################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:04:48 2021 # Report_file: c_0940_59.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00264.pdb # 2: usage_00265.pdb # 3: usage_00616.pdb # 4: usage_00617.pdb # 5: usage_00618.pdb # 6: usage_00619.pdb # 7: usage_00710.pdb # 8: usage_00711.pdb # 9: usage_00712.pdb # 10: usage_00713.pdb # 11: usage_01203.pdb # 12: usage_01204.pdb # 13: usage_01205.pdb # 14: usage_01206.pdb # 15: usage_01267.pdb # 16: usage_01268.pdb # 17: usage_01269.pdb # 18: usage_01702.pdb # # Length: 39 # Identity: 39/ 39 (100.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 39 (100.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 39 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00264.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00265.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00616.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00617.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00618.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00619.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00710.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00711.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00712.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_00713.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_01203.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_01204.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_01205.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_01206.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_01267.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_01268.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_01269.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 usage_01702.pdb 1 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN 39 VEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLN #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################