################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:11:33 2021 # Report_file: c_0317_6.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00050.pdb # 2: usage_00051.pdb # 3: usage_00052.pdb # 4: usage_00065.pdb # 5: usage_00066.pdb # # Length: 135 # Identity: 53/135 ( 39.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 53/135 ( 39.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/135 ( 9.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00050.pdb 1 -YQKLIVYLCDFLEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSV- 58 usage_00051.pdb 1 DYQKLIVYLCDFLEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSV- 59 usage_00052.pdb 1 -YQKLIVYLCDFLEKEVQKRGFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPSSV- 58 usage_00065.pdb 1 -WQKIT-EKCDFIQEKVKNSQSQGVVLGLSGGIDSALVATLCKRALKENVFALLP----T 54 usage_00066.pdb 1 -WQKIT-EKCDFIQEKVKNSQSQGVVLGLSGGIDSALVATLCKRALKENVFALLP----T 54 QK CDF V VV GLSGG DSA V LC KEN ALL usage_00050.pdb 59 ---SMPENKTDALNLCEKFSIPYTEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLY 115 usage_00051.pdb 60 ---SMPENKTDALNLCEKFSIPYTEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLY 116 usage_00052.pdb 59 ---SMPENKTDALNLCEKFSIPYTEYSIAPYDAIFSSHFKDASLTRKGNFCARLRMAFLY 115 usage_00065.pdb 55 QISN-KANLEDALRLCADLNLEYKIIEIQSILDAFIKQSENTTLVSLGNFAARIR-SLLY 112 usage_00066.pdb 55 QISN-KANLEDALRLCADLNLEYKIIEIQSILDAFIKQSENTTLVSLGNFAARIR-SLLY 112 N DAL LC Y I F L GNF AR R LY usage_00050.pdb 116 DYSLKSDSLVIGTSN 130 usage_00051.pdb 117 DYSLKSDSLVIGTSN 131 usage_00052.pdb 116 DYSLKSDSLVIGTS- 129 usage_00065.pdb 113 DYSALKNSLVIGTSN 127 usage_00066.pdb 113 DYSALKNSLVIGTSN 127 DYS SLVIGTS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################