################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:39:44 2021 # Report_file: c_1148_87.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_02563.pdb # 2: usage_02564.pdb # 3: usage_02565.pdb # 4: usage_02566.pdb # 5: usage_02710.pdb # 6: usage_03039.pdb # 7: usage_03040.pdb # 8: usage_03041.pdb # 9: usage_03042.pdb # 10: usage_03043.pdb # 11: usage_03044.pdb # # Length: 40 # Identity: 35/ 40 ( 87.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 35/ 40 ( 87.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 5/ 40 ( 12.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_02563.pdb 1 -----PVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 35 usage_02564.pdb 1 -----PVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 35 usage_02565.pdb 1 -----PVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 35 usage_02566.pdb 1 -----PVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 35 usage_02710.pdb 1 -----PVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 35 usage_03039.pdb 1 KFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 40 usage_03040.pdb 1 ----DPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 36 usage_03041.pdb 1 KFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 40 usage_03042.pdb 1 KFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 40 usage_03043.pdb 1 ----DPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 36 usage_03044.pdb 1 KFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP 40 PVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVP #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################