################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:52 2021 # Report_file: c_1459_90.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00598.pdb # 2: usage_01080.pdb # 3: usage_01183.pdb # 4: usage_01286.pdb # 5: usage_01564.pdb # 6: usage_01565.pdb # 7: usage_01566.pdb # 8: usage_01567.pdb # 9: usage_01587.pdb # 10: usage_01596.pdb # 11: usage_01597.pdb # # Length: 33 # Identity: 11/ 33 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 33 ( 33.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 33 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00598.pdb 1 NTLRLSYATLDREGIAEGVRRLGRALKGLLA-- 31 usage_01080.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEEL--- 30 usage_01183.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEELKA- 32 usage_01286.pdb 1 NTLRLSYATLDREGIAEGVRRLGRALKGLLALV 33 usage_01564.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEEL--- 30 usage_01565.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEE---- 29 usage_01566.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEE---- 29 usage_01567.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEEL--- 30 usage_01587.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEEL--- 30 usage_01596.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEEL--- 30 usage_01597.pdb 1 NTMRLNFTYVDEDKIMEGIKRLAETIKEEL--- 30 NT RL D I EG RL K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################