################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:16:46 2021 # Report_file: c_0769_56.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00292.pdb # 2: usage_00427.pdb # 3: usage_00428.pdb # 4: usage_00449.pdb # 5: usage_00614.pdb # # Length: 74 # Identity: 26/ 74 ( 35.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 27/ 74 ( 36.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 74 ( 13.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00292.pdb 1 GVMPHPVPGK-NGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEIC 59 usage_00427.pdb 1 --ALQPVPMQ-DGSLALADVRAAIA-DDVHFTPTRLVCLENTHN---GKVLPLPYLREMR 53 usage_00428.pdb 1 --ALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHN---GKVLPLPYLREMR 55 usage_00449.pdb 1 --MPHPVPGK-NGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEIC 57 usage_00614.pdb 1 --PHPV-PGK-NG-ADPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEIC 55 p P G DVR AI HF T L ENTHN G V PL E usage_00292.pdb 60 TIAKEHGINVHIDG 73 usage_00427.pdb 54 ELVDEHGLQLHLD- 66 usage_00428.pdb 56 ELVDEHGLQLHLD- 68 usage_00449.pdb 58 TIAKEHGINVHIDG 71 usage_00614.pdb 56 TIAKEHGINVHIDG 69 EHG H D #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################