################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:24 2021 # Report_file: c_0690_44.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00010.pdb # 2: usage_00016.pdb # 3: usage_00017.pdb # 4: usage_00147.pdb # 5: usage_00241.pdb # 6: usage_00242.pdb # 7: usage_00295.pdb # 8: usage_00314.pdb # # Length: 66 # Identity: 15/ 66 ( 22.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 30/ 66 ( 45.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 66 ( 12.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00010.pdb 1 ----PPINLPENSRGPFPQELVRIRSDRDK-N-LSLRYSVTGPGADQPPTGIFIINPISG 54 usage_00016.pdb 1 SWVIPPISCPENEKGPFPKNLVQIKSNKDK-E-GKVFYSITGQGADTPPVGVFIIERETG 58 usage_00017.pdb 1 SWVIPPISCPENEKGPFPKNLVQIKSNKDK-E-GKVFYSITGQGADTPPVGVFIIERETG 58 usage_00147.pdb 1 ------ISCPENEKGPFPKNLVQIKSNKDK-E-GKVFYSITGQGADTPPVGVFIIERETG 52 usage_00241.pdb 1 ----PPINLPENSRGPFPQELVRIRSDRDK-N-LSLRYSVTGPGADQPPTGIFIINPISG 54 usage_00242.pdb 1 ----PPINLPENSRGPFPQELVRIRSDRDK-N-LSLRYSVTGPGADQPPTGIFIINPISG 54 usage_00295.pdb 1 ------ISCPENEEGEFPKNLVQIKSNRDK-E-TKVFYSITGQGADKPPVGVFIIERETG 52 usage_00314.pdb 1 ------VALREGEDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTG 54 i pEn g fp lv I S dk Ys TG Gad PP G Fii G usage_00010.pdb 55 QLSVTK 60 usage_00016.pdb 59 WLKVTE 64 usage_00017.pdb 59 WLKVTE 64 usage_00147.pdb 53 WLKVTE 58 usage_00241.pdb 55 QLSVTK 60 usage_00242.pdb 55 QLSVTK 60 usage_00295.pdb 53 WLKVTQ 58 usage_00314.pdb 55 ELNVTS 60 L VT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################