################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:31:32 2021 # Report_file: c_1269_19.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00138.pdb # 2: usage_00387.pdb # 3: usage_00388.pdb # 4: usage_00916.pdb # 5: usage_00917.pdb # 6: usage_01270.pdb # # Length: 51 # Identity: 36/ 51 ( 70.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 39/ 51 ( 76.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 51 ( 19.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00138.pdb 1 --------KNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYN 43 usage_00387.pdb 1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKK-- 49 usage_00388.pdb 1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKK-- 49 usage_00916.pdb 1 --------KNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYN 43 usage_00917.pdb 1 --------KNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYN 43 usage_01270.pdb 1 --------KNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYN 43 KNADMSE MQQDaVdCATQA EKYNIEKDIAAyIKKEFDKK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################