################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:32 2021 # Report_file: c_1319_115.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00237.pdb # 2: usage_00607.pdb # 3: usage_00608.pdb # 4: usage_00612.pdb # 5: usage_00765.pdb # 6: usage_00773.pdb # 7: usage_00806.pdb # 8: usage_01122.pdb # 9: usage_01939.pdb # 10: usage_01940.pdb # 11: usage_02293.pdb # 12: usage_02411.pdb # # Length: 34 # Identity: 4/ 34 ( 11.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 34 ( 26.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 34 ( 35.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00237.pdb 1 LPISRLYARYFQGDLKLYSMEGVGTDAVIYLKAL 34 usage_00607.pdb 1 LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 32 usage_00608.pdb 1 LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 32 usage_00612.pdb 1 LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 32 usage_00765.pdb 1 LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 32 usage_00773.pdb 1 LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 32 usage_00806.pdb 1 -PTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 31 usage_01122.pdb 1 --------KYFQGDLQLFSMEGFGTDAVIYLK-- 24 usage_01939.pdb 1 LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 32 usage_01940.pdb 1 LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 32 usage_02293.pdb 1 MDVVKNVVESLNGSMGIESEKDKGTKVTIR---- 30 usage_02411.pdb 1 LPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLR-- 32 y G l l S g GTd #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################