################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:03:09 2021 # Report_file: c_0019_13.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00015.pdb # 2: usage_00016.pdb # 3: usage_00040.pdb # 4: usage_00055.pdb # # Length: 176 # Identity: 24/176 ( 13.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 85/176 ( 48.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 31/176 ( 17.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 GVNIIKPWVHNQDDCLA-VNSGENIWFTGGTCIGGHGLSIGSVGDRSNNVVKNVTIEHST 59 usage_00016.pdb 1 GVNIIKPWVHNQDDCLA-VNSGENIWFTGGTCIGGHGLSIGSVGDRSNNVVKNVTIEHST 59 usage_00040.pdb 1 -----DVEVTNKDECVTVKSPANNILVESIYCNWSGGCAMGSLGA-D-TDVTDIVYRNVY 53 usage_00055.pdb 1 HVTLDNNHVYNQDDCVA-VTSGTNIVVSNMYCSGGHGLSIGSVGGKSDNVVDGVQFLSSQ 59 V NqDdC a v sg NI C gghGlsiGSvG s nvV v s usage_00015.pdb 60 VSNSENAVRIKTISGA-TGSVSEITYSNIVMSGISDYGVVIQQDYEDGKPTGKPTNGVTI 118 usage_00016.pdb 60 VSNSENAVRIKTISGA-TGSVSEITYSNIVMSGISDYGVVIQQDYEDGKPTGKPTNGVTI 118 usage_00040.pdb 54 TWSSNQMYMIKSN--GGSGTVSNVLLENFIGHGNA-YSLDIDGYWSSMTAVAGD--GVQL 108 usage_00055.pdb 60 VVNSQNGCRIKSNSGA-TGTINNVTYQNIALTNISTYGVDVQQDYLNGGPTGKPTNGVKI 118 v nS n rIK a tG vs ty Ni gis Ygv iqqdy g ptgkp GV i usage_00015.pdb 119 QDVKLESVTGSVDS--GATEIYLLCGS--GSCSDWTWDDVKVTG------------ 158 usage_00016.pdb 119 QDVKLESVTGSVDS--GATEIYLLCGS--GSCSDWTWDDVKVTG------------ 158 usage_00040.pdb 109 NNITVKNWKGTEANGATRPPIRVVCSDTAP-CTDLTLEDIAIWTESGSSELYLCRS 163 usage_00055.pdb 119 SNIKFIKVTGTVAS--SAQDWFILCGD--GSCSGFTFSGNAITG-G--GKTSSCN- 166 k vtG v s a i lCg g Csd T d tg #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################