################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:52:27 2021 # Report_file: c_1066_32.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00335.pdb # 2: usage_00336.pdb # 3: usage_00337.pdb # 4: usage_00338.pdb # 5: usage_00357.pdb # 6: usage_00394.pdb # 7: usage_00395.pdb # 8: usage_00483.pdb # 9: usage_00484.pdb # 10: usage_00530.pdb # 11: usage_00544.pdb # 12: usage_00545.pdb # # Length: 45 # Identity: 30/ 45 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 45 ( 66.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 45 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00335.pdb 1 ----LNSFMRIREKYGDVFTVHLGPRPVVMLYGTEAIREALVDQA 41 usage_00336.pdb 1 ----LNSFMRIREKYGDVFTVHLGPRPVVMLYGTEAIREALVDQA 41 usage_00337.pdb 1 ----LNSFMRIREKYGDVFTVHLGPRPVVMLYGTEAIREALVDQA 41 usage_00338.pdb 1 ----LNSFMRIREKYGDVFTVHLGPRPVVMLYGTEAIREALVDQA 41 usage_00357.pdb 1 --GLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQA 43 usage_00394.pdb 1 ---LLKSFLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKA 42 usage_00395.pdb 1 ---LLKSFLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKA 42 usage_00483.pdb 1 --GLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQA 43 usage_00484.pdb 1 RKGLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQA 45 usage_00530.pdb 1 ---LLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQ- 41 usage_00544.pdb 1 ---LLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQA 42 usage_00545.pdb 1 --GLLRSFLRLREKYGDVFTVYLGSRPVVVLCGTDAIREALVDQA 43 L SF R REKYGDVFTV LG RPVV L G AIREALVD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################