################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:14 2021 # Report_file: c_0591_13.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00059.pdb # 2: usage_00080.pdb # 3: usage_00148.pdb # 4: usage_00156.pdb # 5: usage_00172.pdb # # Length: 83 # Identity: 21/ 83 ( 25.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 83 ( 57.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 83 ( 18.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00059.pdb 1 --PVFVFGPCSVESYEQVAAVAESIKAKGLKLIRGGAFKPRTSPYDFQGLGLEGLKILKR 58 usage_00080.pdb 1 GYFTIIAGPCSVEGREMLMETAHFLSELGVKVLRGGAYKPRTSPYSFQGLGEKGLEYLRE 60 usage_00148.pdb 1 -GFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMRE 59 usage_00156.pdb 1 -YFTIIAGP-SVEGREMLMETAHFLSELGVKVLRGGAYKPR-------GLGEKGLEYLRE 51 usage_00172.pdb 1 -YFTIIAGPCSVEGREMLMETAHFLSELGVKVLRGGAYKPR-T---FQGLGEKGLEYLRE 55 ftiiaGP SvE re m A fl e G KvlRGGA KPR GlGekgL lre usage_00059.pdb 59 VSDEYGLGVISEIVTPADIEVAL 81 usage_00080.pdb 61 AADKYGMYVVTEALGEDDL---- 79 usage_00148.pdb 60 AADEYGLVTVTEVMDTRH----- 77 usage_00156.pdb 52 AADKYGMYVVTEALGEDDL---- 70 usage_00172.pdb 56 AADKYGMYVVTEALGEDDL---- 74 aaD YG vvtE d #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################