################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:05:12 2021
# Report_file: c_1481_103.html
################################################################################################
#====================================
# Aligned_structures: 13
#   1: usage_01642.pdb
#   2: usage_02334.pdb
#   3: usage_02335.pdb
#   4: usage_02336.pdb
#   5: usage_02337.pdb
#   6: usage_02338.pdb
#   7: usage_02339.pdb
#   8: usage_02340.pdb
#   9: usage_02341.pdb
#  10: usage_02342.pdb
#  11: usage_02343.pdb
#  12: usage_02344.pdb
#  13: usage_02345.pdb
#
# Length:         34
# Identity:       13/ 34 ( 38.2%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     28/ 34 ( 82.4%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            6/ 34 ( 17.6%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_01642.pdb         1  -RETYEMLLKIKESLELMQYLPQHTIETYRQ---   30
usage_02334.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYR----   29
usage_02335.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKY-----   28
usage_02336.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYRQK--   31
usage_02337.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKY-----   28
usage_02338.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYRQK--   31
usage_02339.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYRQ---   30
usage_02340.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYRQ---   30
usage_02341.pdb         1  GRERYEILKKLNDSLELSDVVPASDAEKYRQKFM   34
usage_02342.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYRQKF-   32
usage_02343.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYR----   29
usage_02344.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYRQK--   31
usage_02345.pdb         1  -RERYEILKKLNDSLELSDVVPASDAEKYR----   29
                            RErYEiLkKlndSLELsdvvPasdaEkY     


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################