################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:18:32 2021 # Report_file: c_1196_5.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00833.pdb # 2: usage_00834.pdb # 3: usage_00835.pdb # 4: usage_00836.pdb # 5: usage_01256.pdb # 6: usage_01257.pdb # 7: usage_01258.pdb # 8: usage_01259.pdb # 9: usage_01260.pdb # 10: usage_01261.pdb # # Length: 41 # Identity: 41/ 41 (100.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 41 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 41 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00833.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_00834.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_00835.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_00836.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_01256.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_01257.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_01258.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_01259.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_01260.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 usage_01261.pdb 1 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD 41 NIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################