################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:50:16 2021 # Report_file: c_1344_4.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00157.pdb # 2: usage_00200.pdb # 3: usage_00201.pdb # 4: usage_00202.pdb # 5: usage_00235.pdb # 6: usage_00314.pdb # 7: usage_00494.pdb # 8: usage_00495.pdb # # Length: 39 # Identity: 27/ 39 ( 69.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 39 ( 82.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 39 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00157.pdb 1 -TFNE-RKLDASHVVVFCAKTA-DDAWLERVVDQEDADG 36 usage_00200.pdb 1 YVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADG 39 usage_00201.pdb 1 -YVFNERKLDASHVVVFCAKTA-DDVWLKLVVDQEDADG 37 usage_00202.pdb 1 YVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADG 39 usage_00235.pdb 1 -VFSERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADG 38 usage_00314.pdb 1 -VFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADG 38 usage_00494.pdb 1 -VFSERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADG 38 usage_00495.pdb 1 -VFSERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADG 38 f e LDASHVVVFCAKTA DDvWLklVVDQEDADG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################