################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:12:24 2021 # Report_file: c_1297_97.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00255.pdb # 2: usage_01727.pdb # 3: usage_01728.pdb # 4: usage_01729.pdb # 5: usage_01730.pdb # 6: usage_01731.pdb # 7: usage_01732.pdb # 8: usage_01793.pdb # 9: usage_01794.pdb # 10: usage_01795.pdb # 11: usage_03175.pdb # 12: usage_03176.pdb # # Length: 44 # Identity: 11/ 44 ( 25.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 33/ 44 ( 75.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 44 ( 25.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00255.pdb 1 ----RDDVFELVEHVLDGSGLVGPLDFDLFDVAGTLYLSEINP- 39 usage_01727.pdb 1 DPGTQETVQELALKAYKVLGVRG-ARVDFFLAEGELYL------ 37 usage_01728.pdb 1 DPGTQETVQELALKAYKVLGVRG-ARVDFFLAEGELYL------ 37 usage_01729.pdb 1 DPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYL------ 38 usage_01730.pdb 1 -PGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTI 43 usage_01731.pdb 1 -PGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYL------ 37 usage_01732.pdb 1 DPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTI 44 usage_01793.pdb 1 -PGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYL------ 37 usage_01794.pdb 1 DPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTI 44 usage_01795.pdb 1 DPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTI 44 usage_03175.pdb 1 -PGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYL------ 37 usage_03176.pdb 1 ---TQETVQELALKAYKVLGVRGMARVDFFLAEGELYL------ 35 qetVqELalkaykvlGvrG arvDfFlaeGeLYL #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################