################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:38:53 2021 # Report_file: c_0672_88.html ################################################################################################ #==================================== # Aligned_structures: 16 # 1: usage_00456.pdb # 2: usage_00458.pdb # 3: usage_00460.pdb # 4: usage_00462.pdb # 5: usage_00477.pdb # 6: usage_00479.pdb # 7: usage_00481.pdb # 8: usage_00483.pdb # 9: usage_00550.pdb # 10: usage_00551.pdb # 11: usage_00552.pdb # 12: usage_00553.pdb # 13: usage_00813.pdb # 14: usage_00814.pdb # 15: usage_00815.pdb # 16: usage_00816.pdb # # Length: 42 # Identity: 35/ 42 ( 83.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 42 ( 83.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 42 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00456.pdb 1 --SICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPL 40 usage_00458.pdb 1 --SICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPL 40 usage_00460.pdb 1 DPSICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPL 42 usage_00462.pdb 1 DPSICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPL 42 usage_00477.pdb 1 --SICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPL 40 usage_00479.pdb 1 --SICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPL 40 usage_00481.pdb 1 --SICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPL 40 usage_00483.pdb 1 --SICRADTDYYIATSTFEWFPGVQIHHSKDLVNWHLVAHPL 40 usage_00550.pdb 1 DPSIVRAGDDYYIATSTFEWFPGVQIHHSKDLVHWHLVAHPL 42 usage_00551.pdb 1 DPSIVRAGDDYYIATSTFEWFPGVQIHHSKDLVHWHLVAHPL 42 usage_00552.pdb 1 DPSIVRAGDDYYIATSTFEWFPGVQIHHSKDLVHWHLVAHPL 42 usage_00553.pdb 1 DPSIVRAGDDYYIATSTFEWFPGVQIHHSKDLVHWHLVAHPL 42 usage_00813.pdb 1 DPSICRAGEDYYIAVSTFEWFPGVQIHHSKDLVNWHLVAHPL 42 usage_00814.pdb 1 DPSICRAGEDYYIAVSTFEWFPGVQIHHSKDLVNWHLVAHPL 42 usage_00815.pdb 1 DPSICRAGEDYYIAVSTFEWFPGVQIHHSKDLVNWHLVAHPL 42 usage_00816.pdb 1 DPSICRAGEDYYIAVSTFEWFPGVQIHHSKDLVNWHLVAHPL 42 SI RA DYYIA STFEWFPGVQIHHSKDLV WHLVAHPL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################