################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:30:55 2021 # Report_file: c_1115_17.html ################################################################################################ #==================================== # Aligned_structures: 6 # 1: usage_00197.pdb # 2: usage_00198.pdb # 3: usage_00199.pdb # 4: usage_00200.pdb # 5: usage_00201.pdb # 6: usage_01124.pdb # # Length: 76 # Identity: 15/ 76 ( 19.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 76 ( 78.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 76 ( 21.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00197.pdb 1 ----PGLFRLVEAAFGKRR----KTLLNALAAAG-YPKARVEEALRALGLPPR----VRA 47 usage_00198.pdb 1 ----PGLFRLVEAAFGKRR----KTLLNALAAAG-YPKARVEEALRALGLPPR----VRA 47 usage_00199.pdb 1 ----PGLFRLVEAAFGKRR----KTLLNALAAAG-YPKARVEEALRALGLPPR----VRA 47 usage_00200.pdb 1 ----PGLFRLVEAAFGKRR----KTLLNALAAAG-YPKARVEEALRALGLPPR----VRA 47 usage_00201.pdb 1 ----PGLFRLVEAAFGKRR----KTLLNALAAAG-YPKARVEEALRALGLPPR----VRA 47 usage_01124.pdb 1 SRNTFLRKAYTKLKLQV-NQDGRI-PVKNILKMFSADKKRVETALESCGLKFNRSESIRP 58 pglfrlveaafgk r k llnalaaag ypKaRVEeALralGLppr vRa usage_00197.pdb 48 EELDLEAFRRLREGLE 63 usage_00198.pdb 48 EELDLEAFRRLREGLE 63 usage_00199.pdb 48 EELDLEAFRRLREGLE 63 usage_00200.pdb 48 EELDLEAFRRLREGLE 63 usage_00201.pdb 48 EELDLEAFRRLREGLE 63 usage_01124.pdb 59 DEFSLEIFERFLNKL- 73 eEldLEaFrRlregL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################