################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:09:43 2021 # Report_file: c_1371_104.html ################################################################################################ #==================================== # Aligned_structures: 4 # 1: usage_00046.pdb # 2: usage_00609.pdb # 3: usage_01759.pdb # 4: usage_01760.pdb # # Length: 75 # Identity: 45/ 75 ( 60.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 62/ 75 ( 82.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 13/ 75 ( 17.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 -----QEIYKQTKLFLEG---MHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVE 52 usage_00609.pdb 1 ----FHKTGQEIYKQTKLFLEGHYKRDLSIEEQSECAQDFYHNVAER-QTRGKVPPERVE 55 usage_01759.pdb 1 ---TGQEIYKQTKLFLEG---MHYKRDLSIEEQSECAQDFYHNVAERMQTRGK-PPERVE 53 usage_01760.pdb 1 FHKTGQEIYKQTKLFLEG---MHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVE 57 qeiykqtklfleg mHYKRDLSIEEQSECAQDFYHNVAER QTRGK PPERVE usage_00046.pdb 53 KIMDQIEKYIMTRL- 66 usage_00609.pdb 56 KI-DQIEKYITRL-- 67 usage_01759.pdb 54 KIMDQIEKYIMTRLY 68 usage_01760.pdb 58 KIMDQIEKYIMTRL- 71 KI DQIEKYImtr #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################