################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:10:38 2021 # Report_file: c_1076_55.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01227.pdb # 2: usage_01228.pdb # 3: usage_01229.pdb # 4: usage_01230.pdb # 5: usage_01231.pdb # 6: usage_01650.pdb # 7: usage_01651.pdb # 8: usage_01652.pdb # 9: usage_01653.pdb # # Length: 47 # Identity: 18/ 47 ( 38.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 47 ( 38.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 47 ( 4.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01227.pdb 1 RADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQLFKHSIHILE- 46 usage_01228.pdb 1 RADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQLFKHSIHILE- 46 usage_01229.pdb 1 RADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQLFKHSIHILE- 46 usage_01230.pdb 1 -PDTVDLLAAHGVKLIGIDTPSLDPQESKTMDAHRRVRAHRMAILEG 46 usage_01231.pdb 1 -PDTVDLLAAHGVKLIGIDTPSLDPQESKTMDAHRRVRAHRMAILEG 46 usage_01650.pdb 1 RADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQLFKHSIHILE- 46 usage_01651.pdb 1 RADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQLFKHSIHILE- 46 usage_01652.pdb 1 RADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQLFKHSIHILE- 46 usage_01653.pdb 1 RADIAPFLSEKGIRLIGVDVPSVDPLDDKELAAHHQLFKHSIHILE- 46 D L G LIG D PS DP K AH H ILE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################