################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:04:32 2021
# Report_file: c_1420_71.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_00264.pdb
#   2: usage_00582.pdb
#   3: usage_00583.pdb
#   4: usage_00604.pdb
#   5: usage_00620.pdb
#   6: usage_00874.pdb
#   7: usage_00982.pdb
#   8: usage_00983.pdb
#   9: usage_01002.pdb
#  10: usage_01132.pdb
#  11: usage_01133.pdb
#  12: usage_01134.pdb
#  13: usage_01499.pdb
#
# Length:         34
# Identity:       20/ 34 ( 58.8%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     28/ 34 ( 82.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            3/ 34 (  8.8%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00264.pdb         1  SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FIGF   33
usage_00582.pdb         1  SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF   33
usage_00583.pdb         1  SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF   33
usage_00604.pdb         1  SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FI--   31
usage_00620.pdb         1  SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FIGF   33
usage_00874.pdb         1  SPLLSHQDEEAFPNPREWNPERNMKLVDGAFCGF   34
usage_00982.pdb         1  SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF   33
usage_00983.pdb         1  SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF   33
usage_01002.pdb         1  SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF   33
usage_01132.pdb         1  SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FIGF   33
usage_01133.pdb         1  SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FI--   31
usage_01134.pdb         1  SPLLSHHDEEAFPEPRRWDPERDEKVEGA-FIGF   33
usage_01499.pdb         1  SPLLSHHDEEAFPNPRLWDPERDEKVDGA-FIGF   33
                           SPLLSHhDEEAFP PR WdPERdeKv ga Fi  


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################