################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:04:51 2021 # Report_file: c_0305_17.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00026.pdb # 2: usage_00029.pdb # 3: usage_00076.pdb # 4: usage_00112.pdb # # Length: 130 # Identity: 67/130 ( 51.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 68/130 ( 52.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/130 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00026.pdb 1 --FD-ILTND----GTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNK 53 usage_00029.pdb 1 -LDFDILTND----GTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNK 55 usage_00076.pdb 1 IIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKD- 59 usage_00112.pdb 1 IIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKD- 59 f N R L L N FS QLP MPKEYI LVFD H K usage_00026.pdb 54 QKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADN 113 usage_00029.pdb 56 QKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADN 115 usage_00076.pdb 60 GRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADE 119 usage_00112.pdb 60 GRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADE 119 VIGGICFR Q F E F AVT NEQV GYGT LMN K K NI Y LTYAD usage_00026.pdb 114 FAIGYFKKQG 123 usage_00029.pdb 116 FAIGYFKKQG 125 usage_00076.pdb 120 YAIGYFKKQG 129 usage_00112.pdb 120 YAIGYFKKQG 129 AIGYFKKQG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################