################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:14 2021 # Report_file: c_0398_63.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00310.pdb # 2: usage_00401.pdb # 3: usage_00565.pdb # 4: usage_00567.pdb # 5: usage_00569.pdb # 6: usage_00571.pdb # # Length: 67 # Identity: 5/ 67 ( 7.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 67 ( 9.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 67 ( 14.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00310.pdb 1 QTEKHFPDGRKEITFPDQTVKTLHP--D-GREESVLT-D--GTIIQLNPDGSKVIQFNTG 54 usage_00401.pdb 1 -EILEFPNGQTEHRRKDGTVEIHFP----NNSIKIVD-E--KLEEWRYADGTHLVQLRNG 52 usage_00565.pdb 1 QTVKHFPDGRKEITFPDQTVKTLHP--D-GREESVLT-D--GTIIQLNPDGSKVIQFNTG 54 usage_00567.pdb 1 QTEHRRKDGTVEIHFPNNSIKIVDPSDTEKLEEWRYA-D--GTHLVQLRNGDKILNLPNG 57 usage_00569.pdb 1 QTEHRRKDGTVEIHFPNNSIKIVDPSDTEKLEEWRYA-D--GTHLVQLRNGDKILNLPNG 57 usage_00571.pdb 1 LEILEFPNGQTEHRRKDGTVEIHFP--N-NSIKIVDPSDTEKLEEWRYADGTHLVQLRNG 57 G E P d G G usage_00310.pdb 55 QREIHT- 60 usage_00401.pdb 53 DKILNL- 58 usage_00565.pdb 55 QREIHT- 60 usage_00567.pdb 58 QKEIHTK 64 usage_00569.pdb 58 QKEIHTK 64 usage_00571.pdb 58 DKILN-- 62 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################