################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:40:07 2021
# Report_file: c_1317_97.html
################################################################################################
#====================================
# Aligned_structures: 11
#   1: usage_00085.pdb
#   2: usage_00130.pdb
#   3: usage_00131.pdb
#   4: usage_00183.pdb
#   5: usage_00268.pdb
#   6: usage_00288.pdb
#   7: usage_00369.pdb
#   8: usage_00370.pdb
#   9: usage_00400.pdb
#  10: usage_00401.pdb
#  11: usage_00607.pdb
#
# Length:         30
# Identity:        4/ 30 ( 13.3%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      6/ 30 ( 20.0%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            2/ 30 (  6.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00085.pdb         1  WRHQIDEFSN-DFHTVALDLRGYNLSEKPS   29
usage_00130.pdb         1  WRYQIPALAQAGFRVLAIDMKGYGDSSSPP   30
usage_00131.pdb         1  WRYQIPALAQAGFRVLAIDMKGYGDSSSPP   30
usage_00183.pdb         1  WRYQIPALAQAGYRVLAMDMKGYGESSAPP   30
usage_00268.pdb         1  WRLTIPALSK-FYRVIAPDMVGFGFTDRPE   29
usage_00288.pdb         1  -RHIFRRLHG-HGRLLAVDLIGYGQSSKPD   28
usage_00369.pdb         1  WRKVAPTLAQ-NHTVILPDLRGYGDSDKPT   29
usage_00370.pdb         1  WRKVAPTLAQ-NHTVILPDLRGYGDSDKPT   29
usage_00400.pdb         1  WRHQIPALVDAGYHVMAPDQRGYGGSSAPE   30
usage_00401.pdb         1  WRHQIPALVDAGYHVMAPDQRGYGGSSAPE   30
usage_00607.pdb         1  -RNIIPHVAP-SHRCIAPDLIGMGKSDKPD   28
                            R                D  G g s  P 


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################