################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:33:57 2021 # Report_file: c_1144_2.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00020.pdb # 2: usage_00072.pdb # 3: usage_00074.pdb # 4: usage_00075.pdb # 5: usage_00076.pdb # 6: usage_00282.pdb # 7: usage_00283.pdb # 8: usage_00284.pdb # 9: usage_00612.pdb # 10: usage_00667.pdb # 11: usage_00902.pdb # # Length: 73 # Identity: 58/ 73 ( 79.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 73 ( 82.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 73 ( 13.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00020.pdb 1 TGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ 60 usage_00072.pdb 1 TGNYNYKYRFLRHGKLRPFERDISNVPFSPDGKPCTPPAFNCYWPLNDYGFYTTTGIGYQ 60 usage_00074.pdb 1 -----YKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPAPNCYWPLRGYGFYTTTGIGYQ 55 usage_00075.pdb 1 -----YKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPAPNCYWPLRGYGFYTTTGIGYQ 55 usage_00076.pdb 1 TGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ 60 usage_00282.pdb 1 TGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ 60 usage_00283.pdb 1 -----YKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ 55 usage_00284.pdb 1 TGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ 60 usage_00612.pdb 1 TGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ 60 usage_00667.pdb 1 TGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLKDYGFYTTSGIGYQ 60 usage_00902.pdb 1 TGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ 60 YKYRyLRHGKLRPFERDISNVPFSPDGKPCTPPA NCYWPL YGFYTTtGIGYQ usage_00020.pdb 61 PYRVVVLS----- 68 usage_00072.pdb 61 PYRVVVLSF---- 69 usage_00074.pdb 56 PYRVVVLS----- 63 usage_00075.pdb 56 PYRVVVLS----- 63 usage_00076.pdb 61 PYRVVVLSFE--- 70 usage_00282.pdb 61 PYRVVVLS----- 68 usage_00283.pdb 56 PYRVVVLSFELLN 68 usage_00284.pdb 61 PYRVVVLSFELLN 73 usage_00612.pdb 61 PYRVVVLSFE--- 70 usage_00667.pdb 61 PYRVVVLS----- 68 usage_00902.pdb 61 PYRVVVLS----- 68 PYRVVVLS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################