################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:40 2021 # Report_file: c_0737_15.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00110.pdb # 2: usage_00114.pdb # 3: usage_00278.pdb # 4: usage_00302.pdb # 5: usage_00526.pdb # # Length: 75 # Identity: 33/ 75 ( 44.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 75 ( 54.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 75 ( 8.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00110.pdb 1 NTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWN 60 usage_00114.pdb 1 NTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWN 60 usage_00278.pdb 1 -TVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLI-KG--RKTVTAWD 56 usage_00302.pdb 1 GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLI-KG--RKTVTAWD 57 usage_00526.pdb 1 PIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQ-DG--EKKPIGWD 57 t V LPNKQRTVV vR Gms D L KALkvRGL CC V Rl K W usage_00110.pdb 61 TDAASLIGEELQV-- 73 usage_00114.pdb 61 TDAASLIGEELQVD- 74 usage_00278.pdb 57 TAIAPLDGEELIVE- 70 usage_00302.pdb 58 TAIAPLDGEELIVEV 72 usage_00526.pdb 58 TDISWLTGEELHVEV 72 T a L GEEL V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################