################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:20 2021 # Report_file: c_1208_40.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00090.pdb # 2: usage_00091.pdb # 3: usage_00093.pdb # 4: usage_01292.pdb # 5: usage_01676.pdb # 6: usage_02288.pdb # 7: usage_02444.pdb # # Length: 65 # Identity: 20/ 65 ( 30.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 65 ( 49.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 65 ( 12.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00090.pdb 1 GPLIVYPLNKSMWDDGMSAATPSEDVFYAVSLLFSSV--APN---DLARLQEQNRRILRF 55 usage_00091.pdb 1 GPLIVYPLNKSMWDDGMSAATPSEDVFYAVSLLFSSV--APN---DLARLQEQNRRILRF 55 usage_00093.pdb 1 GPLIVYPLNKSMWDDGMSAATPSEDVFYAVSLLFSSV--APN---DLARLQEQNRRILRF 55 usage_01292.pdb 1 GPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPE---SLEALARQNQRILDF 57 usage_01676.pdb 1 GPLIVYPLNKSMWDDGMSAATPSEDVFYAVSLLFSSV--APN---DLARLQEQNRRILRF 55 usage_02288.pdb 1 GPILLYPVNKSKWDNKTSVVIPDEEIFYLVGFLSSAP--SLSGHGSIAHAMSLNSQIVEF 58 usage_02444.pdb 1 GPLIVYPLNKSMWDDGMSAATPSEDVFYAVSLLFSSV--APN---DLARLQEQNRRILRF 55 GP YP NKs WD Sa tP E vFY V L S ap la l qN rIl F usage_00090.pdb 56 CDLAG 60 usage_00091.pdb 56 CDLAG 60 usage_00093.pdb 56 CDLAG 60 usage_01292.pdb 58 CAGTG 62 usage_01676.pdb 56 CDLAG 60 usage_02288.pdb 59 CE--- 60 usage_02444.pdb 56 CDLAG 60 C #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################