################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:24 2021 # Report_file: c_1487_18.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01217.pdb # 2: usage_01318.pdb # 3: usage_01319.pdb # 4: usage_01320.pdb # 5: usage_01321.pdb # 6: usage_01532.pdb # 7: usage_01533.pdb # 8: usage_03015.pdb # 9: usage_03236.pdb # # Length: 41 # Identity: 0/ 41 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 4/ 41 ( 9.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 41 ( 43.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01217.pdb 1 ----KLELEQANERECEVLRKIWSSAQGIESMLKI------ 31 usage_01318.pdb 1 ----KLELEQANERECEVLRKIWSSAQGIESMLKYVE---- 33 usage_01319.pdb 1 ----KLELEQANERECEVLRKIWSSAQGIESMLKYVENK-- 35 usage_01320.pdb 1 ----KLELEQANERECEVLRKIWSSAQGIESMLKYVE---- 33 usage_01321.pdb 1 RCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKID 41 usage_01532.pdb 1 ----KMELEQANERECEVLKKIWGSAQGMDSMLKYLQR--- 34 usage_01533.pdb 1 ----KMELEQANERECEVLKKIWGSAQGMDS---------- 27 usage_03015.pdb 1 --------NDWMEKRKELLVPLFSTRTFLDRMIRLTKSA-E 32 usage_03236.pdb 1 ----QAELDKIKINQKADFISNLESSSDVAGLFADYLVQ-N 36 e e l s #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################