################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:47 2021 # Report_file: c_1484_12.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00581.pdb # 2: usage_02958.pdb # 3: usage_04137.pdb # 4: usage_04585.pdb # 5: usage_04586.pdb # # Length: 86 # Identity: 17/ 86 ( 19.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 73/ 86 ( 84.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 86 ( 15.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00581.pdb 1 --------PWKLIISAFSIAQFSFESYLTYRQYQKLSETKLPPVLEDEIDDETFHKSRNY 52 usage_02958.pdb 1 -AEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTT---HVPPELGQIMDSETFEKSRLY 56 usage_04137.pdb 1 PAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTT---HVPPELGQIMDSETFEKSRLY 57 usage_04585.pdb 1 -AEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTT---HVPPELGQIMDSETFEKSRLY 56 usage_04586.pdb 1 -AEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTT---HVPPELGQIMDSETFEKSRLY 56 avlLfswtvylwetflaqrqrriykttt hvPPeLgqimDsETFeKSRlY usage_00581.pdb 53 SRAKAKFSIFSDIYNLAQKLVFIKYD 78 usage_02958.pdb 57 QLDKSTFSFWSGLYSETEGTLILLFG 82 usage_04137.pdb 58 QLDKSTFSFWSGLYSETEGTLILL-- 81 usage_04585.pdb 57 QLDKSTFSFWSGLYSETEGTLILLFG 82 usage_04586.pdb 57 QLDKSTFSFWSGLYSETEGTLILLFG 82 qldKstFSfwSglYsetegtlill #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################