################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:46 2021 # Report_file: c_1480_21.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_01341.pdb # 2: usage_01342.pdb # 3: usage_01344.pdb # 4: usage_03124.pdb # 5: usage_03125.pdb # 6: usage_03773.pdb # 7: usage_03774.pdb # # Length: 62 # Identity: 53/ 62 ( 85.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 53/ 62 ( 85.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 62 ( 14.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01341.pdb 1 MSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQ------- 53 usage_01342.pdb 1 MSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQQQ 60 usage_01344.pdb 1 MSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQ--- 57 usage_03124.pdb 1 MSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQ-- 58 usage_03125.pdb 1 MSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQQ- 59 usage_03773.pdb 1 MSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQ-- 58 usage_03774.pdb 1 MSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQQH 60 MSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQ usage_01341.pdb -- usage_01342.pdb 61 Q- 61 usage_01344.pdb -- usage_03124.pdb -- usage_03125.pdb -- usage_03773.pdb -- usage_03774.pdb 61 -Q 61 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################