################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:22:37 2021 # Report_file: c_0415_8.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00155.pdb # 2: usage_00162.pdb # 3: usage_00174.pdb # 4: usage_00175.pdb # 5: usage_00176.pdb # 6: usage_00177.pdb # # Length: 98 # Identity: 8/ 98 ( 8.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 98 ( 32.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 36/ 98 ( 36.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00155.pdb 1 -YQ----LSKQVLG-LGVNGKVLECFHRRTGQKCALKLLYD-----------SPK----A 39 usage_00162.pdb 1 ---KISFCPKDVLGHGAEGTIVYRGMF--DNRDVAVKRILP------------------- 36 usage_00174.pdb 1 KYD-----PKDVIG-RGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQ--LEEVREAT 52 usage_00175.pdb 1 KYD-----PKDVIG-RGVSSVVRRCVHRATGHEFAVKIMEVTA---SPEQ--LEEVREAT 49 usage_00176.pdb 1 KYD-----PKDVIG-RGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQ--LEEVREAT 52 usage_00177.pdb 1 KYD-----PKDVIG-RGVSSVVRRCVHRATGHEFAVKIMEV---RLSPEQLE--EVREAT 49 pKdV G gv V rc h tg AvK usage_00155.pdb 40 RQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIME 77 usage_00162.pdb 37 DREVQLLRESDEHPNVIRYFCTEKDRQ----FQYIAI- 69 usage_00174.pdb 53 RRETHILRQVAGHPHIITLIDSYESSS----FMFLV-- 84 usage_00175.pdb 50 RRETHILRQVAGHPHIITLIDSYESSS----FMFLV-- 81 usage_00176.pdb 53 RRETHILRQVAGHPHIITLIDSYESSS----FMFLV-- 84 usage_00177.pdb 50 RRETHILRQVAGHPHIITLIDSYESSS----FMFLV-- 81 rrE lrq ghPhii d ye f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################