################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:02:59 2021 # Report_file: c_1297_60.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_01703.pdb # 2: usage_02297.pdb # 3: usage_02298.pdb # 4: usage_03138.pdb # 5: usage_03266.pdb # 6: usage_03267.pdb # # Length: 65 # Identity: 34/ 65 ( 52.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 65 ( 52.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 65 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01703.pdb 1 EQWREAFQTAYLSLGGLGERVLGFCQLYLSEKDYPPGYAFDVEAMNFPTSGLSFAGLVSM 60 usage_02297.pdb 1 -ELKDAFQNAYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPLDNLCFVGLISM 59 usage_02298.pdb 1 -ELKDAFQNAYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPLDNLCFVGLISM 59 usage_03138.pdb 1 EQWREAFQTAYLSLGGLGERVLGFCQLYLSEKDYPPGYAFDVEAMNFPTSGLSFAGLVSM 60 usage_03266.pdb 1 -ELKDAFQNAYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPLDNLCFVGLISM 59 usage_03267.pdb 1 -ELKDAFQNAYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPLDNLCFVGLISM 59 AFQ AYL LGGLGERVLGFC L L P G FD NFP L F GL SM usage_01703.pdb 61 IDPPR 65 usage_02297.pdb 60 I---- 60 usage_02298.pdb 60 I---- 60 usage_03138.pdb 61 IDPPR 65 usage_03266.pdb 60 ID--- 61 usage_03267.pdb 60 ID--- 61 I #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################