################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:12 2021 # Report_file: c_0779_19.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00080.pdb # 2: usage_00081.pdb # 3: usage_00082.pdb # 4: usage_00083.pdb # 5: usage_00089.pdb # 6: usage_00090.pdb # 7: usage_00107.pdb # # Length: 73 # Identity: 33/ 73 ( 45.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 50/ 73 ( 68.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 6/ 73 ( 8.2%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00080.pdb 1 GAAAVPGPFGAGKTVVQHQIAKWSDVDLVVYVGCGERGNE-TDVVNEFPELIDP-NTGE- 57 usage_00081.pdb 1 GAAAVPGPFGAGKTVVQHQIAKWSDVDLVVYVGCGERGNE-TDVVNEFPELIDP-NTGE- 57 usage_00082.pdb 1 GAAAVPGPFGAGKTVVQHQIAKWSDVDLVVYVGCGERGNE-TDVVNEFPELIDP-NTGE- 57 usage_00083.pdb 1 GAAAVPGPFGAGKTVVQHQIAKWSDVDLVVYVGCGERGNEMTDVVNEFPELIDP-NTGE- 58 usage_00089.pdb 1 GTAAIPGPFGSGKTVTQQSLAKWSNADVVVYVGCGERGNEMTDVLVEFPELTDP-KTGG- 58 usage_00090.pdb 1 GTAAIPGPFGSGKTVTQQSLAKWSNADVVVYVGCGERGNEMTDVLVEFPELTDP-KTGG- 58 usage_00107.pdb 1 -TTCIPGAFGCGKTVISQSLSKYSNSDAIIYVGCGERGNEMAEVLMEFPELYTEMSGTKE 59 aa PGpFG GKTV q aKwS D vvYVGCGERGNE tdV EFPEL dp tg usage_00080.pdb 58 SL-ERTVLIANT- 68 usage_00081.pdb 58 SL-ERTVLIANT- 68 usage_00082.pdb 58 SL-ERTVLIANT- 68 usage_00083.pdb 59 SLMERTVLIANT- 70 usage_00089.pdb 59 PLMHRTVLIANTS 71 usage_00090.pdb 59 PLMHRTVLIANTS 71 usage_00107.pdb 60 PIMKRTTLVANTS 72 l RTvLiANT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################