################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:17:16 2021
# Report_file: c_1296_96.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_00091.pdb
#   2: usage_00092.pdb
#   3: usage_00515.pdb
#   4: usage_00516.pdb
#   5: usage_00517.pdb
#   6: usage_00518.pdb
#   7: usage_00519.pdb
#   8: usage_00520.pdb
#   9: usage_00552.pdb
#  10: usage_00553.pdb
#  11: usage_00554.pdb
#  12: usage_00555.pdb
#  13: usage_01379.pdb
#  14: usage_01380.pdb
#
# Length:         31
# Identity:       26/ 31 ( 83.9%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     26/ 31 ( 83.9%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            3/ 31 (  9.7%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00091.pdb         1  -ERSDYASSGIEDIVLDIVNHDGSISTTRFK   30
usage_00092.pdb         1  -ERSDYASSGIEDIVLDIVNHDGSISTTRFK   30
usage_00515.pdb         1  DERSDYASPGIEDIVLDIVNYDGSISTTRFK   31
usage_00516.pdb         1  DERSDYASPGIEDIVLDIVNYDGSISTTRFK   31
usage_00517.pdb         1  DERSDYASPGIEDIVLDIVNYDGSISTTRFK   31
usage_00518.pdb         1  -ERSDYASPGIEDIVLDIVNYDGSISTTRFK   30
usage_00519.pdb         1  -ERSDYASPGIEDIVLDIVNYDGSISTTRFK   30
usage_00520.pdb         1  DERSDYASPGIEDIVLDIVNYDGSISTTRFK   31
usage_00552.pdb         1  -ERSDYASSGIEDIVLDIVNHDGSISTTRFK   30
usage_00553.pdb         1  -ERSDYASSGIEDIVLDIVNHDGSISTTR--   28
usage_00554.pdb         1  DERSDYASSGIEDIVLDIVNHDGSISTTRFK   31
usage_00555.pdb         1  -ERSDYASSGIEDIVLDIVNHDGSISTTR--   28
usage_01379.pdb         1  -ERSDYASPGIEDIVLDIVNYDGSISTTRFK   30
usage_01380.pdb         1  DERSDYASPGIEDIVLDIVNYDGSISTTRFK   31
                            ERSDYAS GIEDIVLDIVN DGSISTTR  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################