################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:20:10 2021 # Report_file: c_0941_35.html ################################################################################################ #==================================== # Aligned_structures: 21 # 1: usage_00464.pdb # 2: usage_00466.pdb # 3: usage_00468.pdb # 4: usage_00470.pdb # 5: usage_00771.pdb # 6: usage_00773.pdb # 7: usage_00798.pdb # 8: usage_00799.pdb # 9: usage_01174.pdb # 10: usage_01176.pdb # 11: usage_01178.pdb # 12: usage_01180.pdb # 13: usage_01742.pdb # 14: usage_02009.pdb # 15: usage_02011.pdb # 16: usage_02068.pdb # 17: usage_02070.pdb # 18: usage_02092.pdb # 19: usage_02094.pdb # 20: usage_02096.pdb # 21: usage_02098.pdb # # Length: 48 # Identity: 32/ 48 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 48 ( 66.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 48 ( 10.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00464.pdb 1 APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_00466.pdb 1 APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_00468.pdb 1 APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_00470.pdb 1 APWFLEYSKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_00771.pdb 1 RPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_00773.pdb 1 RPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_00798.pdb 1 -PWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 47 usage_00799.pdb 1 -PWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 47 usage_01174.pdb 1 RPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_01176.pdb 1 --WFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 46 usage_01178.pdb 1 -----EYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 43 usage_01180.pdb 1 RPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_01742.pdb 1 -----EYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 43 usage_02009.pdb 1 ----LWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVT 44 usage_02011.pdb 1 ----LWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVT 44 usage_02068.pdb 1 -PWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 47 usage_02070.pdb 1 RPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 48 usage_02092.pdb 1 --WFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 46 usage_02094.pdb 1 --WFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 46 usage_02096.pdb 1 -PWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 47 usage_02098.pdb 1 -----EYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVT 43 K ECHF NGT RVR L RYFYN EE RFDSDVGEFRAVT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################