################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:29 2021 # Report_file: c_0738_3.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00057.pdb # 2: usage_00111.pdb # 3: usage_00112.pdb # 4: usage_00167.pdb # 5: usage_00337.pdb # 6: usage_00465.pdb # 7: usage_00466.pdb # 8: usage_00529.pdb # 9: usage_00530.pdb # # Length: 72 # Identity: 48/ 72 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 49/ 72 ( 68.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 72 ( 31.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00057.pdb 1 ECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQ 60 usage_00111.pdb 1 ECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQ 60 usage_00112.pdb 1 ECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQ 60 usage_00167.pdb 1 ECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQ 60 usage_00337.pdb 1 ECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLA------- 53 usage_00465.pdb 1 ECFITGWGET---FGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQ 57 usage_00466.pdb 1 ECFITGWGET---FGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQ 57 usage_00529.pdb 1 ECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQ 60 usage_00530.pdb 1 ECFITGWGE----FGAGLLMEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQ 56 ECFITGWGE FGAGLLkEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLA usage_00057.pdb 61 GDAGGPLVCFEK 72 usage_00111.pdb 61 GDAGGPLVCFEK 72 usage_00112.pdb 61 GDAGGPLVCFEK 72 usage_00167.pdb 61 GDSGGPLVCFEK 72 usage_00337.pdb ------------ usage_00465.pdb 58 GDSGGPLVCFEK 69 usage_00466.pdb 58 GDSGGPLVCFEK 69 usage_00529.pdb 61 GDSGGPLVCFEK 72 usage_00530.pdb 57 GDSGGPLVCFEK 68 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################