################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:29:46 2021 # Report_file: c_0831_10.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00188.pdb # 2: usage_00211.pdb # 3: usage_00333.pdb # 4: usage_00381.pdb # 5: usage_00403.pdb # 6: usage_00586.pdb # # Length: 105 # Identity: 20/105 ( 19.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/105 ( 36.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 26/105 ( 24.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00188.pdb 1 ---GIYMALKKAS-RYG-RPLYITENGIATL-----------------DDEWRVEFIIQH 38 usage_00211.pdb 1 --EGLHHLLKRLGREVP-WPLYVTENGAAYPDLWTGEA-------VVE-DPERVAYLEAH 49 usage_00333.pdb 1 CAAGFRDFLVWISKRYGYPPIYVTENGTSIK----GESDLPKEKI-LE-DDFRVKYYNEY 54 usage_00381.pdb 1 --EGLHHLLKRLGREVP-WPLYVTENGAAYPDLWTGEA-------VVE-DPERVAYLEAH 49 usage_00403.pdb 1 YPQALEATIREAWRVAG-IPVMVTENGLATE-----------------DDTQRVAYLRTA 42 usage_00586.pdb 1 --EGLYHLLKRLGREVP-WPLYVTENGAAYPDLWTGEA-------VVE-DPERVAYLEAH 49 g l P yvTENG a D RV y usage_00188.pdb 39 LQYVHKAIE-DGLDVRGYFYWSFMDNYEWKEGFGPRFGLVEVD-- 80 usage_00211.pdb 50 VEAALRARE-EGVDLRGYFVWSLMDNFEWAFGYTRRSGLYYVD-- 91 usage_00333.pdb 55 IRAMVTAVELDGVNVKGYFAWSLMDNFEWADGYVTRFGVTYVDYE 99 usage_00381.pdb 50 VEAALRARE-EGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVD-- 91 usage_00403.pdb 43 VDGVASCLA-DGIDVRGYIAWTAFDNFEWIFGYGPKFGLIAVD-- 84 usage_00586.pdb 50 VEAALRARE-EGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVD-- 91 a e G d rGYf Ws mDNfEW Gy rfGl VD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################