################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:34:17 2021 # Report_file: c_1492_6.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00099.pdb # 2: usage_00125.pdb # 3: usage_00126.pdb # 4: usage_00374.pdb # 5: usage_00375.pdb # 6: usage_00409.pdb # 7: usage_00410.pdb # 8: usage_00412.pdb # 9: usage_00761.pdb # 10: usage_01041.pdb # 11: usage_01263.pdb # # Length: 62 # Identity: 24/ 62 ( 38.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 62 ( 82.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 62 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00099.pdb 1 GEIMELHHDKHHKAYVDGANTALDKLAEARDKADFGAINKLEKDLAFNLAGHVNHSVFWK 60 usage_00125.pdb 1 AQIMQLHHSKHHAANVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT 60 usage_00126.pdb 1 AQIMQLHHSKHHAANVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT 60 usage_00374.pdb 1 AQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKANGGGHINHSIFWT 60 usage_00375.pdb 1 AQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKANGGGHINHSIFWT 60 usage_00409.pdb 1 AQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT 60 usage_00410.pdb 1 AQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT 60 usage_00412.pdb 1 AQIMQLHHSKNHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT 60 usage_00761.pdb 1 AQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT 60 usage_01041.pdb 1 AQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQTALQPALKFNGGGHINHSIFWT 60 usage_01263.pdb 1 AQIMQLHHSKHHAAV--NNLNVTEEKQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT 58 aqIMqLHHsKhHaA n n ek qEAlaKgDvtAq aLqpaLk NggGHiNHSiFWt usage_00099.pdb 61 N- 61 usage_00125.pdb 61 N- 61 usage_00126.pdb 61 N- 61 usage_00374.pdb 61 N- 61 usage_00375.pdb 61 N- 61 usage_00409.pdb 61 N- 61 usage_00410.pdb 61 NL 62 usage_00412.pdb 61 N- 61 usage_00761.pdb 61 N- 61 usage_01041.pdb 61 N- 61 usage_01263.pdb 59 NL 60 N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################