################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:39 2021 # Report_file: c_0721_33.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00187.pdb # 2: usage_00188.pdb # 3: usage_00189.pdb # 4: usage_00190.pdb # 5: usage_00804.pdb # # Length: 81 # Identity: 13/ 81 ( 16.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 55/ 81 ( 67.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/ 81 ( 32.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00187.pdb 1 -MKEVIFTENAPKPIGPYS-QAIKAGNFLFIAGQIPIDPKTGEIVK-GDIKDQTRQVLEN 57 usage_00188.pdb 1 ----VIFTENAPKPIGPYS-QAIKAGNFLFIAGQIPIDPKTGEIVK-GDIKDQTRQVLEN 54 usage_00189.pdb 1 ---EVIFTENAPKPIGPYS-QAIKAGNFLFIAGQIPIDPKTGEIVK-GDIKDQTRQVLEN 55 usage_00190.pdb 1 -MKEVIFTENAPKPIGPYS-QAIKAGNFLFIAGQIPIDPKTGEIVK-GDIKDQTRQVLEN 57 usage_00804.pdb 1 ES-EHGERD---------GITYAHDGEYFFCAG-RV--------PPTGRYTEATRAAYVT 41 vifte s qaikaGnflFiAG ip vk GdikdqTRqvlen usage_00187.pdb 58 IKAILEAAGYSLNDVIKVTVY 78 usage_00188.pdb 55 IKAILEAAGYSLNDVIKVTVY 75 usage_00189.pdb 56 IKAILEAAGYSLNDVIKVTVY 76 usage_00190.pdb 58 IKAILEAAGYSLNDVIKVTVY 78 usage_00804.pdb 42 MFELLEEFGYS--SVFRMWNF 60 ikaiLEaaGYS dVikvtvy #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################