################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:23:42 2021 # Report_file: c_0787_4.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00527.pdb # 2: usage_00528.pdb # 3: usage_00753.pdb # 4: usage_01025.pdb # 5: usage_01113.pdb # 6: usage_01114.pdb # # Length: 95 # Identity: 13/ 95 ( 13.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 37/ 95 ( 38.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 95 ( 7.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00527.pdb 1 IVIRMREKGAF-PEGSAFLQPKFRPLVRQIAELVKDVP--GIVRVSGHTDNRPLDSELYR 57 usage_00528.pdb 1 IVIRMREKGAF-PEGSAFLQPKFRPLVRQIAELVKDVP--GIVRVSGHTDNRPLDSELYR 57 usage_00753.pdb 1 SVVTIRGDELF-ASASASVRDEFQPLLLRIADALRKVK--GQVLVTGHSDNRPIATLRYP 57 usage_01025.pdb 1 SILKLPSNLLFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFK 60 usage_01113.pdb 1 IVIRMREKGAF-PEGSAFLQPKFRPLVRQIAELVKDVP--GIVRVSGHTDNRPLDSELYR 57 usage_01114.pdb 1 IVIRMREKGAF-PEGSAFLQPKFRPLVRQIAELVKDVP--GIVRVSGHTDNRPLDSELYR 57 v r F Sa f pl IA vp g v V GhtDnrPl y usage_00527.pdb 58 SNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMAD 92 usage_00528.pdb 58 SNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMA- 91 usage_00753.pdb 58 SNWKLSQARAQEVADLLGATTGDA-GRFTAEG--- 88 usage_01025.pdb 61 SHYELAANRAYRVMKVLIQYGVNP-NQLSFSSY-- 92 usage_01113.pdb 58 SNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMAD 92 usage_01114.pdb 58 SNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMA- 91 Snw Ls RA Va g rl g #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################