################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 23:11:24 2021 # Report_file: c_1484_256.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_01172.pdb # 2: usage_01176.pdb # 3: usage_01433.pdb # 4: usage_02283.pdb # 5: usage_02782.pdb # 6: usage_02783.pdb # 7: usage_02784.pdb # 8: usage_04011.pdb # 9: usage_04640.pdb # 10: usage_04641.pdb # 11: usage_04642.pdb # # Length: 37 # Identity: 0/ 37 ( 0.0%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 3/ 37 ( 8.1%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 16/ 37 ( 43.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_01172.pdb 1 ------KELASLLAWTHQMKAKNWQE---WTQQAAKQ 28 usage_01176.pdb 1 ------KELASLLAWTHQMKAKNWQE---WTQQAAKQ 28 usage_01433.pdb 1 ------KEVASLLAWTHQMKAKNWQE---WTQQAAKQ 28 usage_02283.pdb 1 DPNISSWLEDAAYFAAIDNSVNTISWYDWPEPLKNR- 36 usage_02782.pdb 1 ------KEVASLLAWTHQMKAKNWPE---WTQQAAKQ 28 usage_02783.pdb 1 ------KEVASLLAWTHQMKAKNWPE---WTQQAAKQ 28 usage_02784.pdb 1 ------KEVASLLAWTHQMKAKNWPE---WTQQAAKQ 28 usage_04011.pdb 1 ----------FTNSLRMLQQK-RWDE---AAVNLAKS 23 usage_04640.pdb 1 ------KEVASLLAWTHQMKAKNWPE---WTQQAA-- 26 usage_04641.pdb 1 ------KEVASLLAWTHQMKAKNWPE---WTQQAA-- 26 usage_04642.pdb 1 ------KEVASLLAWTHQMKAKNWPE---WTQQAA-- 26 w e a #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################