################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:59:26 2021 # Report_file: c_1434_19.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00046.pdb # 2: usage_00047.pdb # 3: usage_01790.pdb # 4: usage_01796.pdb # 5: usage_02237.pdb # 6: usage_02238.pdb # 7: usage_02239.pdb # 8: usage_03366.pdb # # Length: 62 # Identity: 51/ 62 ( 82.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 62 ( 82.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 10/ 62 ( 16.1%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00046.pdb 1 YESAEQALNEVPKDLNRYTAESVAAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN 60 usage_00047.pdb 1 --SAEQALNEV-------TAESVAAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN 51 usage_01790.pdb 1 YESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN 60 usage_01796.pdb 1 YESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN 60 usage_02237.pdb 1 YESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN 60 usage_02238.pdb 1 YESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN 60 usage_02239.pdb 1 YESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN 60 usage_03366.pdb 1 YESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN 60 SAEQALNEV TAESV AVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVN usage_00046.pdb 61 N- 61 usage_00047.pdb 52 N- 52 usage_01790.pdb 61 NL 62 usage_01796.pdb 61 NL 62 usage_02237.pdb 61 NL 62 usage_02238.pdb 61 NL 62 usage_02239.pdb 61 NL 62 usage_03366.pdb 61 NL 62 N #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################