################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:39 2021 # Report_file: c_0788_48.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00071.pdb # 2: usage_00159.pdb # 3: usage_00160.pdb # 4: usage_00302.pdb # 5: usage_00397.pdb # 6: usage_00502.pdb # # Length: 64 # Identity: 15/ 64 ( 23.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 64 ( 34.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 64 ( 3.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00071.pdb 1 ILCATDEPGLTPGVERVLRAVAQAHKRTGAPISTHTHAGLRRGLDQQRIFAEEGVDLSRV 60 usage_00159.pdb 1 -VIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKI 59 usage_00160.pdb 1 -VIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKI 59 usage_00302.pdb 1 -IVAT-TGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRV 58 usage_00397.pdb 1 FVAVIDSSGLTKDVEMAIRAAAKAHIKTDVPIITHSFVGNKSSLDLIRIFKEEGVDLART 60 usage_00502.pdb 1 -IVAT-TGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRV 58 a T E v AaA A T vP TH a g q I EG usage_00071.pdb 61 VIGH 64 usage_00159.pdb 60 LIGH 63 usage_00160.pdb 60 LIGH 63 usage_00302.pdb 59 CIGH 62 usage_00397.pdb 61 VIGH 64 usage_00502.pdb 59 CIGH 62 IGH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################