################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:13:57 2021 # Report_file: c_1192_84.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00270.pdb # 2: usage_00271.pdb # 3: usage_00437.pdb # 4: usage_00438.pdb # 5: usage_00439.pdb # 6: usage_01246.pdb # 7: usage_01247.pdb # 8: usage_01248.pdb # 9: usage_01249.pdb # 10: usage_01299.pdb # 11: usage_02003.pdb # 12: usage_02004.pdb # 13: usage_02005.pdb # 14: usage_02006.pdb # # Length: 43 # Identity: 21/ 43 ( 48.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 21/ 43 ( 48.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 43 ( 4.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00270.pdb 1 DFVGHGIGPTIHESPMIPHYGEAGKGLRLKEGMVITIEPMVNT 43 usage_00271.pdb 1 DFVGHGIGPTIHESPMIPHYGEAGKGLRLKEGMVITIEPMVNT 43 usage_00437.pdb 1 --CGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQ 41 usage_00438.pdb 1 EYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQ 43 usage_00439.pdb 1 --CGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQ 41 usage_01246.pdb 1 DYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINA 43 usage_01247.pdb 1 DYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINA 43 usage_01248.pdb 1 DYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINA 43 usage_01249.pdb 1 --TGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINA 41 usage_01299.pdb 1 DYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINA 43 usage_02003.pdb 1 EYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQ 43 usage_02004.pdb 1 EYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQ 43 usage_02005.pdb 1 EYCGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQ 43 usage_02006.pdb 1 --CGHGIGKVFHEEPQVLHYGRAGTGIELKEGMIFTIEPMINQ 41 GHGIG H P YG G G LKEGM T EPM N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################