################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:28:22 2021 # Report_file: c_1382_109.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00101.pdb # 2: usage_00197.pdb # 3: usage_00287.pdb # 4: usage_00513.pdb # 5: usage_00679.pdb # 6: usage_00696.pdb # 7: usage_01265.pdb # 8: usage_01739.pdb # 9: usage_01740.pdb # 10: usage_01742.pdb # # Length: 32 # Identity: 5/ 32 ( 15.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 13/ 32 ( 40.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 32 ( 28.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00101.pdb 1 KWFPSCQFLLRSKGRDFVHSVQETHS------ 26 usage_00197.pdb 1 KWFPSCQFLLRSKGRDFVHSVQETHS------ 26 usage_00287.pdb 1 LWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKE 32 usage_00513.pdb 1 KWFPRCEFLIRMKGQEFVDEIQG--------- 23 usage_00679.pdb 1 KWFPRCEFLIRMKGQEFVDEIQG--------- 23 usage_00696.pdb 1 KWFPRCEFLIRMKGQEFVDEIQG--------- 23 usage_01265.pdb 1 KWFPRCEFLIRMKGQEFVDEIQG--------- 23 usage_01739.pdb 1 KWFPRCEFLIRMKGQEFVDEIQGRY------- 25 usage_01740.pdb 1 KWFPRCEFLIRMKGQEFVDEIQGRY------- 25 usage_01742.pdb 1 KWFPRCEFLIRMKGQEFVDEIQGRY------- 25 kWfp C Fl r KG fv q #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################