################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:55:48 2021 # Report_file: c_0553_34.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00219.pdb # 2: usage_00515.pdb # 3: usage_00861.pdb # 4: usage_01178.pdb # 5: usage_01179.pdb # 6: usage_01746.pdb # 7: usage_01747.pdb # 8: usage_02183.pdb # # Length: 82 # Identity: 4/ 82 ( 4.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 82 ( 11.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 27/ 82 ( 32.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00219.pdb 1 DISDAYCSAVFA-----GVKKRTKVIKNSVNPVWNEGFEWDLKG--IPLDQGSELHVVVK 53 usage_00515.pdb 1 GTSDPYVKVFLLP--DKKKKFETKVHRKTLNPVFNEQFTFKVPYSE---LGGKTLVMAVY 55 usage_00861.pdb 1 GLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQ---IQKVQVVVTVL 57 usage_01178.pdb 1 SNPNPVVQMSVG-----HKAQESKIRYKTNEPVWEENFTFFIHN-----PKRQDLEVEVR 50 usage_01179.pdb 1 -----VVQMSVG-----HKAQESKIRYKTNEPVWEENFTFFIHN-----PKRQDLEVEVR 45 usage_01746.pdb 1 SEADPYVILQLST--APGMKFKTKTLTDTSHPVWNEAFRFLIQSQV-----KNVLELSIY 53 usage_01747.pdb 1 -----YVILQLST--APGMKFKTKTLTDTSHPVWNEAFRFLIQSQV-----KNVLELSIY 48 usage_02183.pdb 1 GSSDPYVRVYLLP--DKRRRYETKVHRQTLNPHFGETFAFKVPYVE---LGGRVLVMAVY 55 v k t P E F f l usage_00219.pdb 54 DHE--T-MGRNRFLGEAK---- 68 usage_00515.pdb 56 DFDRFSKH---DIIGEFKVP-- 72 usage_00861.pdb 58 DYDKIGKN---DAIGKVFVG-- 74 usage_01178.pdb 51 DEQ--H-Q---CSLGNLKVP-- 64 usage_01179.pdb 46 DEQ--H-Q---CSLGNLKVP-- 59 usage_01746.pdb 54 DEDSVTED---DICFKVLYD-- 70 usage_01747.pdb 49 DEDSVTED---DICFKVLYDIS 67 usage_02183.pdb 56 DFDRFGRN---DAIGEVRVP-- 72 D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################