################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:22 2021 # Report_file: c_1135_102.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00998.pdb # 2: usage_01057.pdb # 3: usage_01058.pdb # 4: usage_01059.pdb # 5: usage_01060.pdb # # Length: 74 # Identity: 50/ 74 ( 67.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 71/ 74 ( 95.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 74 ( 4.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00998.pdb 1 -WTHGVGLYGIYQYYQQTGDIERDIIDRWFADRFAEGATTKNVNTAPFLTLAYRFEETGR 59 usage_01057.pdb 1 -WTHGVGLYG-YHYYQQTGDQTRKIIDDWFADRFAEGATTKNVNTAPFLTLAYRYEETRN 58 usage_01058.pdb 1 EWTHGVGLYG-YHYYQQTGDQTRKIIDDWFADRFAEGATTKNVNTAPFLTLAYRYEETRN 59 usage_01059.pdb 1 -WTHGVGLYG-YHYYQQTGDQTRKIIDDWFADRFAEGATTKNVNTAPFLTLAYRYEETRN 58 usage_01060.pdb 1 -WTHGVGLYG-YHYYQQTGDQTRKIIDDWFADRFAEGATTKNVNTAPFLTLAYRYEETRN 58 WTHGVGLYG YhYYQQTGDqtRkIIDdWFADRFAEGATTKNVNTAPFLTLAYRyEETrn usage_00998.pdb 60 AYLPWLESWAEWA- 72 usage_01057.pdb 59 PAYLPWLETWAEWA 72 usage_01058.pdb 60 PAYLPWLETWAEWA 73 usage_01059.pdb 59 PAYLPWLETWAEWA 72 usage_01060.pdb 59 PAYLPWLETWAEWA 72 paylpwletwaew #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################