################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:04:50 2021 # Report_file: c_0940_127.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00537.pdb # 2: usage_00561.pdb # 3: usage_00562.pdb # 4: usage_00563.pdb # 5: usage_00564.pdb # 6: usage_00604.pdb # 7: usage_00605.pdb # 8: usage_00606.pdb # 9: usage_00675.pdb # 10: usage_01064.pdb # 11: usage_01065.pdb # 12: usage_01680.pdb # 13: usage_01682.pdb # # Length: 45 # Identity: 4/ 45 ( 8.9%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 45 ( 71.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 9/ 45 ( 20.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00537.pdb 1 FLDETPSLAP-NGTMVIYSSSQGMGSVLNLVSTD-GRFKAR---- 39 usage_00561.pdb 1 FLDETPSLAP-NGTMVLYSSSQGMGSVLNLVSTD-GRFKARLPAT 43 usage_00562.pdb 1 FLDETPSLAP-NGTMVIYSSSQGMGSVLNLVSTD-GRFKARLPAT 43 usage_00563.pdb 1 FLDETPSLAP-NGTMVIYSSSQGMGSVLNLVSTD-GRFKARLPAT 43 usage_00564.pdb 1 FLDETPSLAP-NGTMVIYSSSQGMGSVLNLVSTD-GRFKARLPAT 43 usage_00604.pdb 1 FLDETPSLAP-NGTMVIYSSSQGMGSVLNLVSTD-GRFKARLPA- 42 usage_00605.pdb 1 FLDETPSLAP-NGTMVIYSSSQGMGSVLNLVSTD-GRFKARLPA- 42 usage_00606.pdb 1 FLDETPSLAP-NGTMVIYSSSQGMGSVLNLVSTD-GRFKARLPA- 42 usage_00675.pdb 1 -EISFLHA-DDEMNYLIYKKTDGDETVLVIINRSDQKADIPIP-- 41 usage_01064.pdb 1 LLDETPSIAP-NGT-VIYSSTQGLGSVLQLVSTD-GRFKAR---- 38 usage_01065.pdb 1 LLDETPSIAP-NGT-VIYSSTQGLGSVLQLVSTD-GRFKAR---- 38 usage_01680.pdb 1 LLDETPSIAP-NGT-VIYSSTQGLGSVLQLVSTD-GRFKARLP-- 40 usage_01682.pdb 1 LLDETPSIAP-NGT-VIYSSTQGLGSVLQLVSTD-GRFKARLP-- 40 ldetps p ngt viYss qG gsVL lvstd grfkar #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################