################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:00:03 2021 # Report_file: c_1396_19.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_01500.pdb # 2: usage_01503.pdb # 3: usage_01843.pdb # 4: usage_01845.pdb # # Length: 84 # Identity: 75/ 84 ( 89.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 80/ 84 ( 95.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 84 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01500.pdb 1 ---YMNIMMAFTVSLVGLLMYRSHLMSSLLCLEGMMLSLFVMAALTILNSHFTLASMMPI 57 usage_01503.pdb 1 -LVYMNIMMAFTVSLTGLLMYRSHLMSSLLCLEGMMLSLFILATLMILNSHFTLASMMPI 59 usage_01843.pdb 1 SMVYMNIMMAFTVSLVGLLMYRSHLMSSLLCLEGMMLSLFVMAALTILNSHFTLASMMPI 60 usage_01845.pdb 1 ---YMNIMMAFTVSLVGLLMYRSHLMSSLLCLEGMMLSLFVMAALTILNSHFTLASMMPI 57 YMNIMMAFTVSLvGLLMYRSHLMSSLLCLEGMMLSLFvmAaLtILNSHFTLASMMPI usage_01500.pdb 58 ILLVFAACEAALGLSLLVMVSNTY 81 usage_01503.pdb 60 ILLVFAACEAALGLSLLVMVSNT- 82 usage_01843.pdb 61 ILLVFAACEAALGLSLLVMVSNTY 84 usage_01845.pdb 58 ILLVFAACEAALGLSLLVMVSNTY 81 ILLVFAACEAALGLSLLVMVSNT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################