################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:57 2021 # Report_file: c_1250_29.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00657.pdb # 2: usage_00658.pdb # 3: usage_00665.pdb # 4: usage_00694.pdb # 5: usage_00695.pdb # 6: usage_01019.pdb # 7: usage_01020.pdb # 8: usage_01039.pdb # 9: usage_01674.pdb # # Length: 41 # Identity: 12/ 41 ( 29.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 41 ( 29.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 41 ( 17.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00657.pdb 1 FLIGVSGGTASGKSSVCAKIVQLLGQ----YRQKQVVILS- 36 usage_00658.pdb 1 FLIGVSGGTASGKSSVCAKIVQLLGQ----YRQKQVVILS- 36 usage_00665.pdb 1 FLIGVSGGTASGKSSVCAKIVQLLGQN----RQKQVVILS- 36 usage_00694.pdb 1 FLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILS- 40 usage_00695.pdb 1 FLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILS- 40 usage_01019.pdb 1 FLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILS- 40 usage_01020.pdb 1 FLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILS- 40 usage_01039.pdb 1 FIIGVAGSVAVGKSTTARVLQALLAR--WDH-HPRVDLVTT 38 usage_01674.pdb 1 FIIGVAGSVAVGKSTTARVLQALLAR--WDH-HPRVDLVTT 38 F IGV G A GKS LL V #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################