################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:13:06 2021 # Report_file: c_1415_166.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00106.pdb # 2: usage_00107.pdb # 3: usage_00108.pdb # 4: usage_00109.pdb # 5: usage_00347.pdb # 6: usage_01217.pdb # 7: usage_01218.pdb # 8: usage_01323.pdb # 9: usage_01324.pdb # # Length: 63 # Identity: 34/ 63 ( 54.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 63 ( 54.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 63 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00106.pdb 1 SAATLKLIYGDLEAQLNDKPEVKSMIEKLTGTISQLIGYELLEHEMDLEEDGIIVQELFK 60 usage_00107.pdb 1 SAATLKLIYGDLEAQLNDKPEVKSMIEKLTGTISQLIGYELLEHEMDLEEDGIIVQELFK 60 usage_00108.pdb 1 SAATLKLIYGDLEAQLNDKPEVKSMIEKLTGTISQLIGYELLEHEMDLEEDGIIVQELFK 60 usage_00109.pdb 1 SAATLKLIYGDLEAQLNDKPEVKSMIEKLTGTISQLIGYELLEHEMDLEEDGIIVQELFK 60 usage_00347.pdb 1 SSTILKLIHADLESQFNEKPEVKSMIDKLVATITELIVFECLENELDLEYDEITILELIK 60 usage_01217.pdb 1 SAPILKLIHGDLENQFNEKPEVKSMVEKLAATITELIAFECLENELDLEYDEITILELIK 60 usage_01218.pdb 1 -APILKLIHGDLENQFNEKPEVKSMVEKLAATITELIAFECLENELDLEYDEITILELIK 59 usage_01323.pdb 1 SSTILKLIHADLESQFNEKPEVKS-IDKLVATITELIVFECLENELDLEYDEITILELIK 59 usage_01324.pdb 1 SSTILKLIHADLESQFNEKPEVKS-IDKLVATITELIVFECLENELDLEYDEITILELIK 59 LKLI DLE Q N KPEVKS KL TI LI E LE E DLE D I EL K usage_00106.pdb 61 AL- 62 usage_00107.pdb 61 AL- 62 usage_00108.pdb 61 AL- 62 usage_00109.pdb 61 ALG 63 usage_00347.pdb 61 SLG 63 usage_01217.pdb 61 AL- 62 usage_01218.pdb 60 AL- 61 usage_01323.pdb 60 SL- 61 usage_01324.pdb 60 SL- 61 L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################