################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:22 2021 # Report_file: c_0461_119.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00221.pdb # 2: usage_00622.pdb # 3: usage_00623.pdb # 4: usage_00994.pdb # 5: usage_00995.pdb # # Length: 85 # Identity: 20/ 85 ( 23.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 85 ( 34.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 85 ( 8.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00221.pdb 1 RTVLVLIPSLANTVFLETLTGIETVLDAAGYQ-LIGNSHYDAGQELQLLRAYLQHRPDGV 59 usage_00622.pdb 1 --VAVIIPSLSN-VFPEVLTGINQVLEDTELQPVVGVTDYLPEKEEKVLYE-LSWRPSGV 56 usage_00623.pdb 1 --VAVIIPSLSN-VFPEVLTGINQVLEDTELQPVVGVTDYLPEKEEKVLYE-LSWRPSGV 56 usage_00994.pdb 1 --VGLLLPSLNNLHFAQTAQSLTDVLEQGGLQLLLGYTAYSPEREEQLVETMLRRRPEAM 58 usage_00995.pdb 1 --VGLLLPSLNNLHFAQTAQSLTDVLEQGGLQLLLGYTAYSPEREEQLVETMLRRRPEAM 58 V PSL N F VLe lQ G t Y pe Ee L RP usage_00221.pdb 60 LITGLSHAEPFERILSQHALPVVY- 83 usage_00622.pdb 57 IIAGLEHSEAARA-LDAAGIPVVEI 80 usage_00623.pdb 57 IIAGLEHSEAARA-LDAAGIPVVEI 80 usage_00994.pdb 59 VLSYDGHTEQTIRLLQRASIPIVEI 83 usage_00995.pdb 59 VLSYDGHTEQTIRLLQRASIPIVEI 83 H E L a iP Ve #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################