################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:37:45 2021 # Report_file: c_1061_2.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00075.pdb # 2: usage_00076.pdb # 3: usage_00077.pdb # 4: usage_00283.pdb # 5: usage_00284.pdb # 6: usage_00285.pdb # 7: usage_00286.pdb # # Length: 71 # Identity: 63/ 71 ( 88.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 63/ 71 ( 88.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 71 ( 11.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00075.pdb 1 GKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLK---- 56 usage_00076.pdb 1 GKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS 60 usage_00077.pdb 1 GKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS 60 usage_00283.pdb 1 GKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS 60 usage_00284.pdb 1 GKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS 60 usage_00285.pdb 1 GKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS 60 usage_00286.pdb 1 GKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS 60 GKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLK usage_00075.pdb 57 GEIHAMK---- 63 usage_00076.pdb 61 GEIHAMKRLVG 71 usage_00077.pdb 61 GEIHAMK---- 67 usage_00283.pdb 61 GEIHAMK---- 67 usage_00284.pdb 61 GEIHAMKRLVG 71 usage_00285.pdb 61 GEIHAMK---- 67 usage_00286.pdb 61 GEIHAMKRLVG 71 GEIHAMK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################