################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:53 2021 # Report_file: c_1199_86.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00140.pdb # 2: usage_00300.pdb # 3: usage_00301.pdb # 4: usage_00302.pdb # 5: usage_01461.pdb # 6: usage_01462.pdb # 7: usage_01878.pdb # 8: usage_02206.pdb # 9: usage_02207.pdb # # Length: 32 # Identity: 16/ 32 ( 50.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 16/ 32 ( 50.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 32 ( 31.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00140.pdb 1 EVILYQGRSYKAYRGMGSLGAMSLV-PEGIEG 31 usage_00300.pdb 1 EVILYQGRSYKAYRGM----------PEGIEG 22 usage_00301.pdb 1 EVILYQGRSYKAYRGM----------PEGIEG 22 usage_00302.pdb 1 EVILYQGRSYKAYRGM----------PEGIEG 22 usage_01461.pdb 1 AIEIYQGRSYKVYRGMGSLGAMAKFVPEGVEG 32 usage_01462.pdb 1 AIEIYQGRSYKVYRGMGSLGAMAV--PEGVEG 30 usage_01878.pdb 1 EVILYQGRSYKAYRGMGSLGAMSKLVPEGIEG 32 usage_02206.pdb 1 EVILYQGRSYKAYRGMGSLGAMSLV-PEGIEG 31 usage_02207.pdb 1 EVILYQGRSYKAYRGMGSLGAMSLV-PEGIEG 31 YQGRSYK YRGM PEG EG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################