################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:27 2021 # Report_file: c_1124_29.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00048.pdb # 2: usage_00049.pdb # 3: usage_00106.pdb # 4: usage_00161.pdb # 5: usage_00165.pdb # 6: usage_00264.pdb # 7: usage_00284.pdb # # Length: 79 # Identity: 13/ 79 ( 16.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 79 ( 41.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 79 ( 13.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00048.pdb 1 ------QSEARRRILETAWRLIARRGYHNVRIHDIASELGTSNATIHYHFPSKKDILLEA 54 usage_00049.pdb 1 ------QSEARRRILETAWRLIARRGYHNVRIHDIASELGTSNATIHYHFPSKKDILLEA 54 usage_00106.pdb 1 ------QSEARRRILETAWRLIARRGYHNVRIHDIASELGTSNATIHYHFPSKKDILLEA 54 usage_00161.pdb 1 ------QSEARRRILETAWRLIARRGYHNVRIHDIASELGTSNATIHYHFPSKKDILLEA 54 usage_00165.pdb 1 -------DERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAA 53 usage_00264.pdb 1 -------SEARRRILETAWRLIARRGYHNVRIHDIASELGTSNATIHYHFPSKKDILLEA 53 usage_00284.pdb 1 VPKLVDHDERRRSITAAAWRLIAARGIEAANMRDIATEAGYTNGALSHYFAGKDEILRTS 60 E RR i awrLIArrG v diA E G sn F sk iLl a usage_00048.pdb 55 LRRNVKLAFDRQVAELHTI 73 usage_00049.pdb 55 LRRNVKLAFDRQVAE---- 69 usage_00106.pdb 55 LRRNVKLAFDRQVAEL--- 70 usage_00161.pdb 55 LRRNVKLAFDRQVAELH-- 71 usage_00165.pdb 54 LRRAGDIQGDRYRTILDE- 71 usage_00264.pdb 54 LRRNVKLAFDRQVAE---- 68 usage_00284.pdb 61 YEHISEATDRRIAEAL--- 76 lrr dR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################