################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:18 2021 # Report_file: c_0809_18.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00248.pdb # 2: usage_00249.pdb # 3: usage_00252.pdb # 4: usage_00253.pdb # 5: usage_00361.pdb # 6: usage_00371.pdb # 7: usage_00713.pdb # # Length: 67 # Identity: 9/ 67 ( 13.4%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 51/ 67 ( 76.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 67 ( 22.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00248.pdb 1 SGKEAEKLLTEKG--KHGSFLVRESQSHPGDFVLSVRTK----------SKVTHVMIRCQ 48 usage_00249.pdb 1 SGKEAEKLLTEKG--KHGSFLVRESQSHPGDFVLSVRTG-------DGKSKVTHVMIRCQ 51 usage_00252.pdb 1 SGKEAEKLLTEKG--KHGSFLVRESQSHPGDFVLSVRTG----------SKVTHVMIRCQ 48 usage_00253.pdb 1 SGKEAEKLLTEKG--KHGSFLVRESQSHPGDFVLSVRTG----------SKVTHVMIRCQ 48 usage_00361.pdb 1 SGKEAEKLLTEKG--KHGSFLVRESQSHPGDFVLSVRTG---------KSKVTHVMIRCQ 49 usage_00371.pdb 1 TKKDVVKFIEDYSRV--SVYYFSLNHDNPGWFYLMFKIN-A-------NSKLYTWNVKLT 50 usage_00713.pdb 1 SGKEAEKLLTEKG--KHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQ 58 sgKeaeKlltekg gsflvresqshPGdFvLsvrt SKvthvmircq usage_00248.pdb 49 ELKYDV- 54 usage_00249.pdb 52 ELKYDV- 57 usage_00252.pdb 49 ELKYDV- 54 usage_00253.pdb 49 ELKYDV- 54 usage_00361.pdb 50 ELKYDV- 55 usage_00371.pdb 51 NTGYFLV 57 usage_00713.pdb 59 ELKYDV- 64 elkYdv #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################