################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:15:15 2021 # Report_file: c_1283_106.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00088.pdb # 2: usage_00298.pdb # 3: usage_00367.pdb # 4: usage_00368.pdb # 5: usage_00432.pdb # 6: usage_00604.pdb # 7: usage_00695.pdb # 8: usage_01058.pdb # 9: usage_01173.pdb # 10: usage_01186.pdb # 11: usage_01335.pdb # 12: usage_01340.pdb # 13: usage_01404.pdb # 14: usage_01418.pdb # 15: usage_01496.pdb # # Length: 32 # Identity: 6/ 32 ( 18.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 32 ( 65.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 32 ( 15.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00088.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKA----- 27 usage_00298.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKA----- 27 usage_00367.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKAN---- 28 usage_00368.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKA----- 27 usage_00432.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKAN---- 28 usage_00604.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKA----- 27 usage_00695.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKA----- 27 usage_01058.pdb 1 HKHIISINDLSRDELELVLRTAASLKK----- 27 usage_01173.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKA----- 27 usage_01186.pdb 1 GQHILSVQQFTKDQMSHLFNVAHTLRMMVQKE 32 usage_01335.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKA----- 27 usage_01340.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKAN---- 28 usage_01404.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKA----- 27 usage_01418.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKAN---- 28 usage_01496.pdb 1 QKHIISINDLSRDDLNLVLATAAKLKAN---- 28 kHIiSindlsrD l lvl tAa Lk #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################