################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:39 2021 # Report_file: c_1082_14.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00502.pdb # 2: usage_00503.pdb # 3: usage_00504.pdb # 4: usage_00505.pdb # 5: usage_00506.pdb # 6: usage_00507.pdb # 7: usage_00508.pdb # 8: usage_00509.pdb # 9: usage_00634.pdb # # Length: 59 # Identity: 24/ 59 ( 40.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 59 ( 84.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 59 ( 15.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00502.pdb 1 DEQQIRDRLAELGEQIAADYAEEPPVLVGVLRGAV-V-ADLARQIDLKVEDWA------ 51 usage_00503.pdb 1 DEQQIRDRLAELGEQIAADYAEEPPVLVGVLRGAV-V-ADLARQIDLKVEDWA------ 51 usage_00504.pdb 1 DEQQIRDRLAELGEQIAADYAEEPPVLVGVLRGAV-V-ADLARQIDLKVEDWA------ 51 usage_00505.pdb 1 DEQQIRDRLAELGEQIAADYAEEPPVLVGVLRGAV-V-ADLARQIDLKVEDWA------ 51 usage_00506.pdb 1 DEQQIRDRLAELGEQIAADYAEEPPVLVGVLRGAV-V-ADLARQIDLKVEDWA------ 51 usage_00507.pdb 1 DEQQIRDRLAELGEQIAADYAEEPPVLVGVLRGAV-V-ADLARQIDLKVEDWA------ 51 usage_00508.pdb 1 DEQQIRDRLAELGEQIAADYAEEPPVLVGVLRGAV-V-ADLARQIDLKVEDWA------ 51 usage_00509.pdb 1 DEQQIRDRLAELGEQIAADYAEEPPVLVGVLRGAV-V-ADLARQIDLKVEDWA------ 51 usage_00634.pdb 1 TAEQIQARIAELGEQIGNDYREQDLLLITVLKGAVLFVTDLARAIPVPTQFE-FMAVSS 58 deqQIrdRlAELGEQIaaDYaEeppvLvgVLrGAV v aDLARqIdlkvedw #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################