################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:53 2021 # Report_file: c_1022_7.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00058.pdb # 2: usage_00073.pdb # 3: usage_00074.pdb # 4: usage_00281.pdb # 5: usage_00282.pdb # 6: usage_00283.pdb # 7: usage_00284.pdb # 8: usage_00289.pdb # # Length: 63 # Identity: 21/ 63 ( 33.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 63 ( 61.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 63 ( 9.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00058.pdb 1 ICIYWTKYYTLHNAIIEDCVRKQLKKERPIILDPADPTLNVAEGY--RWDIVAQRASQCL 58 usage_00073.pdb 1 LCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILDPADPTGNVGGGDTHSWQRLAQEARVWL 60 usage_00074.pdb 1 LCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILDPADPTGNVGGGDTHSWQRLAQEARVWL 60 usage_00281.pdb 1 LCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILDPADPTGNVGGGDTHSWQRLAQEARVWL 60 usage_00282.pdb 1 LCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILDPADPTGNVGGGDTHSWQRLAQEARVW- 59 usage_00283.pdb 1 LCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILDPADPTGNVGGGDTHSWQRLAQEARVWL 60 usage_00284.pdb 1 LCIFWEAYYDFTNPVVGRCMLQQLKKPRPVILDPADPTGNVGGGDTHSWQRLAQEARVWL 60 usage_00289.pdb 1 LCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCY 60 lCifW yY f np vg c QLKkpRPvILDPADPT nvg G W lAQeA usage_00058.pdb 59 KQ- 60 usage_00073.pdb 61 GYP 63 usage_00074.pdb --- usage_00281.pdb 61 GY- 62 usage_00282.pdb --- usage_00283.pdb --- usage_00284.pdb --- usage_00289.pdb --- #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################