################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:52:47 2021 # Report_file: c_1115_83.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00005.pdb # 2: usage_00006.pdb # 3: usage_00982.pdb # 4: usage_00983.pdb # 5: usage_00984.pdb # 6: usage_00985.pdb # 7: usage_00986.pdb # 8: usage_00987.pdb # 9: usage_00988.pdb # 10: usage_00989.pdb # 11: usage_01451.pdb # 12: usage_01452.pdb # # Length: 68 # Identity: 62/ 68 ( 91.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 62/ 68 ( 91.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 68 ( 8.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00005.pdb 1 ---LLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 57 usage_00006.pdb 1 NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 60 usage_00982.pdb 1 -LHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 59 usage_00983.pdb 1 -LHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 59 usage_00984.pdb 1 NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 60 usage_00985.pdb 1 --HLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 58 usage_00986.pdb 1 NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 60 usage_00987.pdb 1 NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 60 usage_00988.pdb 1 -LHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 59 usage_00989.pdb 1 --HLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 58 usage_01451.pdb 1 ---LLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 57 usage_01452.pdb 1 NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI 60 LLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTI usage_00005.pdb 58 ANKIRKES 65 usage_00006.pdb 61 ANKIRKES 68 usage_00982.pdb 60 ANKIRKES 67 usage_00983.pdb 60 ANKIR--- 64 usage_00984.pdb 61 ANKIRKE- 67 usage_00985.pdb 59 ANKIRKES 66 usage_00986.pdb 61 ANKIRKE- 67 usage_00987.pdb 61 ANKIRKES 68 usage_00988.pdb 60 ANKIRKES 67 usage_00989.pdb 59 ANKIRKE- 65 usage_01451.pdb 58 ANKIRKES 65 usage_01452.pdb 61 ANKIRKE- 67 ANKIR #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################