################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:53:28 2021 # Report_file: c_1297_36.html ################################################################################################ #==================================== # Aligned_structures: 12 # 1: usage_00206.pdb # 2: usage_00207.pdb # 3: usage_00208.pdb # 4: usage_00209.pdb # 5: usage_00211.pdb # 6: usage_00212.pdb # 7: usage_00595.pdb # 8: usage_00596.pdb # 9: usage_00597.pdb # 10: usage_00598.pdb # 11: usage_00695.pdb # 12: usage_00696.pdb # # Length: 63 # Identity: 60/ 63 ( 95.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 63 ( 95.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 3/ 63 ( 4.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00206.pdb 1 RVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 60 usage_00207.pdb 1 RVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 60 usage_00208.pdb 1 RVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 60 usage_00209.pdb 1 RVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 60 usage_00211.pdb 1 RVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 60 usage_00212.pdb 1 RVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 60 usage_00595.pdb 1 -VPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 59 usage_00596.pdb 1 -VPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 59 usage_00597.pdb 1 -VPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 59 usage_00598.pdb 1 -VPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 59 usage_00695.pdb 1 RVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 60 usage_00696.pdb 1 RVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE 60 VPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQTLPTLEYE usage_00206.pdb 61 A-- 61 usage_00207.pdb 61 A-- 61 usage_00208.pdb 61 A-- 61 usage_00209.pdb 61 A-- 61 usage_00211.pdb 61 A-- 61 usage_00212.pdb 61 A-- 61 usage_00595.pdb 60 ALD 62 usage_00596.pdb 60 ALD 62 usage_00597.pdb 60 ALD 62 usage_00598.pdb 60 ALD 62 usage_00695.pdb 61 A-- 61 usage_00696.pdb 61 A-- 61 A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################