################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:20 2021 # Report_file: c_1033_116.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00012.pdb # 2: usage_00013.pdb # 3: usage_00014.pdb # 4: usage_01046.pdb # 5: usage_01047.pdb # # Length: 64 # Identity: 23/ 64 ( 35.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 64 ( 35.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 64 ( 7.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 ---KALVFGSMGGNGGATGTMKELLAEAGFDVAC--EEEVYYVPTGDELDACFEAGRKLA 55 usage_00013.pdb 1 ---KALVFGSMGGNGGATGTMKELLAEAGFDVAC--EEEVYYVPTGDELDACFEAGRKLA 55 usage_00014.pdb 1 LTRKALVFGSMGGNGGATGTMKELLAEAGFDVAC--EEEVYYVPTGDELDACFEAGRKLA 58 usage_01046.pdb 1 ---VGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIA 57 usage_01047.pdb 1 -NKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIA 59 L FG G GGA E L A V VP G L C E GRK A usage_00012.pdb 56 AEIR 59 usage_00013.pdb 56 AEIR 59 usage_00014.pdb 59 AEIR 62 usage_01046.pdb 58 ARIA 61 usage_01047.pdb 60 ARIA 63 A I #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################