################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:11 2021 # Report_file: c_0777_76.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00019.pdb # 2: usage_00028.pdb # 3: usage_00029.pdb # 4: usage_00149.pdb # 5: usage_00179.pdb # 6: usage_01020.pdb # 7: usage_01022.pdb # # Length: 74 # Identity: 17/ 74 ( 23.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 74 ( 37.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 24/ 74 ( 32.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00019.pdb 1 -DICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMI---- 55 usage_00028.pdb 1 -DICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDK- 58 usage_00029.pdb 1 -DICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMI---- 55 usage_00149.pdb 1 -KTAFVAGVADSNGYGWAICKLLRAAGARVLVGTWPPVYSIFKK---------------- 43 usage_00179.pdb 1 -KRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQSRVLPDG 59 usage_01020.pdb 1 -DICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKD 59 usage_01022.pdb 1 EDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKD 60 FiAGi D NGYGW iaK L i G WpPvynIF k usage_00019.pdb 56 -KMNILDMLP---- 64 usage_00028.pdb 59 -KMNILDMLP---- 67 usage_00029.pdb 56 -KMNILDMLP---- 64 usage_00149.pdb 44 ---VFDKIYPLDAV 54 usage_00179.pdb 60 SLMEIKKVYP---- 69 usage_01020.pdb 60 KKMNILDMLP---- 69 usage_01022.pdb 61 KKMNILDMLP---- 70 i P #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################