################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:27:19 2021 # Report_file: c_1106_30.html ################################################################################################ #==================================== # Aligned_structures: 15 # 1: usage_00012.pdb # 2: usage_00022.pdb # 3: usage_00023.pdb # 4: usage_00033.pdb # 5: usage_00043.pdb # 6: usage_00092.pdb # 7: usage_00098.pdb # 8: usage_00105.pdb # 9: usage_00115.pdb # 10: usage_00122.pdb # 11: usage_00124.pdb # 12: usage_00152.pdb # 13: usage_00203.pdb # 14: usage_00256.pdb # 15: usage_00257.pdb # # Length: 57 # Identity: 1/ 57 ( 1.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 57 ( 5.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 57 ( 17.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00012.pdb 1 TALMCACEHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRM- 56 usage_00022.pdb 1 TPLHYAAKEGHKEIVKLLISK-GADVNTSDSDGRTPLDLAREHGNEEIVKLLEK--- 53 usage_00023.pdb 1 LPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG- 56 usage_00033.pdb 1 TPLIVASKYGRSEIVKKLLEL-GADISARDLTGLTAEASARIFGRQEVIKIFTEVRR 56 usage_00043.pdb 1 TALHVAAAKGYTEVLKLLIQA-RYDVNIKDYDGWTPLHAAAHWGKEEACRILVENL- 55 usage_00092.pdb 1 -ALFAVARYGTPADIDFLIKK-GADLKLKNKKGQTALDVAKEASNQDTAKALSKKK- 54 usage_00098.pdb 1 TPLHVAAKYGKVRVAELLLER-DAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRG- 55 usage_00105.pdb 1 SHLHWAILINWEDVAR-F-VE-GIDV-NEDNEHTVPLYLSVRAA-VLLTKELLQK-- 50 usage_00115.pdb 1 TPLHLAASNGHLELVKLLLEK-GADINAEDHSGTTPLHFAAKNGHLELVKLLLEKG- 55 usage_00122.pdb 1 TPLMEAAENNHLEAVKYLIKA-GALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQ 56 usage_00124.pdb 1 TPLMEAAENNHLEAVKYLIKA-GALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQ 56 usage_00152.pdb 1 TPLYLACENQQRACVKKLLES-GADVNQGKG-QDSPLHAVVRTASEELACLLMDFG- 54 usage_00203.pdb 1 TPLHHAAENGHKEVVKLLISK-GADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQG- 55 usage_00256.pdb 1 -PLHLAAENGHKEVVKLLLSQ-GADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQ-- 53 usage_00257.pdb 1 -PLHLAAENGHKEVVKLLLSQ-GADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQG- 54 L a l #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################