################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:07:57 2021 # Report_file: c_1260_11.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00182.pdb # 2: usage_00330.pdb # 3: usage_00870.pdb # 4: usage_01068.pdb # 5: usage_01072.pdb # 6: usage_01073.pdb # 7: usage_01074.pdb # 8: usage_01131.pdb # 9: usage_01336.pdb # # Length: 61 # Identity: 10/ 61 ( 16.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 19/ 61 ( 31.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 61 ( 18.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00182.pdb 1 --LMAGAHLDSV--------SSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWG 50 usage_00330.pdb 1 KVLMAGAHLDSV--------SSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWG 52 usage_00870.pdb 1 EWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYA 60 usage_01068.pdb 1 EWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYA 60 usage_01072.pdb 1 EWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYA 60 usage_01073.pdb 1 EWIVIGGHLDSTIGSHTNEQSVAPGADDNASGIAAVTEVIRVLSENNFQPKRSIAFMAYA 60 usage_01074.pdb 1 EWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYA 60 usage_01131.pdb 1 --VLVGSHLDSV--------YNG-GCFDGPLGVLAGVEVVQTMNEHGVVTHHPIEVVAFT 49 usage_01336.pdb 1 EWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYA 60 G HLDS s G D sG aAv E s qp f usage_00182.pdb 51 A 51 usage_00330.pdb 53 A 53 usage_00870.pdb 61 A 61 usage_01068.pdb 61 A 61 usage_01072.pdb 61 A 61 usage_01073.pdb 61 A 61 usage_01074.pdb 61 A 61 usage_01131.pdb 50 D 50 usage_01336.pdb 61 A 61 a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################