################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:05 2021 # Report_file: c_1445_46.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_04624.pdb # 2: usage_07931.pdb # 3: usage_08492.pdb # 4: usage_08697.pdb # 5: usage_08698.pdb # 6: usage_08699.pdb # 7: usage_08700.pdb # 8: usage_10185.pdb # # Length: 30 # Identity: 13/ 30 ( 43.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 14/ 30 ( 46.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 30 ( 3.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_04624.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLE 30 usage_07931.pdb 1 KVSVLNVAVLENPSPFHSPFRFEISFECSE 30 usage_08492.pdb 1 KVQVNNVVVLDNPSPFYNPFQFEITFECIE 30 usage_08697.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLE 30 usage_08698.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLE 30 usage_08699.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLE 30 usage_08700.pdb 1 IVSLLGIKVLNNPAKFTDPYEFEITFECLE 30 usage_10185.pdb 1 KVQVNNVVVLDNPSPFYNPFQFEITFECI- 29 V VL NP F P FEItFEC #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################