################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:04:34 2021 # Report_file: c_0800_9.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00087.pdb # 2: usage_00088.pdb # 3: usage_00089.pdb # 4: usage_00090.pdb # 5: usage_00091.pdb # 6: usage_00093.pdb # 7: usage_00094.pdb # 8: usage_00192.pdb # 9: usage_00193.pdb # # Length: 72 # Identity: 56/ 72 ( 77.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 56/ 72 ( 77.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 72 ( 20.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00087.pdb 1 NLSFIYLKGDFDVIESRLKARKGHFFK--TQMLVTQFETLQEPGADETDVLVVDIDQPLE 58 usage_00088.pdb 1 NLSFIYLKGDFDVIESRL-----------TQMLVTQFETLQEPGADETDVLVVDIDQPLE 49 usage_00089.pdb 1 NLSFIYLKGDFDVIESRL-----------KTQLVTQFETLQEPGADETDVLVVDIDQPLE 49 usage_00090.pdb 1 NLSFIYLKGDFDVIESRLK--------AR--QLVTQFETLQEPGADETDVLVVDIDQPLE 50 usage_00091.pdb 1 NLSFIYLKGDFDVIESRLK----HFFK--TQMLVTQFETLQEPGADETDVLVVDIDQPLE 54 usage_00093.pdb 1 NLSFIYLKGDFDVIESRLKARKGHFFK--TQMLVTQFETLQEPGADETDVLVVDIDQPLE 58 usage_00094.pdb 1 NLSFIYLKGDFDVIESRLKARKGHFFK--TQMLVTQFETLQEPGADETDVLVVDIDQPLE 58 usage_00192.pdb 1 NLSFIYLKGDFDVIESRLKARKGHFFK--TQMLVTQFETLQEPGADETDVLVVDIDQPLE 58 usage_00193.pdb 1 NLSFIYLKGDFDVIESRLKARKGHFFK--TQMLVTQFETLQEPGADETDVLVVDIDQPLE 58 NLSFIYLKGDFDVIESRL LVTQFETLQEPGADETDVLVVDIDQPLE usage_00087.pdb 59 GVVASTIEVI-- 68 usage_00088.pdb 50 GVVASTIEVI-- 59 usage_00089.pdb 50 GVVASTIEVIK- 60 usage_00090.pdb 51 GVVASTIEVIKK 62 usage_00091.pdb 55 GVVASTIEVIK- 65 usage_00093.pdb 59 GVVASTIEVIK- 69 usage_00094.pdb 59 GVVASTIEVI-- 68 usage_00192.pdb 59 GVVASTIEVI-- 68 usage_00193.pdb 59 GVVASTIEVI-- 68 GVVASTIEVI #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################