################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 01:54:45 2021 # Report_file: c_1345_17.html ################################################################################################ #==================================== # Aligned_structures: 17 # 1: usage_00034.pdb # 2: usage_00035.pdb # 3: usage_00129.pdb # 4: usage_00130.pdb # 5: usage_00131.pdb # 6: usage_00321.pdb # 7: usage_00322.pdb # 8: usage_00323.pdb # 9: usage_00324.pdb # 10: usage_00325.pdb # 11: usage_00326.pdb # 12: usage_00327.pdb # 13: usage_00328.pdb # 14: usage_00449.pdb # 15: usage_00454.pdb # 16: usage_00504.pdb # 17: usage_00505.pdb # # Length: 41 # Identity: 38/ 41 ( 92.7%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 38/ 41 ( 92.7%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 2/ 41 ( 4.9%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00034.pdb 1 --ESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKLADMT 39 usage_00035.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKLADMT 41 usage_00129.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 41 usage_00130.pdb 1 -VESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 40 usage_00131.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 41 usage_00321.pdb 1 -VESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 40 usage_00322.pdb 1 --ESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 39 usage_00323.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 41 usage_00324.pdb 1 --ESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 39 usage_00325.pdb 1 --ESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 39 usage_00326.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 41 usage_00327.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 41 usage_00328.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 41 usage_00449.pdb 1 -VESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 40 usage_00454.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKLADMT 41 usage_00504.pdb 1 --ESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 39 usage_00505.pdb 1 DVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMT 41 ESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKK ADMT #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################