################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:04:11 2021 # Report_file: c_1135_57.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00038.pdb # 2: usage_00434.pdb # 3: usage_00686.pdb # 4: usage_00752.pdb # 5: usage_00753.pdb # 6: usage_00754.pdb # 7: usage_01351.pdb # # Length: 70 # Identity: 17/ 70 ( 24.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 61/ 70 ( 87.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 7/ 70 ( 10.0%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00038.pdb 1 ELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWN 60 usage_00434.pdb 1 ELEFIADILNQDAKNYHAWQHRQWVIQEFK------LWDNELQYVDQLLKEDVRNNSVWN 54 usage_00686.pdb 1 ELEFIADILNQDAKNYHAWQHRQWVIQEFR------LWDNELQYVDQLLKEDVRNNSVWN 54 usage_00752.pdb 1 ELEFIADILNQDAKNYHAWQHRQWVIQEFR------LWDNELQYVDQLLKEDVRNNSVWN 54 usage_00753.pdb 1 ELEFIADILNQDAKNYHAWQHRQWVIQEFR------LWDNELQYVDQLLKEDVRNNSVWN 54 usage_00754.pdb 1 ELEFIADILNQDAKNYHAWQHRQWVIQEFR------LWDNELQYVDQLLKEDVRNNSVWN 54 usage_01351.pdb 1 ELEFIADILNQDAKNYHAWQHRQWVIQEFR------LWDNELQYVDQLLKEDVRNNSVWN 54 ELefiadiLnqDakNyhaWqhRqwVIqef lwdnElQYvdqllKedvrNnSvWN usage_00038.pdb 61 YLKGILQDRG 70 usage_00434.pdb 55 QRYFVISNT- 63 usage_00686.pdb 55 QRHFVISNT- 63 usage_00752.pdb 55 QRHFVISNT- 63 usage_00753.pdb 55 QRHFVISNT- 63 usage_00754.pdb 55 QRHFVISNT- 63 usage_01351.pdb 55 QRHFVISNT- 63 qr fvisnt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################