################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:15:53 2021 # Report_file: c_0513_81.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00428.pdb # 2: usage_00636.pdb # 3: usage_00812.pdb # 4: usage_00837.pdb # 5: usage_00838.pdb # # Length: 122 # Identity: 9/122 ( 7.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/122 ( 27.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 32/122 ( 26.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00428.pdb 1 -VAAAQAGADTL-T----RLGAGGVGD-IVWA-PEVMDALLAREDLSGTLYFEVLNPFPD 52 usage_00636.pdb 1 DEHFVKQGTELAIA-E-IQSGTTTFAD-Y-FYPQQSGEAALAA-GIRAVCFAPVLD-F-- 52 usage_00812.pdb 1 GPEFVADGTTLA-IAEMLRGGTTCVNENY-FFADVQAAVYKQH-GFRALVGAVIID-F-- 54 usage_00837.pdb 1 HDDFVFDGSLLA-G-E-IRGGTTTIND-Y-FYNAAVARAGLAS-G-RTFVGCSILE-F-- 50 usage_00838.pdb 1 HDDFVFDGSLLA-G-E-IRGGTTTIND-Y-FYNAAVARAGLAS-G-RTFVGCSILE-F-- 50 fv G la r Gtt d y f a la g r l F usage_00428.pdb 53 ------KADEVFAAARTHLERWRRL----ERPGLRLGLSPHTPFTVSHRLMRLLSDYAAG 102 usage_00636.pdb 53 PTNYAQNADEYIRKAIECNDRFNNHPNEQ--GLVQIGFGPHAPYTVSDEPLKEITLSDQ- 109 usage_00812.pdb 55 PTAWASSDDEYFARAGELHDQWR------DDPLISTAFAPHAPYTVNDANFERVRMLADQ 108 usage_00837.pdb 51 PTNYASNADDYIAKG-AERSQFL------GEDLLTFTLAPHAPYTVSDDTFRKVVTLAEQ 103 usage_00838.pdb 51 PTNYASNADDYIAKG-AERSQFL------GEDLLTFTLAPHAPYTVSDDTFRKVVTLAEQ 103 aD y a l PHaPyTVsd a usage_00428.pdb 103 E- 103 usage_00636.pdb -- usage_00812.pdb 109 LD 110 usage_00837.pdb 104 E- 104 usage_00838.pdb 104 E- 104 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################