################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:40:00 2021 # Report_file: c_1258_10.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00808.pdb # 2: usage_00809.pdb # 3: usage_00810.pdb # 4: usage_01077.pdb # 5: usage_01078.pdb # 6: usage_01079.pdb # 7: usage_01080.pdb # 8: usage_01081.pdb # 9: usage_01082.pdb # 10: usage_01083.pdb # 11: usage_01084.pdb # # Length: 36 # Identity: 26/ 36 ( 72.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 26/ 36 ( 72.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 0/ 36 ( 0.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00808.pdb 1 ETTYSCRDCAIDPTCVLCMDCFQDSVHKNHRYKMHT 36 usage_00809.pdb 1 ETTYSCRDCAIDPTCVLCMDCFQDSVHKNHRYKMHT 36 usage_00810.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 usage_01077.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 usage_01078.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 usage_01079.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 usage_01080.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 usage_01081.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 usage_01082.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 usage_01083.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 usage_01084.pdb 1 EPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 36 E TYSCRDCA DPTCVLCM CF S H HRY M T #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################