################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:43:02 2021 # Report_file: c_1035_20.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00041.pdb # 2: usage_00096.pdb # 3: usage_00097.pdb # 4: usage_00145.pdb # 5: usage_00177.pdb # 6: usage_00181.pdb # 7: usage_00182.pdb # # Length: 75 # Identity: 9/ 75 ( 12.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 75 ( 29.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 75 ( 18.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00041.pdb 1 PLWVTHNEPMVTVWAGYHMGLFAPGLKDPTLGGRVAHHLLLSHGQALQAFRALS---P-A 56 usage_00096.pdb 1 KTWTTLNEPWCSAFLGYGSGVHAPGRTDPVAALRAAHHLNLGHGLAVQALRDRLP--ADA 58 usage_00097.pdb 1 KTWTTLNEPWCSAFLGYGSGVHAPGRTDPVAALRAAHHLNLGHGLAVQALRDRLP--ADA 58 usage_00145.pdb 1 PFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAG---A-R 56 usage_00177.pdb 1 KDWFVHNEPMVVVEGSYLMQFHYPAIVDGKKAVQVAYNLALATAKVIQAYRRGPAELS-D 59 usage_00181.pdb 1 PFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAG---A-R 56 usage_00182.pdb 1 PFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAG---A-R 56 t NEP g g haPg a r AhhL L hg a A R usage_00041.pdb 57 GSQMG---------- 61 usage_00096.pdb 59 QCSVTLNIHHVRPLT 73 usage_00097.pdb 59 QCSVTLN-------- 65 usage_00145.pdb 57 RVGIVLNFAPAY--- 68 usage_00177.pdb 60 GRIGT---------- 64 usage_00181.pdb 57 RVGIVLNFAPAY--- 68 usage_00182.pdb 57 RVGIVLNFAPAY--- 68 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################