################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:22:11 2021 # Report_file: c_0307_5.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00054.pdb # 2: usage_00055.pdb # 3: usage_00057.pdb # 4: usage_00077.pdb # 5: usage_00094.pdb # 6: usage_00148.pdb # # Length: 81 # Identity: 23/ 81 ( 28.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 36/ 81 ( 44.4%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 81 ( 17.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00054.pdb 1 -PLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLID--------NEKV 51 usage_00055.pdb 1 --LEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLID--------NEKV 50 usage_00057.pdb 1 --LEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLID--------RNEK 50 usage_00077.pdb 1 --LALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFK-----AKR-VM- 51 usage_00094.pdb 1 --LELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTV--------TGV- 49 usage_00148.pdb 1 LPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDES-RN-EKV 58 Le IDK I v s rEF GtLvGFDd VN L D E usage_00054.pdb 52 -MQHHGRMLLSGNNIAILVP- 70 usage_00055.pdb 51 -MQHHGRMLLSGNNIAILVP- 69 usage_00057.pdb 51 VMQHHGRMLLSGNNIAILVP- 70 usage_00077.pdb 52 -VNRLETILLSGNNVAMLVP- 70 usage_00094.pdb 50 -TEKHSEMLLNGNGMCMLIPG 69 usage_00148.pdb 59 -MQHHGRMLLSGNNIAILVP- 77 h mLLsGNn a LvP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################