################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:56:02 2021 # Report_file: c_0591_12.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00126.pdb # 2: usage_00127.pdb # 3: usage_00158.pdb # 4: usage_00182.pdb # 5: usage_00183.pdb # 6: usage_00184.pdb # 7: usage_00185.pdb # 8: usage_00186.pdb # # Length: 81 # Identity: 26/ 81 ( 32.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 77/ 81 ( 95.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 81 ( 4.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00126.pdb 1 DSVPCGVSVGIMDTIPQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERFGDDVLLQ 60 usage_00127.pdb 1 DSVPCGVSVGIMDTIPQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERFGDDVLLQ 60 usage_00158.pdb 1 DR-VEVSATLGSESLDVLIQSVDAAVEQGFRRVKLKIAPGRDRAAIKAVRLRYP-DLAIA 58 usage_00182.pdb 1 ---PCGVSVGIMDTIPQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERFGDDVLLQ 57 usage_00183.pdb 1 ---PCGVSVGIMDTIPQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERFGDDVLLQ 57 usage_00184.pdb 1 ---PCGVSVGIMDTIPQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERFGDDVLLQ 57 usage_00185.pdb 1 ---PCGVSVGIMDTIPQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERFGDDVLLQ 57 usage_00186.pdb 1 DSVPCGVSVGIMDTIPQLLDVVGGYLDEGYVRIKLKIEPGWDVEPVRAVRERFGDDVLLQ 60 pcgvsvgimdtipqLldvVggyldeGyvRiKLKIePGwDvepvrAVReRfg Dvllq usage_00126.pdb 61 VDANTAYTLGDAPQLARLDPF 81 usage_00127.pdb 61 VDANTAYTLGDAPQLARLDPF 81 usage_00158.pdb 59 ADANGSYRPEDAPVLRQLDAY 79 usage_00182.pdb 58 VDANTAYTLGDAPQLARLDPF 78 usage_00183.pdb 58 VDANTAYTLGDAPQLARLDPF 78 usage_00184.pdb 58 VDANTAYTLGDAPQLARLDPF 78 usage_00185.pdb 58 VDANTAYTLGDAPQLARLDPF 78 usage_00186.pdb 61 VDANTAYTLGDAPQLARLDPF 81 vDANtaYtlgDAPqLarLDpf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################