################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:42 2021 # Report_file: c_1100_43.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00070.pdb # 2: usage_00146.pdb # 3: usage_00147.pdb # 4: usage_00371.pdb # 5: usage_00477.pdb # 6: usage_00538.pdb # 7: usage_00539.pdb # 8: usage_00599.pdb # 9: usage_00600.pdb # # Length: 64 # Identity: 1/ 64 ( 1.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 7/ 64 ( 10.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 23/ 64 ( 35.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00070.pdb 1 -LAVATITQAEQQDRFLGR--GELDELASYFASGAKRLEIAQLLTENSEIIVSRAANRI- 56 usage_00146.pdb 1 SVVTKSIVNADAEARYLSP--GELDRIKNFVSTGERRLRIAQTLTENRERIVKQAGDQLF 58 usage_00147.pdb 1 DAITAVINASDVQGKYLDT--AAMEKLKAYFATGELRVRAASVISANAANIVKEAVAKS- 57 usage_00371.pdb 1 DSSLRDAS-----------SLTLDQITGLIEVNEKELDATTK-A---KTEDFVKAFQVFD 45 usage_00477.pdb 1 SIVTKSIVNADAEARYLSP--GELDRIKGFVTSGERRLRIAQVLTESRERIVKQAGDQLF 58 usage_00538.pdb 1 SIVSKSIVNADAEARYLSP--GELERIKTFVVGGDRRLRIAQTIAESRERIVKQAGNQLF 58 usage_00539.pdb 1 SIVSKSIVNADAEARYLSP--GELERIKTFVVGGDRRLRIAQTIAESRERIVKQAGNQLF 58 usage_00599.pdb 1 SIVTKSIVNADAEARYLSP--GELDRIKSFVSSGEKRLRIAQILTDNRERIVKQAGDQLF 58 usage_00600.pdb 1 SIVTKSIVNADAEARYLSP--GELDRIKSFVSSGEKRLRIAQILTDNRERIVKQAGDQLF 58 i g r a iv A usage_00070.pdb ---- usage_00146.pdb 59 QK-- 60 usage_00147.pdb ---- usage_00371.pdb 46 K--- 46 usage_00477.pdb 59 QKRP 62 usage_00538.pdb 59 QKR- 61 usage_00539.pdb 59 QKR- 61 usage_00599.pdb 59 QK-- 60 usage_00600.pdb 59 QK-- 60 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################