################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:16:51 2021 # Report_file: c_1143_36.html ################################################################################################ #==================================== # Aligned_structures: 14 # 1: usage_00300.pdb # 2: usage_00426.pdb # 3: usage_00427.pdb # 4: usage_00428.pdb # 5: usage_00429.pdb # 6: usage_00486.pdb # 7: usage_00549.pdb # 8: usage_00550.pdb # 9: usage_00578.pdb # 10: usage_00579.pdb # 11: usage_00580.pdb # 12: usage_00599.pdb # 13: usage_00600.pdb # 14: usage_00675.pdb # # Length: 30 # Identity: 6/ 30 ( 20.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 8/ 30 ( 26.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 30 ( 13.3%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00300.pdb 1 FKVALKRPAYVVVYDYYNTNLNAIKVYEVD 30 usage_00426.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMF---- 26 usage_00427.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMF---- 26 usage_00428.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMF---- 26 usage_00429.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMF---- 26 usage_00486.pdb 1 FNVELIQPGAVKVYAYYNLEESCTRFYHP- 29 usage_00549.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMF---- 26 usage_00550.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMF---- 26 usage_00578.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMFYSTS 30 usage_00579.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMFYSTS 30 usage_00580.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMF---- 26 usage_00599.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMFYST- 29 usage_00600.pdb 1 FEVGFLSPATFTVYEYHRPDKQCTMFYST- 29 usage_00675.pdb 1 FNVGLIQPGAVKVYSYYNLDETCIRFYHP- 29 F V P VY Y c f #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################