################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:32:21 2021 # Report_file: c_1429_50.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00253.pdb # 2: usage_00254.pdb # 3: usage_00874.pdb # 4: usage_01159.pdb # 5: usage_01416.pdb # 6: usage_01722.pdb # # Length: 69 # Identity: 0/ 69 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 15/ 69 ( 21.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 29/ 69 ( 42.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00253.pdb 1 --------LPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHA 52 usage_00254.pdb 1 --------LPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHA 52 usage_00874.pdb 1 LGQQLAPHLPFLRRYGRALTGSQNQGDKYVRATLEAIVAAPDQFPRDVDPRLGLYRMFQG 60 usage_01159.pdb 1 --------LPYLRRFARSVTGSQSSGDAYVSAMLEALVADISIFPRASCDRIGTYWLFCH 52 usage_01416.pdb 1 ----------SRVALFGKL---NSLAYKAIEAATVFCKLRG-NPYV-------ELVHWFH 39 usage_01722.pdb 1 --------LPYIRRYARALTGDQATGDHYVRVALEALAAGELVLDANLSPRVALYRVFHA 52 rr r l q gd yv lea a y f usage_00253.pdb 53 IWL------ 55 usage_00254.pdb 53 IWLSSAGD- 60 usage_00874.pdb 61 IWASANADG 69 usage_01159.pdb 53 LFDQ----- 56 usage_01416.pdb 40 QILQ----- 43 usage_01722.pdb 53 I-------- 53 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################