################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:55 2021 # Report_file: c_0699_102.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00493.pdb # 2: usage_01028.pdb # 3: usage_01031.pdb # 4: usage_01032.pdb # 5: usage_01033.pdb # 6: usage_01034.pdb # 7: usage_01035.pdb # # Length: 73 # Identity: 20/ 73 ( 27.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 73 ( 35.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 73 ( 17.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00493.pdb 1 --NYTLSANTYFHLHTRFR---SHGPKYAELVLDNPLDREAQPEVNLTITAVDGGSPPKS 55 usage_01028.pdb 1 -LTYRLSTNEHFSLDVPPN---V---KPLGLVLRKPLDREEAAEIRLLLTATDGGKPELT 53 usage_01031.pdb 1 VLTYRLSPNDYFSLEKPSNDERVK---GLGLVLRKSLDREETPEIILVLTVTDGGKPELT 57 usage_01032.pdb 1 --NYTVSPNLHFHVVTLSR-S-DGR-KYPELVLDRALDREEQPELTLILTALDGGAPPKS 55 usage_01033.pdb 1 --NYTVSPNLHFHVVTLSR-S-DGR-KYPELVLDRALDREEQPELTLILTALDGGAPPKS 55 usage_01034.pdb 1 --NYTVSPNLHFHVVTLSR-S-DDR-KYPELVLDRALDREEQPELTLILTALDGGAPPKS 55 usage_01035.pdb 1 --NYTVSPNLHFHVVTLSR-S-DDR-KYPELVLDRALDREEQPELTLILTALDGGAPPKS 55 Y S N F LVL LDREe pE L lTa DGG P usage_00493.pdb 56 GTANIRVVVLDVN 68 usage_01028.pdb 54 GTVQLLITVLD-- 64 usage_01031.pdb 58 GSVQLLITVLDAN 70 usage_01032.pdb 56 GTTTVRIEVVDIN 68 usage_01033.pdb 56 GTTTVRIEVVDIN 68 usage_01034.pdb 56 GTTTVRIEV---- 64 usage_01035.pdb 56 GTTTVRIEVVDIN 68 Gt i V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################