################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:33:30 2021 # Report_file: c_0815_5.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00004.pdb # 2: usage_00005.pdb # 3: usage_00008.pdb # 4: usage_00009.pdb # 5: usage_00010.pdb # 6: usage_00011.pdb # 7: usage_00012.pdb # 8: usage_00020.pdb # 9: usage_00021.pdb # 10: usage_00052.pdb # 11: usage_00093.pdb # # Length: 52 # Identity: 21/ 52 ( 40.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 23/ 52 ( 44.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 52 ( 7.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 RDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA 52 usage_00005.pdb 1 RDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA 52 usage_00008.pdb 1 NGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTV---- 48 usage_00009.pdb 1 NGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTV---- 48 usage_00010.pdb 1 NGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQA-- 50 usage_00011.pdb 1 NGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQ--- 49 usage_00012.pdb 1 NGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQA-- 50 usage_00020.pdb 1 MGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTIT--- 49 usage_00021.pdb 1 MGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTIT--- 49 usage_00052.pdb 1 NGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQA-- 50 usage_00093.pdb 1 NGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKHH- 51 DSGGPLiC G QG S G PCG P YT l WI T #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################