################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:27:51 2021 # Report_file: c_0385_14.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00189.pdb # 2: usage_00225.pdb # 3: usage_00404.pdb # 4: usage_00405.pdb # 5: usage_00521.pdb # 6: usage_00522.pdb # # Length: 79 # Identity: 48/ 79 ( 60.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 62/ 79 ( 78.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 79 ( 20.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00189.pdb 1 GTKSVTRPTRSSAEITCDLTVINA-FYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSP 59 usage_00225.pdb 1 --KSVIRQTGSSAEITCDLA---STGYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISP 55 usage_00404.pdb 1 ---SVIRQTGSSAEITCDL------GYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISP 51 usage_00405.pdb 1 ---SVIRQTGSSAEITCDL------GYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISP 51 usage_00521.pdb 1 --KSVIRQTGSSAEITCDLAEGST-GYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISP 57 usage_00522.pdb 1 --KSVIRQTGSSAEITCDLAEGST-GYIHWYLHQEGKAPQRLLYYDSYTSSVVLESGISP 57 SViRqTgSSAEITCDL gYIHWYLHQEGKAPQRLLYYDsytSsvVLESGiSP usage_00189.pdb 60 GKYYTHTPRRWSWILILRN 78 usage_00225.pdb 56 GKYDTYGSN---LRMILR- 70 usage_00404.pdb 52 GKYDTYGSKN--LRMILRN 68 usage_00405.pdb 52 GKYDTN------LRMILRN 64 usage_00521.pdb 58 GKYDTYGSTRKNLRMILRN 76 usage_00522.pdb 58 GKYDTYGSTRKNLRMILRN 76 GKYdT lrmILR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################