################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:48:02 2021 # Report_file: c_1242_4.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00113.pdb # 2: usage_00119.pdb # 3: usage_00150.pdb # 4: usage_00151.pdb # 5: usage_00223.pdb # 6: usage_00493.pdb # 7: usage_01007.pdb # 8: usage_01010.pdb # 9: usage_01011.pdb # 10: usage_01020.pdb # 11: usage_01021.pdb # 12: usage_02321.pdb # # Length: 42 # Identity: 28/ 42 ( 66.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 42 ( 66.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 42 ( 33.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00113.pdb 1 DRLIVVNSSINFFGGK--PNLAILSAQKFMAKYKSKIYYL-- 38 usage_00119.pdb 1 DRLIVVNSSINFFGGK--PNLAILSAQKFMAKYKSKIYYL-- 38 usage_00150.pdb 1 -RLIVVNS---------KPNLAILSAQKFMAKYKSKIYYL-- 30 usage_00151.pdb 1 DRLIVVNS-----------NLAILSAQKFMAKYKSKIYYL-- 29 usage_00223.pdb 1 -RLIVVNS-----------NLAILSAQKFMAKYKSKIYYL-- 28 usage_00493.pdb 1 DRLIVVNSSINFFGGK--PNLAILSAQKFMAKYKSKIYYL-- 38 usage_01007.pdb 1 DRLIVVNSSINFFGGK--PNLAILSAQKFMAKYKSKIYYLFT 40 usage_01010.pdb 1 DRLIVVNSSINFFGGK--PNLAILSAQKFMAKYKSKIYYL-- 38 usage_01011.pdb 1 DRLIVVNSSINFFGGK--PNLAILSAQKFMAKYKSKIYYLFT 40 usage_01020.pdb 1 DRLIVVNSSINFFGGK--PNLAILSAQKFMAKYKSKIYYL-- 38 usage_01021.pdb 1 DRLIVVNSSINFFGGK--PNLAILSAQKFMAKYKSKIYYL-- 38 usage_02321.pdb 1 DRLIVVNSSI------NKPNLAILSAQKFMAKYKSKIYYL-- 34 RLIVVNS NLAILSAQKFMAKYKSKIYYL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################