################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:28:50 2021 # Report_file: c_1410_68.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00117.pdb # 2: usage_00320.pdb # 3: usage_00321.pdb # 4: usage_00322.pdb # 5: usage_00448.pdb # 6: usage_00564.pdb # 7: usage_00570.pdb # 8: usage_00826.pdb # 9: usage_01161.pdb # 10: usage_01374.pdb # 11: usage_01375.pdb # 12: usage_01406.pdb # 13: usage_01417.pdb # 14: usage_01420.pdb # 15: usage_01421.pdb # # Length: 32 # Identity: 9/ 32 ( 28.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 32 ( 65.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 32 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00117.pdb 1 SAPLALLHKILVENPSARITIPDIKKDRWYNK 32 usage_00320.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_00321.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_00322.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_00448.pdb 1 TDCENLLKKFLILNPSKRGTLEQIMKDRWMNV 32 usage_00564.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_00570.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_00826.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_01161.pdb 1 AEVKFLIHRILDPNPKTRIQIQGIKKDPWFRK 32 usage_01374.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_01375.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_01406.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_01417.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_01420.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 usage_01421.pdb 1 --PLALLHKILVENPSARITIPDIKKDRWYNK 30 LlhkiL NPs Riti IkKDrW nk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################