################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:21 2021 # Report_file: c_1222_25.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00578.pdb # 2: usage_00579.pdb # 3: usage_00580.pdb # 4: usage_00581.pdb # 5: usage_00582.pdb # 6: usage_00583.pdb # 7: usage_00584.pdb # 8: usage_00585.pdb # 9: usage_00734.pdb # 10: usage_01079.pdb # 11: usage_01958.pdb # 12: usage_01959.pdb # # Length: 30 # Identity: 29/ 30 ( 96.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 29/ 30 ( 96.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 30 ( 3.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00578.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_00579.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHVQ 30 usage_00580.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_00581.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_00582.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_00583.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_00584.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_00585.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHVQ 30 usage_00734.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_01079.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_01958.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 usage_01959.pdb 1 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV- 29 VGMFRMVDEHGGDDKVLCVPAGDPRWDHV #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################