################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:10:10 2021 # Report_file: c_1445_8.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_04110.pdb # 2: usage_04111.pdb # 3: usage_04112.pdb # 4: usage_04113.pdb # 5: usage_04114.pdb # 6: usage_07879.pdb # 7: usage_10399.pdb # 8: usage_10400.pdb # 9: usage_10404.pdb # 10: usage_10405.pdb # # Length: 34 # Identity: 6/ 34 ( 17.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 34 ( 88.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 34 ( 8.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_04110.pdb 1 SSAVNFQSFRIQDR-PETLKGGEMPRFIDGILLD 33 usage_04111.pdb 1 SSAVNFQSFRIQDR-PETLKGGEMPRFIDGILLD 33 usage_04112.pdb 1 SSAVNFQSFRIQDR-PETLKGGEMPRFIDGILLD 33 usage_04113.pdb 1 SSAVNFQSFRIQDR-PETLKGGEMPRFIDGILLD 33 usage_04114.pdb 1 SSAVNFQSFRIQDR-PETLKGGEMPRFIDGILLD 33 usage_07879.pdb 1 CSFADKQVIKLQETPDFV-PDGQTPHSISLCVYD 33 usage_10399.pdb 1 SSFVNFQSFRIQDR-PETLKGGEMPRFIDGILL- 32 usage_10400.pdb 1 SSFVNFQSFRIQDR-PETLKGGEMPRFIDGILL- 32 usage_10404.pdb 1 SSFVNFQSFRIQDR-PETLKGGEMPRFIDGILLD 33 usage_10405.pdb 1 SSFVNFQSFRIQDR-PETLKGGEMPRFIDGILLD 33 sS vnfQsfriQdr pet kgGemPrfIdgill #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################