################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:50:10 2021 # Report_file: c_1212_3.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00921.pdb # 2: usage_01051.pdb # 3: usage_01052.pdb # 4: usage_01053.pdb # 5: usage_01054.pdb # 6: usage_01055.pdb # 7: usage_01056.pdb # 8: usage_01057.pdb # # Length: 69 # Identity: 38/ 69 ( 55.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 69 ( 55.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/ 69 ( 44.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00921.pdb 1 GLLGTMHPGFY------------------------RYYYAGGLSGGCTKAYLKLCTTICS 36 usage_01051.pdb 1 GLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICS 60 usage_01052.pdb 1 GLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICS 60 usage_01053.pdb 1 GLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICS 60 usage_01054.pdb 1 GLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICS 60 usage_01055.pdb 1 GLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICS 60 usage_01056.pdb 1 GLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICS 60 usage_01057.pdb 1 GLLGTMHPGFYNKPNSEFTYERRDASTAYIPEGEGRYYYAGGLSGGCTKAYLKLCTTICS 60 GLLGTMHPGFY RYYYAGGLSGGCTKAYLKLCTTICS usage_00921.pdb 37 WV------- 38 usage_01051.pdb 61 WVDRDATNH 69 usage_01052.pdb 61 WVDRDATNH 69 usage_01053.pdb 61 WVDRDATNH 69 usage_01054.pdb 61 WVDRDATNH 69 usage_01055.pdb 61 WVDRDATNH 69 usage_01056.pdb 61 WVDRDATNH 69 usage_01057.pdb 61 WVDRDATNH 69 WV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################