################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:41:12 2021 # Report_file: c_1261_204.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_01356.pdb # 2: usage_01357.pdb # 3: usage_02918.pdb # 4: usage_03203.pdb # 5: usage_03211.pdb # 6: usage_03914.pdb # 7: usage_03915.pdb # 8: usage_03937.pdb # 9: usage_04561.pdb # 10: usage_04562.pdb # 11: usage_04791.pdb # # Length: 30 # Identity: 4/ 30 ( 13.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 30 ( 40.0%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 30 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01356.pdb 1 -P-RLH--RPSLQHFREQFLVPGRPVILKG 26 usage_01357.pdb 1 -P-RLH--RPSLQHFREQFLVPGRPVILKG 26 usage_02918.pdb 1 VE-RADALQLSVEEFVERYERPYKPVVLLN 29 usage_03203.pdb 1 VPYLDE--PPSPLCFYRDWVCPNRPCIIRN 28 usage_03211.pdb 1 VP-RLH--RPSLQHFREQFLVPGRPVILKG 27 usage_03914.pdb 1 -P-RLH--RPSLQHFREQFLVPGRPVILKG 26 usage_03915.pdb 1 -P-RLH--RPSLQHFREQFLVPGRPVILKG 26 usage_03937.pdb 1 VP-RLH--RPSLQHFREQFLVPGRPVILKG 27 usage_04561.pdb 1 -P-RLH--RPSLQHFREQFLVPGRPVILKG 26 usage_04562.pdb 1 -P-RLH--RPSLQHFREQFLVPGRPVILKG 26 usage_04791.pdb 1 VP-RLH--RPSLQHFREQFLVPGRPVILKG 27 p r pS F e P rPvil #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################