################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:27:51 2021 # Report_file: c_1188_63.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00336.pdb # 2: usage_00407.pdb # 3: usage_00578.pdb # 4: usage_00579.pdb # 5: usage_00701.pdb # 6: usage_00797.pdb # 7: usage_00886.pdb # 8: usage_00887.pdb # 9: usage_00888.pdb # 10: usage_00889.pdb # 11: usage_00890.pdb # 12: usage_00891.pdb # 13: usage_00892.pdb # 14: usage_00893.pdb # 15: usage_00894.pdb # # Length: 39 # Identity: 28/ 39 ( 71.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 39 ( 71.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 39 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00336.pdb 1 GEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQK--- 36 usage_00407.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKL 39 usage_00578.pdb 1 GEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQKRKL 39 usage_00579.pdb 1 GEGGIVVGRLRLRRGDPGVELKPGVREVVRVFVAQKRKL 39 usage_00701.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQK--- 36 usage_00797.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKL 39 usage_00886.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVA----- 34 usage_00887.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVA----- 34 usage_00888.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVA----- 34 usage_00889.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVA----- 34 usage_00890.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVA----- 34 usage_00891.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVA----- 34 usage_00892.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVA----- 34 usage_00893.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVY------- 32 usage_00894.pdb 1 GEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVA----- 34 GEGGIVV RLRRGDPGVELKPGVREVVRV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################