################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:58 2021 # Report_file: c_1050_51.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00220.pdb # 2: usage_00221.pdb # 3: usage_00222.pdb # 4: usage_00223.pdb # 5: usage_00532.pdb # 6: usage_00533.pdb # 7: usage_00534.pdb # 8: usage_00535.pdb # 9: usage_00536.pdb # 10: usage_00537.pdb # 11: usage_00749.pdb # # Length: 56 # Identity: 41/ 56 ( 73.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 41/ 56 ( 73.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 56 ( 26.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00220.pdb 1 -EFYFVRTKVDSDITNEAD-------KEKVLQDIRLNCVNTFRENGIAEPPIFLL- 47 usage_00221.pdb 1 -EFYFVRTKVDSDITNE----------EKVLQDIRLNCVNTFRENGIAEPPIFLL- 44 usage_00222.pdb 1 KEFYFVRTKVDSDITNEAD-------KEKVLQDIRLNCVNTFRENGIAEPPIFLLS 49 usage_00223.pdb 1 KEFYFVRTKVDSDITNE----------EKVLQDIRLNCVNTFRENGIAEPPIFLL- 45 usage_00532.pdb 1 -EFYFVRTKVDSDITNEADGKPQT---EKVLQDIRLNCVNTFRENGIAEPPIFLLS 52 usage_00533.pdb 1 EEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLL- 55 usage_00534.pdb 1 -EFYFVRTKVDSDITNEAD-----FDKEKVLQDIRLNCVNTFRENGIAEPPIFLL- 49 usage_00535.pdb 1 -EFYFVRTKVDSDITNEADGK---FDKEKVLQDIRLNCVNTFRENGIAEPPIFLL- 51 usage_00536.pdb 1 -EFYFVRTKVDSDITNEADGT---FDKEKVLQDIRLNCVNTFRENGIAEPPIFLL- 51 usage_00537.pdb 1 -EFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLL- 54 usage_00749.pdb 1 ---YFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFL-- 51 YFVRTKVDSDITNE EKVLQDIRLNCVNTFRENGIAEPPIFL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################