################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:54:20 2021 # Report_file: c_1492_67.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00945.pdb # 2: usage_00946.pdb # 3: usage_00999.pdb # 4: usage_01001.pdb # 5: usage_01110.pdb # 6: usage_01120.pdb # 7: usage_01124.pdb # 8: usage_01206.pdb # 9: usage_01240.pdb # 10: usage_01241.pdb # 11: usage_01242.pdb # 12: usage_01243.pdb # # Length: 31 # Identity: 14/ 31 ( 45.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 18/ 31 ( 58.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 1/ 31 ( 3.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00945.pdb 1 DPSLQHEIEQFYYWEAKLLNDRRFQEWFDLL 31 usage_00946.pdb 1 -PSLQHEIEQFYYWEAKLLNDRRFQEWFDLL 30 usage_00999.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 usage_01001.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 usage_01110.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 usage_01120.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 usage_01124.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 usage_01206.pdb 1 SLELQNAVEQFYYREAQLLDYQNYEAWLALL 31 usage_01240.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 usage_01241.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 usage_01242.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 usage_01243.pdb 1 GLELQNEIEQFYYREAQLLDHRAYEAWFALL 31 LQ eiEQFYY EA LL r Wf LL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################