################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:06:28 2021 # Report_file: c_0932_4.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00260.pdb # 2: usage_00597.pdb # 3: usage_00598.pdb # 4: usage_02011.pdb # 5: usage_02012.pdb # 6: usage_02013.pdb # 7: usage_02014.pdb # 8: usage_02303.pdb # # Length: 67 # Identity: 7/ 67 ( 10.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 47/ 67 ( 70.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 67 ( 22.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00260.pdb 1 -------VLLDYTGHITWTPPAIFKSYCEIIVTHFPF-DEQNCSMKLGTRTYDGS---A- 48 usage_00597.pdb 1 PDTGNKRLMLFPDGRVIYNARFLGSFSNDMDFRLF-PFDRQQFVLELEPFSYNNQQLRFS 59 usage_00598.pdb 1 PDTGNKRLMLFPDGRVIYNARFLGSFSNDMDFRLF-PFDRQQFVLELEPFSYNNQQLRFS 59 usage_02011.pdb 1 PDTGNKRLMLFPDGRVIYNARFLGSFSNDMDFRLF-PFDRQQFVLELEPFSYNNQQLRF- 58 usage_02012.pdb 1 PDTGNKRLMLFPDGRVIYNARFLGSFSNDMDFRLF-PFDRQQFVLELEPFSYNNQQLRF- 58 usage_02013.pdb 1 PDTGNKRLMLFPDGRVIYNARFLGSFSNDMDFRLF-PFDRQQFVLELEPFSYNNQQLRF- 58 usage_02014.pdb 1 PDTGNKRLMLFPDGRVIYNARFLGSFSNDMDFRLF-PFDRQQFVLELEPFSYNNQQLRF- 58 usage_02303.pdb 1 PDTGNKRLMLFPDGRVIYNARFLGSFSNDMDFRLF-PFDRQQFVLELEPFSYNNQQLRF- 58 lmLfpdGrviynarflgsfsndmdfrlF p DrQqfvleLepfsYnnq f usage_00260.pdb 49 -VAINP- 53 usage_00597.pdb 60 DIQVYTE 66 usage_00598.pdb 60 DIQVYTE 66 usage_02011.pdb 59 -SDIQV- 63 usage_02012.pdb 59 -SDIQV- 63 usage_02013.pdb 59 -SDIQV- 63 usage_02014.pdb 59 -SDIQV- 63 usage_02303.pdb 59 -SDIQV- 63 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################