################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:25 2021 # Report_file: c_1434_73.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_02279.pdb # 2: usage_02878.pdb # 3: usage_02980.pdb # 4: usage_03554.pdb # 5: usage_03555.pdb # 6: usage_03557.pdb # # Length: 86 # Identity: 32/ 86 ( 37.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 86 ( 37.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 86 ( 22.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02279.pdb 1 -PTEYILGLSDLTGEL-RRCINSLGSGDTDTCLDTCKALQHFYSGYISL--NCQRARELW 56 usage_02878.pdb 1 TPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTG--PYEVS 58 usage_02980.pdb 1 --TEYILGLSDLTGEL-RRCINSL-----DTCLDTCKALQHFYSGYISL--NC----ELW 46 usage_03554.pdb 1 TPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTG--PYEVS 58 usage_03555.pdb 1 TPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTG--PYEVS 58 usage_03557.pdb 1 TPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTG--PYEVS 58 Y LG DLTGEL R CINS DT L Y G E usage_02279.pdb 57 RKITT-KQSVLKAENVCYNVKV---- 77 usage_02878.pdb 59 KKLYTLKQSLAKVENACYALKVRGS- 83 usage_02980.pdb 47 RKITT-KQSVLKAENVCYNVKV---- 67 usage_03554.pdb 59 KKLYTLKQSLAKVENACYALKVRGSE 84 usage_03555.pdb 59 KKLYTLKQSLAKVENACYALKVRGSE 84 usage_03557.pdb 59 KKLYTLKQSLAKVENACYALKVRGS- 83 K T KQS K EN CY KV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################