################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:25 2021 # Report_file: c_0946_51.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_01114.pdb # 2: usage_01639.pdb # 3: usage_01640.pdb # 4: usage_01641.pdb # 5: usage_01642.pdb # # Length: 69 # Identity: 25/ 69 ( 36.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 59/ 69 ( 85.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 69 ( 14.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01114.pdb 1 GFIHRDVKPDNMLLDK----SGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKS 56 usage_01639.pdb 1 GVVHRDLKPENLLLASKCKGA-AVKLADFGLAIEVQGD-QQAWFGFAGTPGYLSPEVLRK 58 usage_01640.pdb 1 GVVHRDLKPENLLLASKCKGA-AVKLADFGLAIEVQGD-QQAWFGFAGTPGYLSPEVLRK 58 usage_01641.pdb 1 GVVHRDLKPENLLLASKCKGA-AVKLADFGLAIEVQGD-QQAWFGFAGTPGYLSPEVLRK 58 usage_01642.pdb 1 GVVHRDLKPENLLLASKCKGA-AVKLADFGLAIEVQGD-QQAWFGFAGTPGYLSPEVLRK 58 GvvHRDlKPeNlLLas a avKLADFGlaievqgd qqawfgfaGTPgYlSPEVLrk usage_01114.pdb 57 QGGDGYYGR 65 usage_01639.pdb 59 ---EAYGK- 63 usage_01640.pdb 59 ---EAYGK- 63 usage_01641.pdb 59 ---EAYGK- 63 usage_01642.pdb 59 ---EAYGK- 63 eaYgk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################