################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:34:51 2021 # Report_file: c_0694_9.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00006.pdb # 2: usage_00040.pdb # 3: usage_00041.pdb # 4: usage_00042.pdb # 5: usage_00074.pdb # 6: usage_00075.pdb # 7: usage_00076.pdb # 8: usage_00077.pdb # 9: usage_00146.pdb # 10: usage_00147.pdb # 11: usage_00148.pdb # 12: usage_00149.pdb # 13: usage_00155.pdb # 14: usage_00176.pdb # 15: usage_00203.pdb # 16: usage_00204.pdb # # Length: 42 # Identity: 41/ 42 ( 97.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 42 ( 97.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 42 ( 2.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00006.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00040.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00041.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00042.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00074.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00075.pdb 1 -APIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 41 usage_00076.pdb 1 -APIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 41 usage_00077.pdb 1 -APIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 41 usage_00146.pdb 1 -APIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 41 usage_00147.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00148.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00149.pdb 1 -APIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 41 usage_00155.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00176.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00203.pdb 1 TAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 42 usage_00204.pdb 1 -APIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP 41 APIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################