################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:04:00 2021 # Report_file: c_0753_30.html ################################################################################################ #==================================== # Aligned_structures: 18 # 1: usage_00135.pdb # 2: usage_00136.pdb # 3: usage_00137.pdb # 4: usage_00138.pdb # 5: usage_00139.pdb # 6: usage_00140.pdb # 7: usage_00141.pdb # 8: usage_00142.pdb # 9: usage_00143.pdb # 10: usage_00144.pdb # 11: usage_00145.pdb # 12: usage_00146.pdb # 13: usage_00147.pdb # 14: usage_00148.pdb # 15: usage_00774.pdb # 16: usage_00775.pdb # 17: usage_00776.pdb # 18: usage_00777.pdb # # Length: 51 # Identity: 48/ 51 ( 94.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 48/ 51 ( 94.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 51 ( 5.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00135.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00136.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00137.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00138.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00139.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00140.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00141.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00142.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00143.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00144.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00145.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00146.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00147.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00148.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00774.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNE--- 48 usage_00775.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00776.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 usage_00777.pdb 1 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIH 51 GINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNE #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################