################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:35:51 2021 # Report_file: c_0307_3.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00001.pdb # 2: usage_00056.pdb # 3: usage_00091.pdb # 4: usage_00092.pdb # 5: usage_00093.pdb # 6: usage_00095.pdb # 7: usage_00096.pdb # # Length: 75 # Identity: 12/ 75 ( 16.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 75 ( 30.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 75 ( 9.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00001.pdb 1 -KLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLK---NREPVQ-LE 55 usage_00056.pdb 1 -VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNS 59 usage_00091.pdb 1 --PKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYID---GALSGH-LG 54 usage_00092.pdb 1 -SPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVN---GKKTNV-YG 55 usage_00093.pdb 1 SSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVN---GKKTNV-YG 56 usage_00095.pdb 1 -SPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVN---GKKTNV-YG 55 usage_00096.pdb 1 SSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVN---GKKTNV-YG 56 FL gk V L G y G l Dg MN L e usage_00001.pdb 56 TLSIRGNNIRYFILP 70 usage_00056.pdb 60 DVFLRGTQVMYISEQ 74 usage_00091.pdb 55 EVLIRCNNVLYIRG- 68 usage_00092.pdb 56 DAFIRGNNVLYVSAL 70 usage_00093.pdb 57 DAFIRGNNVLYVSA- 70 usage_00095.pdb 56 DAFIRGNNVLYVSAL 70 usage_00096.pdb 57 DAFIRGNNVLYVSA- 70 iRgnnv Y #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################