################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:53 2021 # Report_file: c_0956_9.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00042.pdb # 2: usage_00259.pdb # 3: usage_00263.pdb # 4: usage_00264.pdb # 5: usage_00265.pdb # 6: usage_00266.pdb # 7: usage_00656.pdb # 8: usage_00746.pdb # 9: usage_00747.pdb # # Length: 43 # Identity: 15/ 43 ( 34.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 42/ 43 ( 97.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 43 ( 2.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 -EETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWIC 42 usage_00259.pdb 1 -EETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWIC 42 usage_00263.pdb 1 -EETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWIC 42 usage_00264.pdb 1 -EETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWIC 42 usage_00265.pdb 1 -EETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWIC 42 usage_00266.pdb 1 -EETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWIC 42 usage_00656.pdb 1 TRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWIS 43 usage_00746.pdb 1 -EETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWIC 42 usage_00747.pdb 1 -EETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWIC 42 eeTpttcalcpVGcgItadTRsGEllRIraRevpevNEiWIc #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################