################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:02:45 2021 # Report_file: c_0930_33.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00005.pdb # 2: usage_00006.pdb # 3: usage_00056.pdb # 4: usage_00066.pdb # 5: usage_00412.pdb # 6: usage_00516.pdb # 7: usage_00591.pdb # 8: usage_00592.pdb # 9: usage_00640.pdb # 10: usage_00641.pdb # 11: usage_00663.pdb # 12: usage_00664.pdb # 13: usage_00665.pdb # # Length: 60 # Identity: 21/ 60 ( 35.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 60 ( 58.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 60 ( 16.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHH---- 56 usage_00006.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVY------- 53 usage_00056.pdb 1 ---FSVLACYNGSPSGVYQCAMRPNHTIKGAFLNGSCGSVGFNIDYDCVSFCYMHHMELP 57 usage_00066.pdb 1 ---FNILACYDGAAAGVYGVNMRSNYTIRGSFINGACGSPGYNINNGTVEFCY------- 50 usage_00412.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHH---- 56 usage_00516.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVY------- 53 usage_00591.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHH---- 56 usage_00592.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVY------- 53 usage_00640.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVY------- 53 usage_00641.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHH---- 56 usage_00663.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVY------- 53 usage_00664.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHH---- 56 usage_00665.pdb 1 GESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVY------- 53 FniLACY G p VYgvnMRs TIkGsFi G CGSvGy ng F Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################