################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:54 2021 # Report_file: c_1212_44.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00384.pdb # 2: usage_00763.pdb # 3: usage_00856.pdb # 4: usage_00857.pdb # 5: usage_00895.pdb # 6: usage_00896.pdb # 7: usage_00897.pdb # 8: usage_00900.pdb # 9: usage_00901.pdb # 10: usage_01379.pdb # 11: usage_01380.pdb # # Length: 46 # Identity: 8/ 46 ( 17.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 46 ( 76.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 46 ( 23.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00384.pdb 1 DLHVNPKKQTIGNS-CKACGYRGMLDT--HHKLCTFILK------- 36 usage_00763.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_00856.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_00857.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_00895.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_00896.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_00897.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_00900.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_00901.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_01379.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 usage_01380.pdb 1 DSFFNPKTKKWTNKDTDAEGKPLERA-FNMFILDPIFRLFTAIMNF 45 DsffNPKtkkwtNk tdAeGkplera mfiLdpifrl #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################