################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:03 2021 # Report_file: c_1123_63.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00214.pdb # 2: usage_00354.pdb # 3: usage_00461.pdb # 4: usage_00462.pdb # 5: usage_00635.pdb # 6: usage_00642.pdb # # Length: 79 # Identity: 29/ 79 ( 36.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 79 ( 46.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 79 ( 10.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00214.pdb 1 -DEEEMGLTDTAFDVLGFTDEEKLSMYKCTGCILHLGEMKWKQRG--EQAEADGTAEAEK 57 usage_00354.pdb 1 DDAEELRLTDTAFDILGFSHEYKTDVYKITASCMHLGEMKFKQRPREEQAEADGTEEGER 60 usage_00461.pdb 1 DDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGR 60 usage_00462.pdb 1 DDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGR 60 usage_00635.pdb 1 DDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQ----EQAESDGTAEAEK 56 usage_00642.pdb 1 DDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKLKQ--EQAEPDGTEEADK 58 D EE ltD AFD LGFt eK y T H G MKfKq EQAE DG E usage_00214.pdb 58 VAFLLGVNAGDLLKCLLK- 75 usage_00354.pdb 61 VAHLLGVNAADLYKNLVK- 78 usage_00461.pdb 61 VSKLFGCDTAELYKNLLKP 79 usage_00462.pdb 61 VSKLFGCDTAELYKNLL-- 77 usage_00635.pdb 57 VAFLCGINAGDLLKAL--- 72 usage_00642.pdb 59 SAYLMGLNSADLLKGLCH- 76 v L G L K L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################