################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:10 2021 # Report_file: c_1242_252.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00409.pdb # 2: usage_00410.pdb # 3: usage_00882.pdb # 4: usage_00884.pdb # 5: usage_00885.pdb # 6: usage_01666.pdb # 7: usage_01667.pdb # 8: usage_01668.pdb # 9: usage_01669.pdb # 10: usage_01803.pdb # 11: usage_01804.pdb # # Length: 31 # Identity: 19/ 31 ( 61.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 31 ( 61.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 31 ( 6.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00409.pdb 1 KGVTEETTTGVHRLYQMEKDGRLPFPAFNV- 30 usage_00410.pdb 1 KGVTEETTTGVHRLYQMEKDGRLPFPAFN-- 29 usage_00882.pdb 1 KGVSEETTTGVHRLYEMANKGTLLFPAINVN 31 usage_00884.pdb 1 KGVSEETTTGVHRLYEMANKGTLLFPAINV- 30 usage_00885.pdb 1 KGVSEETTTGVHRLYEMANKGTLLFPAINVN 31 usage_01666.pdb 1 KGVTEETTTGVNRLYQLQKKGLLPFPAIN-- 29 usage_01667.pdb 1 KGVTEETTTGVNRLYQLQKKGLLPFPAINV- 30 usage_01668.pdb 1 KGVTEETTTGVNRLYQLQKKGLLPFPAIN-- 29 usage_01669.pdb 1 KGVTEETTTGVNRLYQLQKKGLLPFPAIN-- 29 usage_01803.pdb 1 KGVTEETTTGVHRLYQMEKDGRLPFPAFNV- 30 usage_01804.pdb 1 KGVTEETTTGVHRLYQMEKDGRLPFPAFNV- 30 KGV EETTTGV RLY G L FPA N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################