################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:12:03 2021 # Report_file: c_1399_22.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00055.pdb # 2: usage_00056.pdb # 3: usage_00959.pdb # 4: usage_00960.pdb # 5: usage_00961.pdb # 6: usage_00962.pdb # 7: usage_00963.pdb # 8: usage_00964.pdb # 9: usage_01543.pdb # # Length: 45 # Identity: 25/ 45 ( 55.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 45 ( 62.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 45 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00055.pdb 1 -ESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEEKVN- 43 usage_00056.pdb 1 -ESLSDDTRGLLQLYEASFLLTEGETTLESAREFATKFLEEKVNE 44 usage_00959.pdb 1 KASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQKKLD- 44 usage_00960.pdb 1 KASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQKKLD- 44 usage_00961.pdb 1 KASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQKKLD- 44 usage_00962.pdb 1 KASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQKKLD- 44 usage_00963.pdb 1 KASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQKKLD- 44 usage_00964.pdb 1 KASLAQDTKGMLQLYEASFLLRKGEDTLELAREFATKCLQKKLD- 44 usage_01543.pdb 1 KPSLVDDTRGLLQLYEASFLSAQGEETLRLARDFATKFLQ----- 40 SL DT G LQLYEASFLl GE TLe AReFATK L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################