################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:18:14 2021 # Report_file: c_1172_403.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00170.pdb # 2: usage_00267.pdb # 3: usage_00673.pdb # 4: usage_01079.pdb # 5: usage_01080.pdb # 6: usage_01081.pdb # 7: usage_01082.pdb # 8: usage_01083.pdb # 9: usage_01084.pdb # 10: usage_01085.pdb # 11: usage_01086.pdb # 12: usage_01087.pdb # 13: usage_01100.pdb # 14: usage_01182.pdb # # Length: 31 # Identity: 25/ 31 ( 80.6%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 25/ 31 ( 80.6%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 31 ( 19.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00170.pdb 1 --KSWSGELGGGIILSLRKKGTTVEYS---- 25 usage_00267.pdb 1 --KSWSGELGGGIILSLRKKGTTVEYS---- 25 usage_00673.pdb 1 --KSWSGELGGGIILSLRKKGTTVEYS---- 25 usage_01079.pdb 1 -TKSWSGELGGGIILSLRKKGTTVEYS---- 26 usage_01080.pdb 1 --KSWSGELGGGIILSLRKKGTTVEYS---- 25 usage_01081.pdb 1 --KSWSGELGGGIILSLRKKGTTVEYS---- 25 usage_01082.pdb 1 -TKSWSGELGGGIILSLRKKGTTVEYS---- 26 usage_01083.pdb 1 PTKSWSGELGGGIILSLRKKGTTVEYS---- 27 usage_01084.pdb 1 -TKSWSGELGGGIILSLRKKGTTVEYS---- 26 usage_01085.pdb 1 PTKSWSGELGGGIILSLRKKGTTVEYS---- 27 usage_01086.pdb 1 --KSWSGELGGGIILSLRKKGTTVEYS---- 25 usage_01087.pdb 1 --KSWSGELGGGIILSLRKKGTTVEYS---- 25 usage_01100.pdb 1 PTKSWSGELGGGIILSLRKKGTTVEYSIGGE 31 usage_01182.pdb 1 --KSWSGELGGGIILSLRKKGTTVEYSIGGE 29 KSWSGELGGGIILSLRKKGTTVEYS #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################