################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 23:17:57 2021
# Report_file: c_1200_144.html
################################################################################################
#====================================
# Aligned_structures: 18
#   1: usage_03625.pdb
#   2: usage_03626.pdb
#   3: usage_03627.pdb
#   4: usage_03628.pdb
#   5: usage_03629.pdb
#   6: usage_03630.pdb
#   7: usage_03631.pdb
#   8: usage_03638.pdb
#   9: usage_03639.pdb
#  10: usage_03640.pdb
#  11: usage_03641.pdb
#  12: usage_03642.pdb
#  13: usage_03643.pdb
#  14: usage_03644.pdb
#  15: usage_03645.pdb
#  16: usage_03646.pdb
#  17: usage_03647.pdb
#  18: usage_03648.pdb
#
# Length:         34
# Identity:       23/ 34 ( 67.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     23/ 34 ( 67.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            4/ 34 ( 11.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_03625.pdb         1  GWVTSSKKYFVRFRIQVFRQGATPLLDET-L---   30
usage_03626.pdb         1  GWVTSSKKYFVRFRIQVFRQGAATPLLDETLKLK   34
usage_03627.pdb         1  GWVTSSKKYFVRFRIQVFRQGAATPLLDETL---   31
usage_03628.pdb         1  GWVTSSKKYFVRFRIQVFRQGAATPLLDETL---   31
usage_03629.pdb         1  GWVTSSKKYFVRFRIQVFRQGAATPLLDETL---   31
usage_03630.pdb         1  GWVTSSKKYFVRFRIQVFRQGAATPLLDETL---   31
usage_03631.pdb         1  GWVTSSKKYFVRFRIQVFRQGAATPLLDETL---   31
usage_03638.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03639.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03640.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03641.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03642.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03643.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03644.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03645.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03646.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03647.pdb         1  GWVTSSKKYFVRFRIQVFRQGEETPLLDETL---   31
usage_03648.pdb         1  GWVTSSKKYFVRFRIQVFRQGETPLLDET-L---   30
                           GWVTSSKKYFVRFRIQVFRQG    L    L   


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################