################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:56 2021 # Report_file: c_0821_69.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00693.pdb # 2: usage_00970.pdb # 3: usage_00971.pdb # 4: usage_00972.pdb # 5: usage_01147.pdb # # Length: 70 # Identity: 9/ 70 ( 12.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 70 ( 30.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 18/ 70 ( 25.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00693.pdb 1 ----PDTLRRVFEKYGRVGDVYIPRDRYTK--ESRGFAFVRFHDKRDAEDAMDAMDGAVL 54 usage_00970.pdb 1 VPVLKKALTSLFSKAGKVVNMEFPIDEA--TGKTKGFLFVECGSMNDAKKIIKSFHGKRL 58 usage_00971.pdb 1 -----------FSKAGKVVNMEFPIDEA--TGKTKGFLFVECGSMNDAKKIIKSFHGKRL 47 usage_00972.pdb 1 VPVLKKALTSLFSKAGKVVNMEFPIDEA--TGKTKGFLFVECGSMNDAKKIIKSFHGKRL 58 usage_01147.pdb 1 ----NKALYDTFSAFGNILSCKVVCDE---N-GSKGYGFVHFETQEAAERAIEKMNGMLL 52 Fsk G v p De kGf FV dA i G L usage_00693.pdb 55 DG-RELRVQ- 62 usage_00970.pdb 59 DLKHRLFLYT 68 usage_00971.pdb 48 DLKHRLFLYT 57 usage_00972.pdb 59 DLKHRLFLYT 68 usage_01147.pdb 53 ND-RKVFVGR 61 d lf #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################