################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:36 2021 # Report_file: c_1396_107.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00018.pdb # 2: usage_00319.pdb # 3: usage_01013.pdb # 4: usage_01291.pdb # 5: usage_01734.pdb # # Length: 88 # Identity: 2/ 88 ( 2.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 44/ 88 ( 50.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 44/ 88 ( 50.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00018.pdb 1 RVRFLQTIKDIASAIKELLDTVNNV----------RALEHQKKEFVKYSKSFSDTLKTYF 50 usage_00319.pdb 1 QEYIKKVTDELKELIQNVNDDIKEVEKNPE------DMEYWNKIYRLVHTMKEITETMG- 53 usage_01013.pdb 1 RVRFLQTIKDIASAIKELLDTVNNVFKKY-QYQNRRALEHQKKEFVKYSKSFSDTLKTYF 59 usage_01291.pdb 1 RVRFLQTIKD---------------------------------EFVKYSKSFSDTLKTYF 27 usage_01734.pdb 1 RVRFLQTIKDIASAIKELLDTVNNVFKKY-QYQNRRALEHQKKEFVKYSKSFSDTLKTYF 59 rvrflqtikd efvkysksfsdTlkty usage_00018.pdb 51 KDGKAINVFVSANRLIHQTNLI------ 72 usage_00319.pdb 54 ----FSSVAKVLHTIMNLVDKMLNS--- 74 usage_01013.pdb 60 KDGKAINVFVSANRLIHQTNLILQTFKT 87 usage_01291.pdb 28 KDGKAINVFVSANRLIHQTNLILQT--- 52 usage_01734.pdb 60 KDGKAINVFVSANRLIHQTNLILQTFK- 86 ainVfvsanrlihqtnli #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################