################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:17 2021 # Report_file: c_1261_362.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00368.pdb # 2: usage_01556.pdb # 3: usage_02103.pdb # 4: usage_02104.pdb # 5: usage_02105.pdb # 6: usage_02314.pdb # 7: usage_03517.pdb # 8: usage_03518.pdb # 9: usage_03589.pdb # 10: usage_03924.pdb # # Length: 31 # Identity: 2/ 31 ( 6.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 4/ 31 ( 12.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 31 ( 12.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00368.pdb 1 -RVIITGANGQLGKQLQEELNPEEYDIYPFD 30 usage_01556.pdb 1 -RTLITGASGQLGIELSRLLSERHEVIKVYN 30 usage_02103.pdb 1 -KILITGANGQLGREIQKQLKGKNVEVIPTD 30 usage_02104.pdb 1 -KILITGANGQLGREIQKQLKGKNVEVIPTD 30 usage_02105.pdb 1 -KILITGANGQLGREIQKQLKGKNVEVIPTD 30 usage_02314.pdb 1 MNILLFGKTGQVGWELQRSLAPVGNLIA-LD 30 usage_03517.pdb 1 -KILLIGASGTLGSAVKERLEKKAEVIT-AG 29 usage_03518.pdb 1 -KILLIGASGTLGSAVKERLEKKAEVIT-AG 29 usage_03589.pdb 1 -KIFIVGSTGRVGKSLLKSLSTTDYQIYAGA 30 usage_03924.pdb 1 --LDCGNS-GTAIRLLSGLLAGQPFNTVLTG 28 g G g L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################