################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:30:30 2021 # Report_file: c_1021_33.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00088.pdb # 2: usage_00235.pdb # 3: usage_00237.pdb # 4: usage_00603.pdb # 5: usage_00604.pdb # 6: usage_00732.pdb # # Length: 65 # Identity: 35/ 65 ( 53.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 45/ 65 ( 69.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 8/ 65 ( 12.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00088.pdb 1 PFAVVFAAMGITQRELSYFIQEFERTGALSRSVLFLNKADDPTIERILTPRMALTVAEYL 60 usage_00235.pdb 1 --AVVFAAIGITFEEAEFF-EDFRQTGAIDRSV-F-NLANDPAIERIATPR-ALTAAEYL 54 usage_00237.pdb 1 ----VFAAIGITFEEAEFF-EDFRQTGAIDRSV-F-NLANDPAIERIATPR-ALTAAEYL 52 usage_00603.pdb 1 ----VFAAIGITFEEAEFFMEDFRQTGAIDRSVMFMNLANDPAIERIATPRMALTAAEYL 56 usage_00604.pdb 1 DFAVVFAAIGITFEEAEFFMEDFRQTGAIDRSVMFMNLANDPAIERIATPRMALTAAEYL 60 usage_00732.pdb 1 AFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYL 60 VFAA GIT eEa F dF TGA RsV F NlA DPaiERI TPR ALTaAEYL usage_00088.pdb 61 AFEHD 65 usage_00235.pdb 55 AYEKG 59 usage_00237.pdb 53 AYEKG 57 usage_00603.pdb 57 AYEKG 61 usage_00604.pdb 61 AYEKG 65 usage_00732.pdb 61 AYEHG 65 AyE g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################