################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:54:24 2021 # Report_file: c_1165_58.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00004.pdb # 2: usage_00397.pdb # 3: usage_00398.pdb # 4: usage_00401.pdb # 5: usage_00402.pdb # 6: usage_00407.pdb # 7: usage_00408.pdb # 8: usage_00569.pdb # 9: usage_00836.pdb # 10: usage_00837.pdb # 11: usage_00838.pdb # 12: usage_00839.pdb # 13: usage_00859.pdb # 14: usage_01211.pdb # 15: usage_01321.pdb # 16: usage_01322.pdb # 17: usage_01497.pdb # # Length: 32 # Identity: 5/ 32 ( 15.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 6/ 32 ( 18.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 32 ( 6.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00004.pdb 1 QCSCSGTTVDCRSKRHASVPAGIPTNAQILYL 32 usage_00397.pdb 1 KCRCEGTTVDCSNQKLNKIPEHIPQYTAELRL 32 usage_00398.pdb 1 KCRCEGTTVDCSNQKLNKIPEHIPQYTAELRL 32 usage_00401.pdb 1 -CSCSGTEVNCAGKSLASVPAGIPTTTRVLYL 31 usage_00402.pdb 1 QCSCSGTEVNCAGKSLASVPAGIPTTTRVLYL 32 usage_00407.pdb 1 ACTCSNNIVDCRGKGLTEIPTNLPETITEIRL 32 usage_00408.pdb 1 ACTCSNNIVDCRGKGLTEIPTNLPETITEIRL 32 usage_00569.pdb 1 -CTCLDTVVRCSNKGLKVLPKGIPRDVTELYL 31 usage_00836.pdb 1 RCSCSGTEIRCNSKGLTSVPTGIPSSATRLEL 32 usage_00837.pdb 1 RCSCSGTEIRCNSKGLTSVPTGIPSSATRLEL 32 usage_00838.pdb 1 RCSCSGTEIRCNSKGLTSVPTGIPSSATRLEL 32 usage_00839.pdb 1 RCSCSGTEIRCNSKGLTSVPTGIPSSATRLEL 32 usage_00859.pdb 1 RCSCSGTEIRCNSKGLTSVPTGIPSSATRLEL 32 usage_01211.pdb 1 RCTCSGDSLDCGGRGLAALPGDLPSSTRSLNL 32 usage_01321.pdb 1 -CSCAGTLVDCGRRGLTALPALPARTTE-LVL 30 usage_01322.pdb 1 -CSCAGTLVDCGRRGLTALPALPARTTE-LVL 30 usage_01497.pdb 1 -CHCEGTTVDCTGRGLKEIPRDIPLHTTELLL 31 C C C l P L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################