################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:02 2021 # Report_file: c_0620_11.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00017.pdb # 2: usage_00022.pdb # 3: usage_00051.pdb # 4: usage_00067.pdb # 5: usage_00080.pdb # 6: usage_00103.pdb # # Length: 81 # Identity: 6/ 81 ( 7.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 81 ( 33.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 22/ 81 ( 27.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00017.pdb 1 SEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNN-DGRIDYD 59 usage_00022.pdb 1 -EEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNN-DGRIDYD 58 usage_00051.pdb 1 -EEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNN-DGRIDYD 58 usage_00067.pdb 1 --TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNK-DGKLDFE 57 usage_00080.pdb 1 SEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNN-DGRIDYD 59 usage_00103.pdb 1 --TFLKAAFNKIDKDEDGYISKSDIVSLVHDK--VLDNNDIDNFFLSVHS--IINKISFQ 54 l lF Dkn DGyid el l ddie gd dg id usage_00017.pdb 60 EFLEFMK-------------- 66 usage_00022.pdb 59 EFLEFM--------------- 64 usage_00051.pdb 59 EFLEFM--------------- 64 usage_00067.pdb 58 EFMKYLKDHEKKMKLAFKSLD 78 usage_00080.pdb 60 EFLEFMKGVE----------- 69 usage_00103.pdb 55 EFKDYMLSTF----------- 64 EF m #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################