################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:59 2021 # Report_file: c_1297_123.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00882.pdb # 2: usage_00966.pdb # 3: usage_01065.pdb # 4: usage_01067.pdb # 5: usage_01068.pdb # 6: usage_01069.pdb # 7: usage_01070.pdb # 8: usage_03028.pdb # 9: usage_03029.pdb # # Length: 31 # Identity: 7/ 31 ( 22.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 31 ( 90.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 31 ( 9.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00882.pdb 1 ADNVAPAIFGGFTMVTNY-EPLEVLHIPID- 29 usage_00966.pdb 1 -DNVAPAVLGNWVVGAKLDGEDFYVRHLFP- 29 usage_01065.pdb 1 ADNVAPAIFGGFTMVTNY-EPLEVLHIPIDF 30 usage_01067.pdb 1 ADNVAPAIFGGFTMVTNY-EPLEVLHIPIDF 30 usage_01068.pdb 1 ADNVAPAIFGGFTMVTNY-EPLEVLHIPID- 29 usage_01069.pdb 1 ADNVAPAIFGGFTMVTNY-EPLEVLHIPID- 29 usage_01070.pdb 1 ADNVAPAIFGGFTMVTNY-EPLEVLHIPIDF 30 usage_03028.pdb 1 -DNVAPAIFGGFTMVTNY-EPLEVLHIPIDF 29 usage_03029.pdb 1 ADNVAPAIFGGFTMVTNY-EPLEVLHIPIDF 30 DNVAPAifGgftmvtny eplevlhipid #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################