################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:04:49 2021 # Report_file: c_0943_45.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00437.pdb # 2: usage_00438.pdb # 3: usage_00439.pdb # 4: usage_00440.pdb # 5: usage_00441.pdb # 6: usage_00442.pdb # 7: usage_00443.pdb # 8: usage_00444.pdb # 9: usage_00445.pdb # 10: usage_00446.pdb # 11: usage_00447.pdb # 12: usage_00448.pdb # 13: usage_00450.pdb # 14: usage_00451.pdb # 15: usage_00452.pdb # 16: usage_00453.pdb # 17: usage_00454.pdb # 18: usage_00455.pdb # # Length: 33 # Identity: 30/ 33 ( 90.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 33 ( 90.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 33 ( 9.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00437.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00438.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00439.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00440.pdb 1 ---VVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 30 usage_00441.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00442.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00443.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00444.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00445.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00446.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00447.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00448.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00450.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00451.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00452.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00453.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00454.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 usage_00455.pdb 1 SDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS 33 VVVNMGAAHKNQAYRPLLLTTDNGIKAYHS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################