################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:29:12 2021 # Report_file: c_1481_32.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_01708.pdb # 2: usage_01810.pdb # 3: usage_01811.pdb # 4: usage_01812.pdb # 5: usage_01813.pdb # 6: usage_01814.pdb # 7: usage_01815.pdb # 8: usage_01816.pdb # 9: usage_01817.pdb # 10: usage_01818.pdb # 11: usage_01819.pdb # 12: usage_01820.pdb # 13: usage_01821.pdb # 14: usage_01824.pdb # 15: usage_01825.pdb # # Length: 40 # Identity: 37/ 40 ( 92.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 40 ( 92.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 40 ( 7.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01708.pdb 1 --LAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 37 usage_01810.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01811.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01812.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01813.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01814.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01815.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01816.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01817.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01818.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01819.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01820.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01821.pdb 1 GELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH- 39 usage_01824.pdb 1 -ELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKHA 39 usage_01825.pdb 1 -ELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKHA 39 LAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKH #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################