################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:16 2021 # Report_file: c_1164_181.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00016.pdb # 2: usage_00017.pdb # 3: usage_00235.pdb # 4: usage_00238.pdb # 5: usage_00274.pdb # 6: usage_00885.pdb # 7: usage_01532.pdb # # Length: 37 # Identity: 11/ 37 ( 29.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 37 ( 32.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 37 ( 10.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00016.pdb 1 LNWLTHLNFKYPALNVTMPNNEQFDKLYIWGVHHPGT 37 usage_00017.pdb 1 LNWLTHLNFKYPALNVTMPNNEQFDKLYIWGVHHPGT 37 usage_00235.pdb 1 VVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIH---- 33 usage_00238.pdb 1 VVWLIKKDSTYPTIKRSYNNTNQEDLLVLWGIH---- 33 usage_00274.pdb 1 VVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIHHP-- 35 usage_00885.pdb 1 VVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPND 37 usage_01532.pdb 1 VVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIH---- 33 WL n YP N Q D L WG H #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################