################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:48 2021 # Report_file: c_1104_32.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00298.pdb # 2: usage_00301.pdb # 3: usage_00303.pdb # 4: usage_00306.pdb # 5: usage_00589.pdb # # Length: 121 # Identity: 41/121 ( 33.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/121 ( 33.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 80/121 ( 66.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00298.pdb 1 KPVDNYLRIPSNSLLRTILSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEAGIEY 60 usage_00301.pdb 1 -PVDNYLRIPSNSLLRTILSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEAGIEY 59 usage_00303.pdb 1 -PVDNYLRIPSNSLLRTILSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEAGIEY 59 usage_00306.pdb 1 KPVDNYLRIPSNSLLRTILSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEAGIEY 60 usage_00589.pdb 1 -----------------------------------------SKLIRAIVLHVGIEAGIEY 19 SKLIRAIVLHVGIEAGIEY usage_00298.pdb 61 KRTSSNAVFNTKSSYYTLLFNLIQN----------------------------------- 85 usage_00301.pdb 60 KRTSSNAVFNTKSSYYTLLFNLIQ------------------------------------ 83 usage_00303.pdb 60 KRTS-NAVFNTKSSYYTLLFNLIQ------------------------------------ 82 usage_00306.pdb 61 KRT--NAVFNTKSSYYTLLFNLIQN----------------------------------- 83 usage_00589.pdb 20 KRT--NAVFNTKSSYYTLLFNLIQNGSIEMKYQIILSIVEQLRYPNIHTYWFSFVLMNMF 77 KRT NAVFNTKSSYYTLLFNLIQ usage_00298.pdb - usage_00301.pdb - usage_00303.pdb - usage_00306.pdb - usage_00589.pdb 78 K 78 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################