################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:44 2021 # Report_file: c_0940_154.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00232.pdb # 2: usage_00233.pdb # 3: usage_00234.pdb # 4: usage_00236.pdb # 5: usage_00244.pdb # 6: usage_00246.pdb # 7: usage_00512.pdb # 8: usage_01271.pdb # 9: usage_01465.pdb # # Length: 41 # Identity: 1/ 41 ( 2.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 41 ( 14.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 41 ( 24.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00232.pdb 1 AGLAVDRQNPDII-VTS-NAWWPDEYIFRSTDGG-ATWKN- 37 usage_00233.pdb 1 AGLAVDRQNPDII-VTS-NAWWPDEYIFRSTDGG-ATWKN- 37 usage_00234.pdb 1 AGLAVDRQNPDII-VTS-NAWWPDEYIFRSTDGG-ATWKN- 37 usage_00236.pdb 1 AGLAVDRQNPDII-VTS-NAWWPDEYIFRSTDGG-ATWKN- 37 usage_00244.pdb 1 AGLAVDRQNPDIIMVTSMNAWWPDEYIFRSTDGG-ATWKN- 39 usage_00246.pdb 1 AGLAVDRQNPDIIMVTSMNAWWPDEYIFRSTDGG-ATWKN- 39 usage_00512.pdb 1 TSVIFDPERNGTIYASAT-A--P-QGMYVTHDGG-VSWEP- 35 usage_01271.pdb 1 -GVGTDKARRDHVRLAGS-D----GQLYDSTDAG-ATWKP- 33 usage_01465.pdb 1 IDIAVSNGDPDHFFVGTW-G----NGLFEFKDGKAIARYSG 36 d d Dgg w #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################