################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:01:32 2021 # Report_file: c_1377_229.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00060.pdb # 2: usage_00283.pdb # 3: usage_00284.pdb # 4: usage_00790.pdb # 5: usage_01366.pdb # # Length: 88 # Identity: 20/ 88 ( 22.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 88 ( 29.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 88 ( 20.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00060.pdb 1 -------ARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTS----GVEEIPPGIVNKEL 49 usage_00283.pdb 1 EEQKKKALERSMYVLSELVETEKMYVDDLGQIVEGYMATMAA----Q--GVPESLRGRDR 54 usage_00284.pdb 1 -EQKKKALERSMYVLSELVETEKMYVDDLGQIVEGYMATMAA----Q--GVPESLRGRDR 53 usage_00790.pdb 1 -------ARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTS----GVEEIPPGIVNKEL 49 usage_01366.pdb 1 -EEEESLAILRRHVMNELLDTERAYVEELLCVLEGYAAEMDNPLMAH--LISTGLQNKKN 57 r EL TEk YV dL Y M p usage_00060.pdb 50 IIFGNMQEIYEFHNNIFLKELEK----- 72 usage_00283.pdb 55 IVFGNIQQIYEWHRDYFLQELQRCLKDP 82 usage_00284.pdb 54 IVFGNIQQIYEWHRDYFLQELQRCLKDP 81 usage_00790.pdb 50 IIFGNMQEIYEFHNNIFLKELEKY---- 73 usage_01366.pdb 58 ILFGNMEEIYHFHNRIFLRELESC---- 81 I FGN q IYe H FL EL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################