################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:03:53 2021 # Report_file: c_1235_26.html ################################################################################################ #==================================== # Aligned_structures: 13 # 1: usage_00015.pdb # 2: usage_00016.pdb # 3: usage_00067.pdb # 4: usage_00093.pdb # 5: usage_00094.pdb # 6: usage_00160.pdb # 7: usage_00243.pdb # 8: usage_00244.pdb # 9: usage_00301.pdb # 10: usage_00326.pdb # 11: usage_00327.pdb # 12: usage_00331.pdb # 13: usage_00339.pdb # # Length: 45 # Identity: 32/ 45 ( 71.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 32/ 45 ( 71.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 45 ( 6.7%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00015.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA- 44 usage_00016.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA- 44 usage_00067.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQL--- 42 usage_00093.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQL--- 42 usage_00094.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA- 44 usage_00160.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA- 44 usage_00243.pdb 1 LSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE 45 usage_00244.pdb 1 LSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE 45 usage_00301.pdb 1 LSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILA- 44 usage_00326.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA- 44 usage_00327.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQL--- 42 usage_00331.pdb 1 LSVPVGRLRKLAMGGEYLSAFTVGDQLLWGAAEPLRRMLRILLD- 44 usage_00339.pdb 1 LSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA- 44 LSVPVGRLRK AMG L AFTVGDQLLWGAAEP RR L #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################