################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 00:12:42 2021
# Report_file: c_0905_139.html
################################################################################################
#====================================
# Aligned_structures: 9
#   1: usage_00018.pdb
#   2: usage_00038.pdb
#   3: usage_00344.pdb
#   4: usage_00500.pdb
#   5: usage_00687.pdb
#   6: usage_00896.pdb
#   7: usage_00992.pdb
#   8: usage_01002.pdb
#   9: usage_01079.pdb
#
# Length:         41
# Identity:        6/ 41 ( 14.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:      6/ 41 ( 14.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:           22/ 41 ( 53.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00018.pdb         1  RLKLGKPLG-RG--GQVIEADAFGID-----TCRTVAVKML   33
usage_00038.pdb         1  --------LGRGAFGQVIEADAFGID-----TCRTVAVKM-   27
usage_00344.pdb         1  RLVLGKPLGEG-AFGQVVLAEAIGLDKDKPNRVTKVAVKML   40
usage_00500.pdb         1  RLKLGKPLG-----GQVIEADAFGIDKTA--TCRTVAVKML   34
usage_00687.pdb         1  --------GEG-AFGKVFLAECHNLLP-Q--DKMLVAVKAL   29
usage_00896.pdb         1  RLVLGKPLG------QVVLAEAIGL----PNRVTKVAVKML   31
usage_00992.pdb         1  RLKLGKPLGR----GQVIEADAFGIDKTA--TCRTVAVKML   35
usage_01002.pdb         1  --VLKREL-------KVFLAECYNLSPTK--DKMLVAVKAL   30
usage_01079.pdb         1  RLVLGKPLGEG-AFGQVVLAEAIGLDKDKPNRVTKVAVKML   40
                                           V  A               VAVK  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################