################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:06 2021 # Report_file: c_1125_10.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00025.pdb # 2: usage_00181.pdb # 3: usage_00297.pdb # 4: usage_00537.pdb # 5: usage_00538.pdb # 6: usage_00539.pdb # # Length: 72 # Identity: 69/ 72 ( 95.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 69/ 72 ( 95.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 72 ( 4.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00025.pdb 1 -AAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKV 59 usage_00181.pdb 1 PAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKV 60 usage_00297.pdb 1 -AAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKV 59 usage_00537.pdb 1 PAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKV 60 usage_00538.pdb 1 -AAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKV 59 usage_00539.pdb 1 -AAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKV 59 AAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKV usage_00025.pdb 60 ESSKDFLIAT-- 69 usage_00181.pdb 61 ESSKDFLIATLK 72 usage_00297.pdb 60 ESSKDFLIATLK 71 usage_00537.pdb 61 ESSKDFLIATLK 72 usage_00538.pdb 60 ESSKDFLIATLK 71 usage_00539.pdb 60 ESSKDFLIATLK 71 ESSKDFLIAT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################