################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:26:02 2021 # Report_file: c_1032_61.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00265.pdb # 2: usage_00611.pdb # 3: usage_00612.pdb # 4: usage_00613.pdb # 5: usage_00614.pdb # 6: usage_00615.pdb # 7: usage_00794.pdb # 8: usage_00795.pdb # 9: usage_00796.pdb # 10: usage_00797.pdb # # Length: 48 # Identity: 25/ 48 ( 52.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 43/ 48 ( 89.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 48 ( 10.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00265.pdb 1 NIRIVLIETSHSGNIGSAARA-KT-GLTQLCLVSPKSV-DEQSYALS- 44 usage_00611.pdb 1 RIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARA- 47 usage_00612.pdb 1 RIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARAS 48 usage_00613.pdb 1 RIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARA- 47 usage_00614.pdb 1 RIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARA- 47 usage_00615.pdb 1 RIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARA- 47 usage_00794.pdb 1 RIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARA- 47 usage_00795.pdb 1 RIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARA- 47 usage_00796.pdb 1 -IRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARA- 46 usage_00797.pdb 1 RIRVVLVNTSHPGNIGGAARAMKNMGLSQLVLVQPESFPHGDAVARA- 47 IRvVLvnTSHpGNIGgAARA Kn GLsQLvLVqPeSf hgdavAra #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################