################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:00 2021 # Report_file: c_1418_18.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00618.pdb # 2: usage_00619.pdb # 3: usage_00620.pdb # 4: usage_00640.pdb # 5: usage_00643.pdb # 6: usage_00722.pdb # 7: usage_00726.pdb # 8: usage_00976.pdb # # Length: 72 # Identity: 46/ 72 ( 63.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 72 ( 63.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/ 72 ( 36.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00618.pdb 1 PE--LETWVETWAFSETIHSRS-THIIRNIVNDPSVVFDDIVTNEQIQKRAEGISSYYDE 57 usage_00619.pdb 1 PE--LETWVETWAFSETIHSRS-THIIRNIVNDPSVVFDDIVTNEQIQKRAEGISSYYDE 57 usage_00620.pdb 1 --PELETWVETWAFSETIHSRSYTHIIRNIVNDPSVVFDDIVTNEQIQKRAEGISSYYDE 58 usage_00640.pdb 1 --PELETWVETWAFSETIHSRSYTHIIRNIVNDPSVVFDDIVTNEQIQKRAEGISSYYDE 58 usage_00643.pdb 1 --PELETWVETWAFSETIHSRSYTHIIRNIVNDPSVVFDDIVTNEQIQKRAEGI------ 52 usage_00722.pdb 1 --PELETWVETWAFSETIHSRSYTHIIRNIVNDPSVVFDDIVTNEQIQKRAEGISSYYDE 58 usage_00726.pdb 1 --PELETWVETWAFSETIHSRSHTHIIRNIVNDPSVVFDDIVTNEQIQKRA--------- 49 usage_00976.pdb 1 --PELETWVETWAFSETIHSRSYTHIIRNIVNDPSVVFDDIVTNEQIQKRAEGISS---- 54 LETWVETWAFSETIHSRS THIIRNIVNDPSVVFDDIVTNEQIQKRA usage_00618.pdb 58 LIEMTSYWHL-- 67 usage_00619.pdb 58 LIEMTSYWHLLG 69 usage_00620.pdb 59 LIEMTSYWHLLG 70 usage_00640.pdb 59 LIEMTSYWH--- 67 usage_00643.pdb ------------ usage_00722.pdb 59 LIEMTSYWHLLG 70 usage_00726.pdb ------------ usage_00976.pdb ------------ #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################