################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:28 2021 # Report_file: c_0852_68.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00079.pdb # 2: usage_00119.pdb # 3: usage_00147.pdb # 4: usage_00560.pdb # 5: usage_00561.pdb # 6: usage_00722.pdb # 7: usage_00833.pdb # # Length: 94 # Identity: 13/ 94 ( 13.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 94 ( 24.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 94 ( 23.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00079.pdb 1 TPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSKLDS---------FG 51 usage_00119.pdb 1 -QEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPD---GKRKAMRTDTAVGYS 56 usage_00147.pdb 1 -QEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPD---GKRKAMRTDTAVGYS 56 usage_00560.pdb 1 SQEEVKEIIGYAADRGITVVPEID-PGHAEAALNAYPRLGCF---NVAVKVPQ------N 50 usage_00561.pdb 1 SQEEVKEIIGYAADRGITVVPEID-PGHAEAALNAYPRLGC----NVAVKV--------N 47 usage_00722.pdb 1 -QEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPD---GKRKAMRTDTAVGYS 56 usage_00833.pdb 1 TQDDLREIVAFAADRHITVIPEIDVPGHSQAAIAAYPELGAGP---SPVEVWTRWGINET 57 q i yAa R I V PEiD PGH aa y L usage_00079.pdb 52 PINPTLNTTYSFLTTFFKEISEVFPDQFIHLG-- 83 usage_00119.pdb 57 TLMPRAEITYQFVEDVISELAAISPSPYIHLG-- 88 usage_00147.pdb 57 TLMPRAEITYQFVEDVISELAAISPSPYIHLG-- 88 usage_00560.pdb 51 IFCAGKDSTLIFLKNVLDEVCRFPSAYIHLG--- 81 usage_00561.pdb 48 IFCAGKDSTLIFLKNVLDEVCRFPSAYIHLGGDE 81 usage_00722.pdb 57 TLMPRAEITYQFVEDVISELAAISPSPYIHLG-- 88 usage_00833.pdb 58 VLEV-SETSLEFYRNVLDEVVEIFPSPWIS---- 86 t F v E #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################