################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:08:33 2021 # Report_file: c_0592_96.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00205.pdb # 2: usage_00206.pdb # 3: usage_00255.pdb # 4: usage_00403.pdb # 5: usage_00410.pdb # 6: usage_00411.pdb # 7: usage_00527.pdb # 8: usage_00623.pdb # 9: usage_00670.pdb # # Length: 77 # Identity: 1/ 77 ( 1.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 5/ 77 ( 6.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 77 ( 24.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00205.pdb 1 ---KILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLHAPDVIITDIRP--KL 55 usage_00206.pdb 1 ---RVLIVDDNERQAQRVAAELGVEHRP-VIESDPEKAKISAG-GPVDLVIVNAAA--KN 53 usage_00255.pdb 1 SHMNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLDLLL--PD 58 usage_00403.pdb 1 ---KILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIML--PN 55 usage_00410.pdb 1 -MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEM--PG 57 usage_00411.pdb 1 --KRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEP--GI 56 usage_00527.pdb 1 --KKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMM--PV 56 usage_00623.pdb 1 --RTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQN-MPRK 57 usage_00670.pdb 1 -GKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLILLNVNL--GD 57 L d l g d usage_00205.pdb 56 -GG-LELDRIKAGG--- 67 usage_00206.pdb 54 FDGLRFTAALR------ 64 usage_00255.pdb 59 VNGLEILKWIKERSP-- 73 usage_00403.pdb 56 KDGVEVCREVRK----- 67 usage_00410.pdb 58 ISGLEVAGEIRKK---- 70 usage_00411.pdb 57 -SGLEVAGEIRKK---- 68 usage_00527.pdb 57 MDGFTVLKKLQEK---- 69 usage_00623.pdb 58 ----SGLELIAALR-QL 69 usage_00670.pdb 58 MMAQDFAEKL------- 67 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################