################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:54:30 2021
# Report_file: c_1261_285.html
################################################################################################
#====================================
# Aligned_structures: 12
#   1: usage_02117.pdb
#   2: usage_02327.pdb
#   3: usage_02328.pdb
#   4: usage_02329.pdb
#   5: usage_02330.pdb
#   6: usage_02332.pdb
#   7: usage_02639.pdb
#   8: usage_02640.pdb
#   9: usage_02641.pdb
#  10: usage_02642.pdb
#  11: usage_02643.pdb
#  12: usage_03141.pdb
#
# Length:         43
# Identity:       11/ 43 ( 25.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     35/ 43 ( 81.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            8/ 43 ( 18.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_02117.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02327.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02328.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02329.pdb         1  ---PVIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   36
usage_02330.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02332.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02639.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02640.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02641.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02642.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_02643.pdb         1  ----VIKINSNQR-YAT---NSETAGFFRHLCQDSEVPVQSFV   35
usage_03141.pdb         1  RPVGIVANQPMQFAGCLDITASEKAARFVRTCDAFNVPVLTFV   43
                               vikinsnQr yat   nSEtAgfFrhlCqdseVPVqsFV


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################