################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:18:40 2021 # Report_file: c_1319_4.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00139.pdb # 2: usage_00667.pdb # 3: usage_00699.pdb # 4: usage_00700.pdb # 5: usage_00898.pdb # 6: usage_01094.pdb # 7: usage_01118.pdb # 8: usage_01568.pdb # 9: usage_02212.pdb # 10: usage_02213.pdb # # Length: 44 # Identity: 0/ 44 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 44 ( 20.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 44 ( 50.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00139.pdb 1 SAEQERKVLSYIEIGKNEGQLV-LG-GKRLEGEGYFIAPTVFT- 41 usage_00667.pdb 1 SAEQERKVLSYIEIGKNEGQLV-LG-GKRLEGEGYFIAPTVFTE 42 usage_00699.pdb 1 SAEQERKVLSYIEIGKNEGQLV-LG-GKRLEGEGYFIAPTVFT- 41 usage_00700.pdb 1 SAEQERKVLSYIEIGKNEGQLV-LG-GKRLEGEGYFIAPTVFT- 41 usage_00898.pdb 1 ----ADAVAHLE-------AGK--DYLEIEVGGRRLFFV----- 26 usage_01094.pdb 1 SAEQERKVLSYIEIGKNEGQLV-LG-GKRLEGEGYFIAPTVFT- 41 usage_01118.pdb 1 SAEQERKVLSYIEIGKNEGQLV-LG-GKRLEGEGYFIAPTVFT- 41 usage_01568.pdb 1 -VEAKQRLDAHIARMKTEARLHFAG---PAP-EGCFVAPHIFE- 38 usage_02212.pdb 1 SAEQERKVLSYIEIGKNEGQLV-LG-GKRLEGEGYFIAPTVFT- 41 usage_02213.pdb 1 SAEQERKVLSYIEIGKNEGQLV-LG-GKRLEGEGYFIAPTVFTE 42 v i l g eg f ap #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################