################################################################################################ # Program: MUSTANG v3.2.3: A Multiple structural alignment algorithm # Authors: A. S. Konagurthu, J. C. Whisstock, and P. J. Stuckey, A. M. Lesk # Rundate: Thu Jan 21 00:25:41 2021 # Report_file: c_0888_81.html ################################################################################################ #==================================== # Aligned_structures: 10 # 1: usage_00147.pdb # 2: usage_00296.pdb # 3: usage_00457.pdb # 4: usage_00458.pdb # 5: usage_00623.pdb # 6: usage_00625.pdb # 7: usage_00627.pdb # 8: usage_00629.pdb # 9: usage_00694.pdb # 10: usage_00866.pdb # # Length: 71 # Identity: 60/ 71 ( 84.5%) (Calculated as the percentage of conserved columns in the alignment.) # Similarity: 60/ 71 ( 84.5%) (Calculated as the percentage of semi-conserved columns in the alignment) # Gaps: 4/ 71 ( 5.6%) (Calculated as the percentage of columns with atleast one gap.) #===========================================ALIGNMENT START========================================= usage_00147.pdb 1 GALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 60 usage_00296.pdb 1 --LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 58 usage_00457.pdb 1 --LPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQ 58 usage_00458.pdb 1 --LPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQ 58 usage_00623.pdb 1 --LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 58 usage_00625.pdb 1 --LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 58 usage_00627.pdb 1 --LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 58 usage_00629.pdb 1 --LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 58 usage_00694.pdb 1 --LPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 58 usage_00866.pdb 1 --LPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQ 58 LPALVQLLSSPNEQILQEALW L NIASGGNEQKQAVKEAGA LEQLQS NEKIQ usage_00147.pdb 61 KEAQEALEKL- 70 usage_00296.pdb 59 KEAQEALEKL- 68 usage_00457.pdb 59 KEAQEALEKIQ 69 usage_00458.pdb 59 KEAQEALEK-- 67 usage_00623.pdb 59 KEAQEALEKLQ 69 usage_00625.pdb 59 KEAQEALEKL- 68 usage_00627.pdb 59 KEAQEALEKLQ 69 usage_00629.pdb 59 KEAQEALEKL- 68 usage_00694.pdb 59 KEAQEALEKLQ 69 usage_00866.pdb 59 KEAQEALEKLQ 69 KEAQEALEK #=========================================ALIGNMENT END============================================= #LEGEND: # # Colours indicate the chemical nature of the amino acid; # Red = small hydrophobic including aromatic,{A,F,I,L,M,P,V,W} # Blue = Acidic,{D,E} # Magenta = Basic,{K,R} and # Green = Basic amino acids with hydroxyl groups and/or amine groups {C,G,H,N,Q,S,T,Y}. # # The "markup row" below each stretch of the multiple alignment is used to mark completely conserved # residue (denoted in UPPERCASE) and semi-conserved reside ( denoted in lowercase) in a column of the alignment. # ################################################EOF#################################################