################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:42:12 2021 # Report_file: c_0779_39.html ################################################################################################ #==================================== # Aligned_structures: 7 # 1: usage_00151.pdb # 2: usage_00180.pdb # 3: usage_00194.pdb # 4: usage_00251.pdb # 5: usage_00254.pdb # 6: usage_00255.pdb # 7: usage_00256.pdb # # Length: 93 # Identity: 4/ 93 ( 4.3%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 12/ 93 ( 12.9%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 50/ 93 ( 53.8%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00151.pdb 1 NCLIMTTEILRSM-LYR------GADLIR--DVEFVIFDE--VH-YV--NDQDRGVVWEE 46 usage_00180.pdb 1 DIILTTYAVLLRDT------------RLKEVEWKYIVIDEAQNIK--NPQT-K---IFKA 42 usage_00194.pdb 1 DIIISTAQILENS-LLN-----GV--QLS--DFSLIIIDE--C-------------VYNN 35 usage_00251.pdb 1 DVVICTAQILQNA-LLSGEEEARV--ELT--DFSLLVIDE--CH---HTQKEA---VYNK 47 usage_00254.pdb 1 DVVICTAQILQNA-LLSGEEEARV--ELT--DFSLLVIDE--CH---HTQKEA---VYNK 47 usage_00255.pdb 1 DVIICTAQILENS-LLN----ESV--RLS--DFSLIIIDQ--CH---HTQKEG---VYNN 43 usage_00256.pdb 1 DVIICTAQILENS-LLN----ESV--RLS--DFSLIIIDQ--CH---HTQKEG---VYNN 43 d i T iL l d iD v usage_00151.pdb 47 VIIMLPQ------------------HVKFILLS 61 usage_00180.pdb 43 VKELK--------------------SKYRIALT 55 usage_00194.pdb 36 IMRHYL-MQKLKNNRLKKENKPVIPLPQILGLT 67 usage_00251.pdb 48 IMLSYL-QKKLSG---------QRDLPQILGLT 70 usage_00254.pdb 48 IMLSYL-QKKLSG---------QRDLPQILGLT 70 usage_00255.pdb 44 IMRRYL-KEKIKN---------RP-QPQILGLT 65 usage_00256.pdb 44 IMRRYL-KEKIKN---------RP-QPQILGLT 65 Lt #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################