################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:37:57 2021 # Report_file: c_0767_29.html ################################################################################################ #==================================== # Aligned_structures: 11 # 1: usage_00199.pdb # 2: usage_00200.pdb # 3: usage_00255.pdb # 4: usage_00256.pdb # 5: usage_00257.pdb # 6: usage_00337.pdb # 7: usage_00454.pdb # 8: usage_00455.pdb # 9: usage_00463.pdb # 10: usage_00531.pdb # 11: usage_00532.pdb # # Length: 88 # Identity: 60/ 88 ( 68.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 88 ( 68.2%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 19/ 88 ( 21.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00199.pdb 1 ---PVVLVGPSLKGYEVTD--QKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRS 55 usage_00200.pdb 1 ---PVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRS 57 usage_00255.pdb 1 SMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLA----------- 49 usage_00256.pdb 1 ---PVVLVGPSLKGYEVTD--QKALFDFLKHRFDGRISITRVTADLSLAK---------- 45 usage_00257.pdb 1 ---PVVLVGPSLKGYEVTD--QKALFDFLKHRFDGRISITRVTADLSLAK---------S 46 usage_00337.pdb 1 ---PVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKAIIERSNTRS 57 usage_00454.pdb 1 ---PIILVGPSLKGYEVTDMMQKALFDFLKHLFDGRISITRVTADISLA---------RS 48 usage_00455.pdb 1 ---PIILVGPSLKGYEVTDMMQKALFDFLKHLFDGRISITRVTADISLA---------RS 48 usage_00463.pdb 1 ---PVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLA---------RS 48 usage_00531.pdb 1 -SRPVVLVGPSLKGYEVTD--QKALFDFLKHRFDGRISITRVTADISLAK---------S 48 usage_00532.pdb 1 -SRPVVLVGPSLKGYEVTD--QKALFDFLKHRFDGRISITRVTADISLAK---------S 48 P LVGPSLKGYEVTD QKALFDFLKH F GRISITRVTAD SLA usage_00199.pdb 56 SLAEVQSEIERIFELARTLQLVVLD--- 80 usage_00200.pdb 58 SLAEVQSEIERIFELARTLQLVVLD--- 82 usage_00255.pdb 50 SIAEVQSEIERIFELAKSLQLVVLD--- 74 usage_00256.pdb 46 SIAEVQSEIERIFELAKSLQLVVLD--- 70 usage_00257.pdb 47 SIAEVQSEIERIFELAKSLQLVVLD--- 71 usage_00337.pdb 58 SLAEVQSEIERIFELARTLQLVVLDA-- 83 usage_00454.pdb 49 SLAEVQSEIERIFELARTLQLVALDADT 76 usage_00455.pdb 49 SLAEVQSEIERIFELARTLQLVALD--- 73 usage_00463.pdb 49 SLAEVQSEIERIFELARTLQLVVLD--- 73 usage_00531.pdb 49 SLAEVQSEIERIFELARSLQLVVLD--- 73 usage_00532.pdb 49 SLAEVQSEIERIFELARSLQLVVLD--- 73 S AEVQSEIERIFELA LQLV LD #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################