.pdb 1 EYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNA 43 eYcGHGIGrgFHeePqvLhYdsreTnvvLKpGMtFTiEPMvNA #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################