################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:14:07 2021 # Report_file: c_1387_66.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00185.pdb # 2: usage_00186.pdb # 3: usage_00194.pdb # 4: usage_00204.pdb # 5: usage_00205.pdb # 6: usage_01422.pdb # 7: usage_01423.pdb # 8: usage_01425.pdb # 9: usage_01426.pdb # 10: usage_01834.pdb # 11: usage_02461.pdb # 12: usage_02462.pdb # 13: usage_02464.pdb # 14: usage_02465.pdb # # Length: 43 # Identity: 25/ 43 ( 58.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 43 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 43 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00185.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_00186.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_00194.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_00204.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_00205.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_01422.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_01423.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_01425.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_01426.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_01834.pdb 1 GYHISEAGSSPLQEAAFTLANLITYVNEVTKTGMHVDEFAPRL 43 usage_02461.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_02462.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_02464.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 usage_02465.pdb 1 GYHIAEAGANPISQLAFTLANGFTYVEAYLARGMHIDDFAPNL 43 GYHIaEAGanPisqlAFTLANgfTYVeaylarGMHiDdFAPnL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################