################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:08:26 2021 # Report_file: c_1488_104.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_01543.pdb # 2: usage_04616.pdb # 3: usage_04617.pdb # 4: usage_04618.pdb # 5: usage_04620.pdb # 6: usage_04621.pdb # 7: usage_04623.pdb # 8: usage_05518.pdb # 9: usage_05519.pdb # # Length: 42 # Identity: 24/ 42 ( 57.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 28/ 42 ( 66.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 42 ( 14.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01543.pdb 1 ----ELGKVLAKSILPQLKSGNIVSDHDGSTNGLINMFNTR- 37 usage_04616.pdb 1 QWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNEL- 41 usage_04617.pdb 1 QWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNEL- 41 usage_04618.pdb 1 ----ELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNE-- 36 usage_04620.pdb 1 QWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNEL- 41 usage_04621.pdb 1 QWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNEL- 41 usage_04623.pdb 1 ----ELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNEL- 37 usage_05518.pdb 1 -WGVELGKLLAKSILLQLQPGQKVTNHDSSTNGLIELFNERS 41 usage_05519.pdb 1 ----ELGKLLAKSILLQLQPGQKVTNHDSSTNGLIELFNE-- 36 ELGK LAKSIL QL pG V nHDsSTNGLI FNe #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################