################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:18:19 2021 # Report_file: c_1078_8.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00141.pdb # 2: usage_00142.pdb # 3: usage_00176.pdb # 4: usage_00234.pdb # 5: usage_00266.pdb # 6: usage_00338.pdb # 7: usage_00339.pdb # 8: usage_00340.pdb # 9: usage_00341.pdb # 10: usage_00342.pdb # # Length: 57 # Identity: 17/ 57 ( 29.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 46/ 57 ( 80.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 57 ( 19.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00141.pdb 1 -------VMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 50 usage_00142.pdb 1 --AQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 55 usage_00176.pdb 1 --------AQDIDAAVELLNNSKRPVIYAGIGTM--G-HGPAVQELARKIKAPVITT 46 usage_00234.pdb 1 ---QDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 54 usage_00266.pdb 1 SRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 57 usage_00338.pdb 1 SRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 57 usage_00339.pdb 1 -----EFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 52 usage_00340.pdb 1 -----EFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 52 usage_00341.pdb 1 SRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 57 usage_00342.pdb 1 SRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTT 57 mQsInkAadLiNlaKkPVlYvGaGil a gprllkELsdraqiPVtTT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################