################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:44 2021 # Report_file: c_1074_28.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00355.pdb # 2: usage_00356.pdb # 3: usage_00363.pdb # 4: usage_00364.pdb # 5: usage_00373.pdb # 6: usage_00374.pdb # 7: usage_00411.pdb # 8: usage_00479.pdb # # Length: 68 # Identity: 10/ 68 ( 14.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 17/ 68 ( 25.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 17/ 68 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00355.pdb 1 -YHQAHTRGVKLIGATAHFVTADLDEGPIIAQDVEHVSHRDSAEDLVRKGRDIERRVLSR 59 usage_00356.pdb 1 PYHQAHTRGVKLIGATAHFVTADLDEGPIIAQDVEHVSHRDSAEDLVRKGRDIERRVLSR 60 usage_00363.pdb 1 PYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVSHRDSIENVRFGRDVE--KVLAR 58 usage_00364.pdb 1 PYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVSHRDSIENVRFGRDVE--KVLAR 58 usage_00373.pdb 1 -YHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISHRDTPADLVRKGRDIERRVLSR 59 usage_00374.pdb 1 -YHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISHRDTPADLVRKGRDIERRVLSR 59 usage_00411.pdb 1 THQRALDAGMKLAGCTVHLVTE-D-EGPILAQAAVPVLDGDTAETLAARVLKAE-H---- 53 usage_00479.pdb 1 THRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPL 60 qA G kl G t H VT l GPii Q D usage_00355.pdb 60 AVLLFLED 67 usage_00356.pdb 61 AVLLFLED 68 usage_00363.pdb 59 GLRAHLED 66 usage_00364.pdb 59 GLRAHLED 66 usage_00373.pdb 60 ALHYHLDD 67 usage_00374.pdb 60 ALHYHLDD 67 usage_00411.pdb -------- usage_00479.pdb 61 VISWFADG 68 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################