################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:09:45 2021 # Report_file: c_0833_21.html ################################################################################################ #==================================== # Aligned_structures: 9 # 1: usage_00189.pdb # 2: usage_00294.pdb # 3: usage_00408.pdb # 4: usage_00436.pdb # 5: usage_00437.pdb # 6: usage_00450.pdb # 7: usage_00451.pdb # 8: usage_00498.pdb # 9: usage_00517.pdb # # Length: 71 # Identity: 3/ 71 ( 4.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 71 ( 11.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 11/ 71 ( 15.5%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00189.pdb 1 -HRDYLARAERLASGLLRDGVHTGDRVAILSQNCSEMIELIGAVALIGAILLPVNYRLNA 59 usage_00294.pdb 1 TYGQLKRDSDSIAAFIDSLALLAKSPVLVFGAQTYDMLATFVALTKSGHAYIPVDVHSAP 60 usage_00408.pdb 1 SYEELMQETCRVANVLKSYGVKKGDAVSIYLPMTWQAAAAFLACARIGAIHSAVFAGFSA 60 usage_00436.pdb 1 SYAELVARAGRVANVLVARGLQVGDRVAAQTEKSVEALVLYLATVRAGGVYLPLNTAYTL 60 usage_00437.pdb 1 SYAELVARAGRVANVLVARGLQVGDRVAAQTEKSVEALVLYLATVRAGGVYLPLNTAYTL 60 usage_00450.pdb 1 SYAELVARAGRVANVLVARGLQVGDRVAAQTE-SVEALVLYLATVRAGGVYLPLNTAYTL 59 usage_00451.pdb 1 SYAELVARAGRVANVLVARGLQVGDRVAAQTE-SVEALVLYLATVRAGGVYLPLNTAYTL 59 usage_00498.pdb 1 SYGLLHSWAEGLADLLHDAGVRKGDRVALRMPPGANAIAAMLGILRAGAAYVPLDIRNPP 60 usage_00517.pdb 1 TYAELAAAAGATAGRIG--------RVAVWATPAMETGVAVVAALLAGVAAVPLNPKSGD 52 y l A V a G p usage_00189.pdb 60 DEIAFVLGDGA 70 usage_00294.pdb 61 ERILAIIEIAK 71 usage_00408.pdb 61 ESLRDRVNDCE 71 usage_00436.pdb 61 HELDYFITDAE 71 usage_00437.pdb 61 HELDYFITDAE 71 usage_00450.pdb 60 HELDYFITDA- 69 usage_00451.pdb 60 HELDYFITDAE 70 usage_00498.pdb 61 ARNAFIVTDSQ 71 usage_00517.pdb 53 KELAHILSDSA 63 d #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################