################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:28 2021 # Report_file: c_1491_91.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01631.pdb # 2: usage_01928.pdb # 3: usage_02598.pdb # 4: usage_02599.pdb # 5: usage_02709.pdb # 6: usage_03514.pdb # 7: usage_03515.pdb # 8: usage_03516.pdb # 9: usage_03517.pdb # # Length: 36 # Identity: 7/ 36 ( 19.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 36 ( 72.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 36 ( 11.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01631.pdb 1 TAFEYHGTDPRFNKVFNKGMSDHSTITMKKILET-- 34 usage_01928.pdb 1 TAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLE--- 33 usage_02598.pdb 1 SAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLEL-- 34 usage_02599.pdb 1 SAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLEL-- 34 usage_02709.pdb 1 -VYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCR 35 usage_03514.pdb 1 SAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLEL-- 34 usage_03515.pdb 1 SAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLEL-- 34 usage_03516.pdb 1 SAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLEL-- 34 usage_03517.pdb 1 SAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLEL-- 34 afEyhgtDprFn vFneGM hS i kklle #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################