################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 02:50:08 2021 # Report_file: c_1426_40.html ################################################################################################ #==================================== # Aligned_structures: 22 # 1: usage_00123.pdb # 2: usage_00234.pdb # 3: usage_00371.pdb # 4: usage_00372.pdb # 5: usage_00460.pdb # 6: usage_00463.pdb # 7: usage_00502.pdb # 8: usage_00505.pdb # 9: usage_00506.pdb # 10: usage_00530.pdb # 11: usage_00531.pdb # 12: usage_00532.pdb # 13: usage_00541.pdb # 14: usage_00572.pdb # 15: usage_00573.pdb # 16: usage_00574.pdb # 17: usage_00600.pdb # 18: usage_00601.pdb # 19: usage_00602.pdb # 20: usage_00662.pdb # 21: usage_00663.pdb # 22: usage_00832.pdb # # Length: 61 # Identity: 58/ 61 ( 95.1%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 58/ 61 ( 95.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 61 ( 4.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00123.pdb 1 -SGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00234.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00371.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00372.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00460.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00463.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00502.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00505.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00506.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00530.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00531.pdb 1 --PFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 58 usage_00532.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00541.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00572.pdb 1 --PFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 58 usage_00573.pdb 1 --PFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 58 usage_00574.pdb 1 LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 60 usage_00600.pdb 1 --PFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 58 usage_00601.pdb 1 --PFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 58 usage_00602.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00662.pdb 1 LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 60 usage_00663.pdb 1 -TPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 59 usage_00832.pdb 1 ---FLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN 57 FLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN usage_00123.pdb 60 F 60 usage_00234.pdb 60 F 60 usage_00371.pdb 60 F 60 usage_00372.pdb 60 F 60 usage_00460.pdb 60 F 60 usage_00463.pdb 60 F 60 usage_00502.pdb 60 F 60 usage_00505.pdb 60 F 60 usage_00506.pdb 60 F 60 usage_00530.pdb 60 F 60 usage_00531.pdb 59 F 59 usage_00532.pdb 60 F 60 usage_00541.pdb 60 F 60 usage_00572.pdb 59 F 59 usage_00573.pdb 59 F 59 usage_00574.pdb 61 F 61 usage_00600.pdb 59 F 59 usage_00601.pdb 59 F 59 usage_00602.pdb 60 F 60 usage_00662.pdb 61 F 61 usage_00663.pdb 60 F 60 usage_00832.pdb 58 F 58 F #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################