################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:11:29 2021 # Report_file: c_1276_10.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00047.pdb # 2: usage_00048.pdb # 3: usage_00049.pdb # 4: usage_00549.pdb # 5: usage_00811.pdb # 6: usage_00812.pdb # 7: usage_00813.pdb # 8: usage_01104.pdb # 9: usage_01105.pdb # # Length: 51 # Identity: 22/ 51 ( 43.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 22/ 51 ( 43.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 51 ( 13.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00047.pdb 1 --LVLPNATFTQIWKDSGLPGSKWREQIYD-DDFAIAMKAAVGKWGADSWK 48 usage_00048.pdb 1 --LVLPNATFTQIWKDSGLPGSKWREQIYD-DDFAIAMKAAVGKWGA---- 44 usage_00049.pdb 1 --LVLPNATFTQIWKDSGLPGSKWREQIYD-DDFAIAMKAAVGKWGA---- 44 usage_00549.pdb 1 EYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADS-- 49 usage_00811.pdb 1 --LVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGA---- 45 usage_00812.pdb 1 --LVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGA---- 45 usage_00813.pdb 1 EYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGA---- 47 usage_01104.pdb 1 LYLVLTRDQISSIWQASGLGSTPWRSEIFDCDDFATVFKGAVAKWGNEN-- 49 usage_01105.pdb 1 LYLVLTRDQISSIWQASGLGSTPWRSEIFDCDDFATVFKGAVAKWGNEN-- 49 LVL IW SGL WR I D DDFA K AV KWG #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################