################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Wed Jan 20 23:19:58 2021 # Report_file: c_1373_245.html ################################################################################################ #==================================== # Aligned_structures: 5 # 1: usage_00313.pdb # 2: usage_00834.pdb # 3: usage_01251.pdb # 4: usage_01394.pdb # 5: usage_01874.pdb # # Length: 72 # Identity: 3/ 72 ( 4.2%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 11/ 72 ( 15.3%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 14/ 72 ( 19.4%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00313.pdb 1 --------RERSRGMLDELVDAMLRAGPPADLTEAVLSPFPIAVICELMGVPATDRHSMH 52 usage_00834.pdb 1 TRKRVKDKEASIAALCDTLIDAVCE-RGECDFVRDLAAPLPMAVIGDMLGVRPEQRDMFL 59 usage_01251.pdb 1 THRKIRRMAPYIEQIVTERLDEMEREGSPADLIELFADEVPGPVLCELLGVPRDDRAMFL 60 usage_01394.pdb 1 --------EPKVQAVARKLMESLRP-RGSCDFVSDFAEILPLNIFLTLIDVPLEDRPRLR 51 usage_01874.pdb 1 TQRRMRRLAPRIEEIVTDRLDAMEQAGPPADLIELFADEVPGAVLCELIGVPRDDQAMFL 60 d D a P v l gVp dr usage_00313.pdb 53 TWTQLI-LS--- 60 usage_00834.pdb 60 RWSDDL-VTFLS 70 usage_01251.pdb 61 QLCHRH-LD--- 68 usage_01394.pdb 52 QLGVQLTR---- 59 usage_01874.pdb 61 QLCHRH-L---- 67 #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################