################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:48 2021 # Report_file: c_1084_115.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00833.pdb # 2: usage_00834.pdb # 3: usage_00953.pdb # 4: usage_00954.pdb # 5: usage_00955.pdb # 6: usage_00956.pdb # 7: usage_00957.pdb # 8: usage_00958.pdb # # Length: 49 # Identity: 23/ 49 ( 46.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 49 ( 46.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 49 ( 4.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00833.pdb 1 VFNLLGPLVNPLRPTGQVVGLFTPKLLTTVAQALDNLGKQKAIVLHGRE 49 usage_00834.pdb 1 VFNLLGPLVNPLRPTGQVVGLFTPKLLTTVAQALDNLGKQKAIVLHGRE 49 usage_00953.pdb 1 IFNVLGPLINPARPPKALIGVYSPELVLPIAQALKVLGYKNAAVVHG-- 47 usage_00954.pdb 1 IFNVLGPLINPARPPKALIGVYSPELVLPIAQALKVLGYKNAAVVHGG- 48 usage_00955.pdb 1 IFNVLGPLINPARPPKALIGVYSPELVLPIAQALKVLGYKNAAVVHGG- 48 usage_00956.pdb 1 IFNVLGPLINPARPPKALIGVYSPELVLPIAQALKVLGYKNAAVVHGG- 48 usage_00957.pdb 1 IFNVLGPLINPARPPKALIGVYSPELVLPIAQALKVLGYKNAAVVHGG- 48 usage_00958.pdb 1 IFNVLGPLINPARPPKALIGVYSPELVLPIAQALKVLGYKNAAVVHGG- 48 FN LGPL NP RP G P L AQAL LG A V HG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################