################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:47 2021 # Report_file: c_0835_94.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00089.pdb # 2: usage_00916.pdb # 3: usage_00917.pdb # 4: usage_00918.pdb # 5: usage_01014.pdb # 6: usage_01253.pdb # # Length: 117 # Identity: 13/117 ( 11.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 24/117 ( 20.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 37/117 ( 31.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00089.pdb 1 IGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKT 60 usage_00916.pdb 1 --------LPVVQD-KTDFIFISVD-DVLDQSHAPGCPAIGPGGLYTDELLEAVKYIAQQ 50 usage_00917.pdb 1 --------LPVVQD-KTDFIFISVD-DVLDQSHAPGCPAIGPGGLYTDELLEAVKYIAQQ 50 usage_00918.pdb 1 LIPTIKEILPVVQD-KTDFIFISVD-DVLDQSHAPGCPAIGPGGLYTDELLEAVKYIAQQ 58 usage_01014.pdb 1 MTRVMEETIAYLKE-RTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEA 59 usage_01253.pdb 1 IYNTICTALEKIDPNSNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILAET 60 l i S D D lD s aPg GGL E a usage_00089.pdb 61 GLLSGLDIMEVNPSLGKT---------------PEEVTRTVNTAVAITLAC------ 96 usage_00916.pdb 51 PNVAGIEIVEVDPTLDFR---------------D-----TSRAAAHVLLHALKGKL- 86 usage_00917.pdb 51 PNVAGIEIVEVDPTLDFR---------------D-----TSRAAAHVLLHALKGK-- 85 usage_00918.pdb 59 PNVAGIEIVEVDPTLDFR---------------D-----TSRAAAHVLLHALKGKLS 95 usage_01014.pdb 60 QIITSAEFVEVNPILDER---------------N----KTASVAVALMGS------- 90 usage_01253.pdb 61 KRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNAT----KTGKLCLELIARVLG---- 109 vEv P Ld T a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################