################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:57:03 2021 # Report_file: c_0849_60.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00133.pdb # 2: usage_00252.pdb # 3: usage_00253.pdb # 4: usage_00254.pdb # 5: usage_00374.pdb # 6: usage_00623.pdb # 7: usage_00624.pdb # 8: usage_00641.pdb # # Length: 66 # Identity: 35/ 66 ( 53.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 66 ( 54.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 66 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00133.pdb 1 GAFQDAIVAGLKESAAKGNSLKVRILVGAAPHMN-----GIPSKYRDKLTAKLGKAAENI 55 usage_00252.pdb 1 GAFQDAIVAGLKESAAKGNKLKVRILVGA----------VIPSKYRDELTAKLGKAAENI 50 usage_00253.pdb 1 GAFQDAIVAGLKESAAKGNKLKVRILVGAAP--------VIPSKYRDELTAKLGKAAENI 52 usage_00254.pdb 1 GAFQDAIVAGLKESAAKGNKLKVRILVGAAP--------VIPSKYRDELTAKLGKAAENI 52 usage_00374.pdb 1 GGFEDAVVDGLKASVAAGHSPRVRILVGAAPI--YHLNV-VPSRYRDELIGKLGAAAGKV 57 usage_00623.pdb 1 GAFQDAIVAGLKESAAKGNKLKVRILVGAA---------VIPSKYRDELTAKLGKAAENI 51 usage_00624.pdb 1 GAFQDAIVAGLKESAAKGNKLKVRILVGAAP-MN-----VIPSKYRDELTAKLGKAAENI 54 usage_00641.pdb 1 GGFEDAVVDGLKASVAAGHSPRVRILVGAAPI--YHLNV-VPSRYRDELIGKLGAAAGKV 57 G F DA V GLK S A G VRILVGA PS YRDeL KLG AA usage_00133.pdb 56 TLNVAS 61 usage_00252.pdb 51 TLNVAS 56 usage_00253.pdb 53 TLNVAS 58 usage_00254.pdb 53 TLNVAS 58 usage_00374.pdb 58 TLNVAS 63 usage_00623.pdb 52 TLNVAS 57 usage_00624.pdb 55 TLNVAS 60 usage_00641.pdb 58 TLNVAS 63 TLNVAS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################