################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:17:45 2021 # Report_file: c_1097_63.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00017.pdb # 2: usage_00101.pdb # 3: usage_00219.pdb # 4: usage_00543.pdb # 5: usage_00544.pdb # # Length: 61 # Identity: 14/ 61 ( 23.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/ 61 ( 39.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 61 ( 11.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00017.pdb 1 --SAETIKVIIDNYLAPLLVGKDASNLSQARVLMDRAVTGNLSAKAAIDIALHDLKARAL 58 usage_00101.pdb 1 --CAETIKIIVERYLAPHLLGTDAFNVSGALQTMARAVTGNASAKAAVEMALLDLKARAL 58 usage_00219.pdb 1 SV---ETKALVDGYLAPVLIGRAVSELAGI-ADLERVVARARYAKAAVDVA-HDAWARSL 55 usage_00543.pdb 1 ---VETIKTIIDQYLAPVIIGRDPSTIGVASQSMDGLVFGNSVAKAAIETALWDDRERRS 57 usage_00544.pdb 1 ---VETIKTIIDQYLAPVIIGRDPSTIGVASQSMDGLVFGNSVAKAAIETALWDDRERRS 57 tiK i d YLAP G d s a m V gn AKAA A D R usage_00017.pdb 59 N 59 usage_00101.pdb 59 G 59 usage_00219.pdb 56 N 56 usage_00543.pdb 58 R 58 usage_00544.pdb 58 R 58 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################