################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:38:13 2021 # Report_file: c_0811_33.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00108.pdb # 2: usage_00109.pdb # 3: usage_00113.pdb # 4: usage_00262.pdb # 5: usage_00449.pdb # 6: usage_00450.pdb # 7: usage_00451.pdb # 8: usage_00452.pdb # 9: usage_00570.pdb # 10: usage_00571.pdb # 11: usage_00619.pdb # # Length: 55 # Identity: 34/ 55 ( 61.8%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 34/ 55 ( 61.8%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 12/ 55 ( 21.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00108.pdb 1 ---------RQTIQGVQYLHNNRVIHRNLKLGNLFLNDDMDVKIGDFGLATKI-- 44 usage_00109.pdb 1 ---------RQTIQGVQYLHNNRVIHRNLKLGNLFLNDDMDVKIGDFGLATK--- 43 usage_00113.pdb 1 TEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEY 55 usage_00262.pdb 1 -EPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEY 54 usage_00449.pdb 1 ---------RQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEF 46 usage_00450.pdb 1 ---------RQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIE- 45 usage_00451.pdb 1 ---------RQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIE- 45 usage_00452.pdb 1 ---------RQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEF 46 usage_00570.pdb 1 --------LRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEY 47 usage_00571.pdb 1 -EPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEY 54 usage_00619.pdb 1 --------LRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEY 47 RQ G QYLH NRVIHR LKLGNLFLN D VKIGDFGLATK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################