################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:56 2021 # Report_file: c_0835_69.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00046.pdb # 2: usage_00047.pdb # 3: usage_00232.pdb # 4: usage_00602.pdb # 5: usage_00604.pdb # 6: usage_00605.pdb # 7: usage_00606.pdb # 8: usage_00609.pdb # # Length: 72 # Identity: 60/ 72 ( 83.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 72 ( 83.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 72 ( 1.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 LPTALANVNAFFRRCPDKLVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFARL 60 usage_00047.pdb 1 LPTALANVNAFFRRCPDKLVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFARL 60 usage_00232.pdb 1 LPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRL 60 usage_00602.pdb 1 LPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRL 60 usage_00604.pdb 1 LPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRL 60 usage_00605.pdb 1 LPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRL 60 usage_00606.pdb 1 LPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRL 60 usage_00609.pdb 1 LPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRL 60 LPTALANVNAF RRCPDKLVFGCGGVYSGE AFLHILAGASMVQVGTAL EGP IF RL usage_00046.pdb 61 NKELQEIMTNK- 71 usage_00047.pdb 61 NKELQEIMTNK- 71 usage_00232.pdb 61 EDELLEIMARKG 72 usage_00602.pdb 61 EDELLEIMARKG 72 usage_00604.pdb 61 EDELLEIMARK- 71 usage_00605.pdb 61 EDELLEIMARKG 72 usage_00606.pdb 61 EDELLEIMARKG 72 usage_00609.pdb 61 EDELLEIMARK- 71 EL EIM K #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################