################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:16:05 2021 # Report_file: c_0992_38.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00044.pdb # 2: usage_00047.pdb # 3: usage_00048.pdb # 4: usage_00084.pdb # 5: usage_00085.pdb # 6: usage_00086.pdb # 7: usage_00224.pdb # 8: usage_00262.pdb # 9: usage_00263.pdb # 10: usage_00264.pdb # 11: usage_00398.pdb # 12: usage_00441.pdb # 13: usage_00442.pdb # 14: usage_00666.pdb # # Length: 39 # Identity: 4/ 39 ( 10.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 39 ( 23.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 39 ( 17.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00044.pdb 1 -----TAHDYDVVIIGGGPAGLTAAIYTGRAQLSTLILE 34 usage_00047.pdb 1 -------NPYDVVVIGGGPGGYVASIKAAQLGMKTACVE 32 usage_00048.pdb 1 -------NPYDVVVIGGGPGGYVASIKAAQLGMKTACVE 32 usage_00084.pdb 1 ------AIETETLVVGAGPGGYVAAIRAAQLGQKVTIVE 33 usage_00085.pdb 1 -----TEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVE 34 usage_00086.pdb 1 -----TEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVE 34 usage_00224.pdb 1 -------THYDVVVLGAGPGGYVAAIRAAQLGLSTAIVE 32 usage_00262.pdb 1 -------THYDVVVLGAGPGGYVAAIRAAQLGLSTAIVE 32 usage_00263.pdb 1 -----SMTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVE 34 usage_00264.pdb 1 -----SMTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVE 34 usage_00398.pdb 1 ------SQKFDVIVIGAGPGGYVAAIKSAQLGLKTALIE 33 usage_00441.pdb 1 -------THYDVVVLGAGPGGYVAAIRAAQLGLSTAIVE 32 usage_00442.pdb 1 -------THYDVVVLGAGPGGYVAAIRAAQLGLSTAIVE 32 usage_00666.pdb 1 AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVT 39 v G Gp G A g t e #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################