################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:49:04 2021 # Report_file: c_0597_8.html ################################################################################################ #==================================== # Aligned_structures: 8 # 1: usage_00006.pdb # 2: usage_00007.pdb # 3: usage_00008.pdb # 4: usage_00032.pdb # 5: usage_00040.pdb # 6: usage_00041.pdb # 7: usage_00053.pdb # 8: usage_00067.pdb # # Length: 78 # Identity: 7/ 78 ( 9.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 9/ 78 ( 11.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 15/ 78 ( 19.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00006.pdb 1 TQASATVAIPKEHHRFVIGKNGEKLQDLELKTA-TKIQIPRPDDPS--NQIKITGTKEGI 57 usage_00007.pdb 1 --TVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTE---GE--DKITLEGPTEDV 53 usage_00008.pdb 1 ---EVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGS--DTVVIRGPSSDV 55 usage_00032.pdb 1 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESG-ASIKIDEPLEGSEDRIITITGTQDQI 59 usage_00040.pdb 1 PIITTQVTIPKDLARSIIGKGGQRIKQIRHESG-ASIKIDEPLEGSEDRIITITGTQDQI 59 usage_00041.pdb 1 --TTHELTIPNNLIGCIIGRQGANINEIRQMSG-AQIKIANPVEGSSGRQVTITGSAASI 57 usage_00053.pdb 1 --ITTQVTIPKDLAGSIIGKGGQRIKQIRHESG-ASIKIDEPLEGSEDRIITITGTQDQI 57 usage_00067.pdb 1 SVMTEEYKVPDGMVGFIIGRGGEQISRIQQESG-CKIQIAPDSGGLPERSCMLTGTPESV 59 P IG G i I g G usage_00006.pdb 58 EKARHEVLLISAEQDKR- 74 usage_00007.pdb 54 SVAQEQIEGMVKDLINRS 71 usage_00008.pdb 56 EKAKKQLLHLAEEKQ--- 70 usage_00032.pdb 60 QNAQYLLQNSVKQYS--- 74 usage_00040.pdb 60 QNAQYLLQNSVKQYS--- 74 usage_00041.pdb 58 SLAQYLINARLS------ 69 usage_00053.pdb 58 QNAQYLLQNSVKQYSG-- 73 usage_00067.pdb 60 QSAKRLLDQIVEKGR--- 74 A #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################