################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:40:16 2021 # Report_file: c_0378_63.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00042.pdb # 2: usage_00197.pdb # 3: usage_00583.pdb # 4: usage_00717.pdb # 5: usage_00874.pdb # 6: usage_01011.pdb # 7: usage_01012.pdb # # Length: 92 # Identity: 73/ 92 ( 79.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 73/ 92 ( 79.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 92 ( 20.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00042.pdb 1 -QKEEVQLLVFGLTANS--HLLQG-QSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSV 56 usage_00197.pdb 1 DQKEEVQLLVFGLTANSDTHLLQG-QSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSV 59 usage_00583.pdb 1 --KEEVQLLVFGLTANS-------DQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSV 51 usage_00717.pdb 1 -QKEEVQLLVFGLTANSDTHLLQG-QSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSV 58 usage_00874.pdb 1 -QKEEVQLLVFGLTANSDTHLLQG-QSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSV 58 usage_01011.pdb 1 -QKEEVQLLVFGLTANSDTHLLQG-QSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSV 58 usage_01012.pdb 1 -QKEEVQLLVFGLTANSDTHLLQG-QSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSV 58 KEEVQLLVFGLTANS QSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSV usage_00042.pdb 57 SQLELQDSGTWTCTVLQNQKKVEFKID----- 83 usage_00197.pdb 60 SQLELQDSGTWTCTVLQNQKKVEFKIDIV--- 88 usage_00583.pdb 52 SQL---DSGTWTCTVLQNQKKVEFKI------ 74 usage_00717.pdb 59 SQLELQDSGTWTCTVLQNQKKVEFKIDIVVLA 90 usage_00874.pdb 59 SQLELQDSGTWTCTVLQNQKKVEFKIDIV--- 87 usage_01011.pdb 59 SQLELQDSGTWTCTVLQNQKKVEFKID----- 85 usage_01012.pdb 59 SQLELQDSGTWTCTVLQNQKKVEFKIDIVV-- 88 SQL DSGTWTCTVLQNQKKVEFKI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################