################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:44:03 2021 # Report_file: c_1336_80.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00107.pdb # 2: usage_00154.pdb # 3: usage_00159.pdb # 4: usage_00160.pdb # 5: usage_00161.pdb # 6: usage_00162.pdb # 7: usage_00163.pdb # # Length: 61 # Identity: 19/ 61 ( 31.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 61 ( 75.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 61 ( 24.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00107.pdb 1 --DFLTVRDILAKSLLGRLVEYESTFARYR-NF----------GLTYNLGSHLIDQAIQL 47 usage_00154.pdb 1 -NDFLTIKKLISEGSLEDINTYQVSYNRYRPEVQ-------ATGTLYDLGSHIIDQTLHL 52 usage_00159.pdb 1 -NDFLTIKKLISEGSLEDINTYQVSYNRYRPEV--------ATGTLYDLGSHIIDQTLHL 51 usage_00160.pdb 1 -NDFLTIKKLISEGSLEDINTYQVSYNRYRPEVQARWGT--ATGTLYDLGSHIIDQTLHL 57 usage_00161.pdb 1 DNDFLTIKKLISEGSLEDINTYQVSYNRYRPEVQ----GT-ATGTLYDLGSHIIDQTLHL 55 usage_00162.pdb 1 -NDFLTIKKLISEGSLEDINTYQVSYNRYRPEVQAR----WATGTLYDLGSHIIDQTLHL 55 usage_00163.pdb 1 -NDFLTIKKLISEGSLEDINTYQVSYNRYRPE---------ATGTLYDLGSHIIDQTLHL 50 DFLTikklisegsLedintYqvsynRYR e GtlYdLGSHiIDQtlhL usage_00107.pdb 48 F 48 usage_00154.pdb 53 F 53 usage_00159.pdb - usage_00160.pdb 58 F 58 usage_00161.pdb - usage_00162.pdb 56 F 56 usage_00163.pdb 51 F 51 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################