################################################################################################
# Program: MUSTANG v3.2.3: A  Multiple structural alignment algorithm
# Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey,  A. M. Lesk
# Rundate: Thu Jan 21 01:18:14 2021
# Report_file: c_1172_403.html
################################################################################################
#====================================
# Aligned_structures: 14
#   1: usage_00170.pdb
#   2: usage_00267.pdb
#   3: usage_00673.pdb
#   4: usage_01079.pdb
#   5: usage_01080.pdb
#   6: usage_01081.pdb
#   7: usage_01082.pdb
#   8: usage_01083.pdb
#   9: usage_01084.pdb
#  10: usage_01085.pdb
#  11: usage_01086.pdb
#  12: usage_01087.pdb
#  13: usage_01100.pdb
#  14: usage_01182.pdb
#
# Length:         31
# Identity:       25/ 31 ( 80.6%)  (Calculated as the percentage of conserved columns in the alignment.)
# Similarity:     25/ 31 ( 80.6%)  (Calculated as the percentage of semi-conserved columns in the alignment)
# Gaps:            6/ 31 ( 19.4%)  (Calculated as the percentage of columns with atleast one gap.)

#===========================================ALIGNMENT START=========================================


usage_00170.pdb         1  --KSWSGELGGGIILSLRKKGTTVEYS----   25
usage_00267.pdb         1  --KSWSGELGGGIILSLRKKGTTVEYS----   25
usage_00673.pdb         1  --KSWSGELGGGIILSLRKKGTTVEYS----   25
usage_01079.pdb         1  -TKSWSGELGGGIILSLRKKGTTVEYS----   26
usage_01080.pdb         1  --KSWSGELGGGIILSLRKKGTTVEYS----   25
usage_01081.pdb         1  --KSWSGELGGGIILSLRKKGTTVEYS----   25
usage_01082.pdb         1  -TKSWSGELGGGIILSLRKKGTTVEYS----   26
usage_01083.pdb         1  PTKSWSGELGGGIILSLRKKGTTVEYS----   27
usage_01084.pdb         1  -TKSWSGELGGGIILSLRKKGTTVEYS----   26
usage_01085.pdb         1  PTKSWSGELGGGIILSLRKKGTTVEYS----   27
usage_01086.pdb         1  --KSWSGELGGGIILSLRKKGTTVEYS----   25
usage_01087.pdb         1  --KSWSGELGGGIILSLRKKGTTVEYS----   25
usage_01100.pdb         1  PTKSWSGELGGGIILSLRKKGTTVEYSIGGE   31
usage_01182.pdb         1  --KSWSGELGGGIILSLRKKGTTVEYSIGGE   29
                             KSWSGELGGGIILSLRKKGTTVEYS    


#=========================================ALIGNMENT END=============================================
#LEGEND:
#
# Colours indicate the chemical nature of the amino acid;
# Red         = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W}
# Blue        = Acidic,{D,E}
# Magenta     = Basic,{K,R} and
# Green       = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}.
#
# The "markup row" below each stretch of the multiple alignment is used to mark completely conserved
# residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment.
#
################################################EOF#################################################